2ZVNA

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords UBC protein
total genus 32
structure length 148
sequence length 148
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA01
4BFRA 4JL9A 2IZVB 2O6VD 4BKSA 4M8NA 2K8BA 1GC6A 1WJUA 4GMVA 3TIXA 3V61A 2K8CA 3DBSA 1R4NI 3N32A 4FJYA 2MBQA 2M0XA 4F7ZA 3PREA 1L7YA 3DQVA 1ZKHA 2BYEA 2PEAA 2W9NA 3PVLA 1OEYA 2ZVNA 3L10B 4W9EA 3N30A 1KOTA 3PZDA 4P7IA 3TL5A 4W9HA 1FXTB 4DDID 4NQLB 3VUYA 1JRUA 3NHEB 2FCMA 3QC8B 4J6IA 3UQBA 2ZZPB 1CMXB 4TQ1A 2BYFA 2ZNVB 3PTFC 3VTWA 3UINB 4WJPA 5DPRA 3IHPC 3VHTC 4LDTB 2GBRA 3HM6X 2HE7A 4GU2A 2LI5A 2XBBC 3VTVA 1UZXB 3QHTA 5LXHA 1WIAA 2K8HA 2RGFA 2Z0DB 2LRWA 4TQ0A 1WM2A 5LXIB 2JT4B 4GN1A 4DWFA 3VH4B 2KXJA 3X23A 2K25A 4WJQA 3PV1A 1V5TA 3QK0A 4KSKC 2D11A 2K6DB 2KMCA 3UIPB 2KTRA 3ZVVA 1PQSA 1QZEA 1HE8A 2UYZB 4IUMB 5J17A 2WX1A 3JW0X 4GGQA 1WE7A 2CHXA 2XK5B 3HM3A 3L54A 2C7MB 4M0WB 1WMHB 2O2VB 4BOZB 4HCNB 3L17A 4W9JA 3VDZA 3B0AA 2I1JA 2BWES 3RUIB 3AU4A 4B6WA 2A4ZA 2DYBA 2V3SA 2A5UA 2EMSA 4GDLB 4KDLB 2KWUB 1WX8A 2AL3A 2BWFA 3VVWB 4DDGD 2IO0B 2C9WB 3S2AA 3H1UA 2KK8A 2LVQA 3WAOA 4NAWA 2G3QB 1IP9A 3ZTDA 1GNUA 2V4LA 2O6VA 5JHAA 3JVZX 4XX5A 3PRMB 5G55A 1WGRA 3QA8A 4HCPB 3LJ3A 3QQ8B 4PS8A 1XT9B 4ZRIA 2GMIC 3W1SA 2GBMA 2NPTB 3VH3B 4K81A 1H4RA 3B08A 3PHXB 2LXCA 5JHBA 5D2MB 4BBNF 2YVCA 2N4FA 3WANA 2KQ7A 2DAJA 2GOWA 2RD0A 4RM9A 2JF5A 2ZPYA 3TCAA 3U30A 1WXVA 5JZEB 2AYOB 1WX9A 2BKFA 2PJHA 3VXWA 4B9KA 2MQJA 3AXCA 4JLCA 1WXAA 2M4NA 3A9KA 3JYUA 4KSLC 2UWQA 4FULA 5DPTA 2KJRA 3PGEA 2JY6A 2LGXA 3JSVB 3V6CB 3RT3B 1Z5SB 3DVNU 3V60A 4MELA 3A1QB 5D94A 4CYEA 3SHQA 2BGFA 3UF8A 4B95A 3KH0A 2BKRB 4N9F4 1UELA 2AL6A 2WDTB 1WE6A 3IVFA 3UGBB 2MBEA 4AP4C 4WWNA 4GIVA 3L16A 4NPNA 4IWPA 3ONSA 4AWJA 4KIKB 1XQQA 1X1MA 2NBVB 1OTRB 5HKHA 4NAWB 2V1YA 3SD5A 2KJ6A 2NBWB 2DX5B 3N3KB 4MM3A 4MSQB 4IM3A 2KFKA 4HDQA 4RMAA 4GB9A 4KVGB 2KDFB 4CHKA 4W9IA 4TKNA 3T9LA 1Q1OA 1ZGUB 4FBJB 3APDA 2N7DA 4JGHB 2YLMA 3K9OB 4I6PA 2G4SA 4AOFA 2KVRA 3IG3A 3ML8A 1S1QB 1EF5A 1UBIA 1WYWB 2N9EB 2Y5BB 5KHOA 3WIMA 3KUZA 1WI0A 2R2QA 4NNJB 3ZRFA 2EKEC 2LGYA 4EOYA 2JVCA 4MSMB 4FA6A 4ZRJA 1E8YA 1UBQA 2D07B 4KDIC 4WQOB 4DHZB 2LD9A 5AEKB 2KWVB 3R3MA 3QJZA 2ZEQA 1UD7A 2D2QA 3EHVA 4I6LB 2ZVOA 3RCZA 3PSEB 2KLGA 2L76A 1UGMA 3WALA 4HK2A 3PRPB 4EEWA 2AEHA 1I42A 4IW0A 2QHOA 4DHJD 3APCA 4FHJA 1V9JA 2AWTA 3PLUA 2XK5A 4WWPA 1R4MI 3BINA 2NS5A 5FR6A 4OVUA 2D3GA 4WJNA 2KZRA 2RPQA 1WXMA 2MW5A 3VQIA 4EKUA 3VFKA 3PRZA 1WX7A 2C7HA 2WX0A 3MHSD 4GOCA 4F8CB 2NR2A 1J19A 1L2NA 4MH0E 1WR1A 3AULA 2JWZA 1A5RA 2KANA 2BPSA 5J2RA 4EZJA 2DHZA 3BY4B 4MJSA 4AUQC 4MEMA 2KDBA 3ZO5B 3IBEA 4IC7B 4ANVA 4IWQA 4XZ4A 4IM2A 1RFAA 4NJ7A 4K1RB 3RZFA 2KX0A 4ANUA 1GJZA 5CHFA 3P2BA 4EFOA 2LZ6A 4HJKA 4W9DA 1TBEA 3VTUA 4HDOA 1E8ZA 1LFDA 2KDIA 2MP2A 3O65B 1Q0WB 4EZLA 2K39A 2CU1A 2ZCBA 5DCNA 2M8SA 5CX3A 3DVGY 1LQBA 2JRIB 1KJTA 1E7VA 3A9JA 3WA0A 3NZUA 4AJWA 4LDTD 3VUXA 4BOSC 2FCQA 2ZJDA 2VRRB 4DXAB 4EUTA 5CHWA 2LGDA 4F1SA 2M17A 2ZPNA 3VUWA 2N1VA 4E3CA 1S3SG 4KV2A 2GBNA 2KHWB 1EUVB 4ICUA 2C60A 3NS8A 2KFJA 3R7QA 3ZW3A 4W9LA 1TZ1A 5AZFA 2JXXA 2KX3A 1P98A 5E6NA 3M62B 3PS6A 3ZDMC 5J18A 1WJ6A 3MTNB 3ZNZB 3EC8A 4HPMB 2IO1B 3HK0A 3RULA 4TV3A 4JQWC 2KWCA 1IPGA 1H8CA 2CS4A 2MX2A 2DZIA 4A3OA 3ZKJC 4MGKE 4NJ6A 3Q3JA 5C23A 2IY1B 3KVFB 3QARA 3D32A 3ML9A 2J7QB 3OLMD 2EMTA 1E8XA 1V86A 4FJVB 5CHVC 1E7UA 1VCBA 1WZ0A 3DOWA 4GDKA 1E90A 4K7SA 1UH6A 4IG7B 2IY0B 1V5OA 2KQSA 3ZTCA 5C1ZA 2DENB 2KMAA 1YQBA 3DBLI 3KYCD 3QX1A 2PPHA 2HJ8A 4HPLB 3ZIMA 2L3ZA 1WXSA 2WYQA 1NBFC 4ZRKA 1K8RB 3L08A 2FNJB 3AI5A 4GSWA 1P1AA 2L05A 1V80A 4G0NB 2KOXA 4KIKA 4PS3A 1V6EA 1M94A 5IAAC 3A4SC 2KTFA 3DBHI 2O2VA 3TBLD 1E8WA 3MJWA 2PE6B 2KC1A 1WMHA 2ZNVC 3UQAA 4FHKA 3QCAA 2OJRA 3DBRI 2NCNA 4MGYE 2WWZA 1J0GA 2MBBB 3ZLZA 1SE9A 3ECIA 1P0RA 4FLHA 4WAAA 4BVUC 5EDSA 5JH5C 1TGZB 1WR6E 4HLEA 2FIFA 2O6VB 1YJ1A 3CSFA 4HVBA 2N1WA 4TUUA 3CSTA 1OEYJ 1C1YB 1NDDA 4ICVA 4AJYB 5D7GA 2FCNA 4W9KA 2C5LC 3VAWA 1OGWA 1IYFA 4G11A 1KLVA 5CTRC 4I6NB 3KUCB 2RR9A 2OOBB 2IBIB 1NI2A 5AZGA 4LCDE 2K6QA 2MWSB 1GUAB 2KJHB 1WM3A 5TR5A 1OQYA 4G3XB 4ASWC 3Q3FA 2MSED 4BKGA 4YL8A 1XD3B 2LRUA 1YX5B 1Z2MA 4BKSD 3A4RA 3A9KB 3M3JA 2DZMA 3TMPB 1V49A 1WGDA 3DPDA 4GXBA 4KZCA 3PLVA 5LLIA 2N7EA 1YX6B 4NY0A 1WF9A 1I35A 1P3QU 1LXDA 3UIOB 2MLBA 2REXA 3LDZE 4WJOA 2MP2B 3KYDD 1ZW7A 1AARA 1WGHA 3RZWC 3ZNHB 1WJ4A 3NY5A 1GG3A 1WJNA 2J0JA 3L0WB 2J0MA 4ANXA 2L8JA 4MGZE 5G2NA 1D3ZA 2ASQA 2B3AA 3QIJA 2JZ3B 3H7PA 4II2B 5GMVA 2DAFA 3W1YA 2N9XA 1E5WA 2ZCCA 2Z59B 4PYUA 2IO2B 2XEWA 2I1KA 4OVVA 4KZ0A 1WGGA 3C0RB 1Y8RC 1WZ3A 1Q5WB 2J0KA 3OJ3A 3M63B 4K7UA 2LUEA 2DYOA 2NBUA 4DHZE 4BBNC 2GBJA 2KFKB 2DZKA 4NQKE 3ZRCA 1VD2A 4JIOU 4GDLA 3DDCB 4PS7A 3OAWA 5KHQA 3RYTA 3U7DA 2CKHB 2N9PC 4DBGA 4E74A 1F9JA 2L0FA 2LVPA 2BYVE 2FAZA 2JUOA 4HXDA 1WGYA 3K9PB 5E6PA 1KM7A 2DYMA 3I3TB 3QAQA 2PE9A 1MG8A 2GBKA 2L00B 3ZNID 3NZSA 5D6JB 5AZHA 4HWIB 3T8MA 2MBOA 3H9DA 2KC2A 1EF1A 2JZZA 2NPTA 3CF6E 4MDKE 1P9DU 3PT2B 4WWOA 1WFYA 3H6NA 4DK5A 3DCGA 2MCNB 1V2YA 3A33B 3IFWB 2R2OA 3WAPA 3R7RA 1TTNA 1RLFA 2KO3A 4W9CA 3RD2A 5BO4B 4A3PA 2JPHA 2MRPA 3V62A 3HHMA 4K7WA 3W1SC 2LJ5A 5DPWA 3GOEA 2G4DB 2CHWA 3H7PB 4W9GA 4URKA 4EZKA 2L7RA 2LVOA 1V81A 3CMMB 1LM8B 3KUDB 4II3B 4IWOA 1J8CA 3EFUA 4A20A 4IM0A 3A1QA 4E71A 2L0TA 3DVNV 1WRDB 1RRBA 3HIZA 3NOBA 4FN2A 5IA7A 2DZJA 3R66C 2M1MA 1SIFA 2Z0EB 3GZNI 3L13A 3ZNGC 1WH3A 2CR5A 2C7NB 2JRHA 3B1LX 1G6JA 2MA9B 1EO6A 4W9FA 2FCSA 2BF8B 2LXAA 4GDKB 2KKCA 3APFA 1T0YA 3WAMA 1U4AA 3QWZB 4PYZA 2LASA 4G50A 3ALBA 4MGIE 3SU8X 3KW5B 3M95A 3PPAA 4XC2A 4RM8A 2HTHA 2FIDA 3TJPA 4FADA 2KNBA 4MJSB 1YD8U 1SGHA 4X57B 2D10A 2FUHB 3EECA 3ENEA 5DPSA 5E6OA 3ZUNA 4CO7A 1YIWA 1WY8A 3OJ4B 2CHZA 3PHWB 4ZDVA 1GC7A 2G45B 3JSVA 1BT0A 2LWPA 2HD5B 1ISNA 3DVGX 3U8ZA 3SDLC 1C3TA 5L95C 4LJOB 4DHJB 3AU5A 2IO3B 4LJPB 4BKTA 3H7SA 3ZDTA 4ANWA 2KD0A 2KLCA 3A9JB 2RSUA 2IYDB 4ZYNA 2KDEB 3X0WA 2KTRB 1RAXA 4M8MA 3V6EB 2NVUI 2MBHA 5L83A 2KN5A 4FJZA 2K1FA
chains in the Genus database with same CATH superfamily
1SXTA 4HROA 1I4XA 5G5GA 1GC6A 1R4NI 1QOAA 3H8HA 3DQVA 1QOGA 4Q2JA 3PVLA 1FNWA 2ZVNA 3L10B 1T0SC 4P7IA 3TL5A 1ZUD2 3Q8AA 3QC8B 5I4DA 2ZZPB 4YT0B 4TQ1A 2WGSA 4LK0M 1FFUA 1LO5D 3VTWA 3I9V1 3VHTC 1ET9A 2GBRA 4GU2A 2LI5A 2W3SA 2QCZA 2G9HD 2RGFA 2Z0DB 5HFYA 1N5WA 4L2YA 2ZW1A 2L52A 3P42A 1SE3A 1RM6C 4C7ZA 1V5TA 2D11A 3UIPB 2KTRA 1QZEA 2WX1A 1WE7A 2RPVA 2C7MB 4W9JA 4JX1C 3AE3B 2BWES 3W9CB 2A5UA 2EMSA 1ZE3D 4DDGD 1V97A 2IO0B 3WAOA 1YQ3B 5JHAA 2QILA 2E3TA 1MHHE 2QMTA 5G55A 4HCPB 1L4DB 4PS8A 3W1SA 5MPOA 1GB4A 1PYWD 2NPTB 4K81A 3OWEB 5D2MB 4A90A 5JHBA 4BBNF 3WANA 1TJEA 2ZPYA 3TCAA 2WXOA 1SEBD 2BKFA 3VXWA 2MQJA 4ZOHC 4OVZA 1YMHE 4RGOS 5DPTA 1Z5SB 4CYEA 3UF8A 4B95A 2BKRB 3BVMA 4N9F4 2WDTB 3MP9A 2JQRB 1F2RC 3L16A 4NZLB 3ONSA 4AWJA 5BYRA 2KJ6A 4MM3A 4IM3A 3Q8EA 1L0YB 1Q1OA 1ZGUB 4RGTA 3P4SB 2YLMA 3EUB2 2KAJA 2SEBD 3HRDD 1L6VA 1FPYA 3WIMA 2J52A 4N59A 1YOVB 3BK2A 3P4PB 4ZRJA 2LD9A 2KWVB 4A6QA 1CZPA 4C80A 4HK2A 4EEWA 4IW0A 4DHJD 1R7SA 3APCA 4FHJA 2AWTA 1Q10A 4WWPA 3DHIC 3BINA 2NS5A 1FIQA 3AE4B 1JROA 3VFKA 3PRZA 3UI3A 3MHSD 4F8CB 1J19A 2WU5B 2BPSA 3BY4B 4AUQC 4MEMA 3ZO5B 4IM2A 1RFAA 4ANUA 5CHFA 3EFCA 4LNIA 2MH7A 2WXGA 2KDIA 3O65B 5TSSA 3IT4B 2V0GA 1C79A 3FILB 4RCOA 2PKOA 3A9JA 4BOSC 4P1CC 1XCTL 1ZDXA 2LGDA 2M17A 3VUWA 2D3CA 2GBNA 3R7QA 2C60A 3PO0A 4ZYSA 4JPSA 2KX3A 1T5XD 3MTNB 4HPMB 2BYTA 4TV3A 1T0RC 4MGKE 4NJ6A 1RWSA 3Q3JA 5C23A 3GZNB 2N9LA 4IDIA 4ZHPA 3KVFB 1KRHA 3IT6B 3QARA 3ML9A 2J7QB 3OLMD 2EMTA 1F77A 4FJVB 5CHVC 1PFDA 3DOWA 1UH6A 4IG7B 3TUOA 2IY0B 1TT5B 2PPHA 2L3ZA 2WXKA 1UWMA 4ZRKA 1CJEA 3IXSA 4GSWA 5BMIA 4KIKA 4EE2A 2JYTA 2BW2A 1K52A 3NUHB 3UQAA 1DYQA 1WMHA 2ZNVC 1EWCA 2CJNA 3DBRI 3Q69A 4MGYE 2W3RA 2WWZA 2L1AA 4UDUC 1TGZB 1WR6E 2O6VB 3CSTA 1VLBA 1ACCA 5D7GA 3VAWA 2IJ0A 3T3OA 2L32A 5CTRC 2GB1A 2RDBC 2IBIB 2K6QA 3VR9B 2JSVX 1OQYA 2PTLA 1WXQA 4BKGA 5EE0A 4YTNB 2W82A 5HG2A 3PLVA 1WF9A 1LXDA 3KYDD 1ZW7A 3ZNHB 1WJ4A 3ZXRA 2J0MA 1XLOA 1SE2A 2H89B 5G2NA 3W2DA 4PK1A 2Z59B 5EE1A 4OVVA 4C56C 1Y8RC 1WZ3A 1P7FA 3M63B 3OJ3A 2NBUA 2GBJA 1WWTA 2JU6X 2DZKA 4LNNA 4NQKE 4JIOU 3DDCB 4PS7A 3RYTA 1SE4A 3U7DA 3AEAB 1AWDA 2N9PC 2MHJA 3N1YC 2DYMA 3I3TB 3ZNID 5D6JB 5AZHA 3T8MA 1EF1A 2NPTA 3RNGC 1TS4A 3H6NA 3WAPA 4W9CA 5BO4B 2JPHA 4K7WA 1ZDVA 2WXPA 5DPWA 2BVCA 1SF0A 2WP9B 4URKA 4EZKA 1AYFA 2LVOA 1V81A 4II3B 2KMMA 3BZDB 2L0TA 3TEXA 3HIZA 1FFVA 4XE0A 2I38A 1WH3A 2CR5A 2JRHA 2WXNA 4YTPB 3BIID 2KKCA 1U4AA 2LASA 3ALBA 4RM8A 2HTHA 2FIDA 2ICIA 4FADA 3ZUNA 1NYRA 4HRSA 4LLGM 2G45B 3JSVA 2J42A 2HD5B 1ISNA 1SBBB 5AUKA 4GLSC 4DHJB 3MHZA 3N1ZC 3H7SA 1WYGA 2KLCA 3AE2B 1XO3A 2M56B 4ZYNA 2JZPA 1FCLA 1RAXA 4M8MA 3V6EB 3AEEB 2IZVB 4BKSA 2Q5WD 1K50A 1WJUA 3TIXA 4FJYA 2M0XA 4F7ZA 2PEAA 2DLBA 1OEYA 1E10A 3PZDA 1FXTB 4DDID 3NHEB 2FBWB 2FCMA 3E9SA 1CMXB 2ZNVB 1NYQA 2WDRB 4US8A 5DPRA 1GPXA 4N6EB 3HM6X 3Q3NC 3AEDB 2XBBC 2GLSA 5LXHA 1WIAA 2K8HA 3HVZA 2LRWA 2CU3A 4TQ0A 4RF1A 4DWFA 4GN1A 2K25A 4R3DA 4S17A 3PV1A 4HPPA 4OZBA 4KSKC 3ZVVA 1PQSA 1HE8A 4IUMB 4AS1A 2K22A 2J4XA 3HM3A 1T6BX 1WMHB 1J7AA 1F2RI 2IPKD 4HCNB 2ZW0A 3VDZA 1XLPA 2I1JA 5HI1A 3GS2A 2DYBA 2V3SA 4GDLB 2MEKA 1WX8A 1TKEA 2C9WB 3H1UA 2KK8A 4NAWA 1IP9A 4J3OD 1KF6B 2V4LA 2WXFA 1WGRA 2IGHA 3RNAC 2BS2B 1H4RA 1FO4A 2YVCA 1N6ZA 2AYOB 1WX9A 4B9KA 4JLCA 3ZJUA 2UU7A 2M4NA 3A9KA 4FULA 4K3BA 1ZOYB 3V6CB 3DVNU 4MELA 3A1QB 5D94A 2BGFA 3KH0A 1V1OA 2M19A 4AP4C 4IWPA 4KIKB 2NBVB 5HKHA 4NAWB 3BVGA 2V1YA 3BK1A 2NBWB 2DX5B 3N3KB 2WLBA 4RMAA 4GB9A 4KVGB 2KDFB 3T9LA 3N9YC 1FNUA 4FBJB 2WXJA 3CIRB 3K9OB 2KVRA 3IG3A 1UBIA 1VZ6A 2Y5BB 3DWMA 3DHHC 1VDVA 4H2AA 1VZ7A 3KUZA 1WI0A 3ZRFA 2EKEC 2JVCA 4TSSA 1UBQA 4DHZB 5AEKB 3R3MA 4S0RA 3QJZA 1UD7A 3EHVA 4I6LB 2ZVOA 1A70A 1UGMA 2ONQA 2AEHA 2BT6A 4P16A 1SIJA 1TYGB 1I42A 2WHIA 3RI7C 2W54A 4XGAB 2XK5A 4KGTA 2MJEA 5FR6A 4WJNA 2KZRA 5E6JA 2LJIA 3BYTB 3VQIA 4EKUA 4GOCA 2C7HA 2WX0A 3PZ7A 3Q2AC 3RFZB 1MG4A 2NR2A 1EM7A 2JWZA 2MJDA 2KANA 4K3CA 1IUEA 4EZJA 2KDBA 3LB8C 1TS5A 5H92C 4BZAA 1GJZA 3AV8A 3P2BA 2KQ4X 3AE8B 2LZ6A 1TBEA 3VTUA 2V3NA 1Q0WB 4EZLA 3U7ZA 2EKIA 3EGRA 2V9HA 3KWVA 5DCNA 1QLBB 4LDTD 1B1ZA 2N1VA 4E3CA 4KV2A 2KACA 4ICUA 3NS8A 4W9LA 1P98A 5E6NA 3M62B 3EC8A 2IO1B 3HK0A 3RULA 3B9JA 3Q3MC 3GE3C 4JQWC 2KWCA 3GE8C 4A3OA 2N9KA 2WNMA 1HTOA 4A9AA 4ARCA 3CWIA 1ENFA 4XYCA 1V86A 1NVID 1E7UA 1VCBA 4GDKA 1C9FA 4WIPA 3AE6B 2MJ3A 1Y56A 4XDCA 3BVZA 1YJIA 2HJ8A 1WXSA 2KYWA 2WU2B 2WYQA 1NBFC 3J9CA 3L08A 3AEGB 4G0NB 4PS3A 1DOYA 5IAAC 5C2TB 3A4SC 3TBLD 1QOFA 3MJWA 2PE6B 4C7YA 3DHGC 4FHKA 1B9RA 4PT5A 4WQMA 4CQNA 2OJRA 1FXIA 1SE9A 2BS4B 4WAAA 5JH5C 1OEYJ 1NDDA 2C5LC 5IP4D 1OGWA 2XN9C 1NI2A 5AZGA 2MWSB 1ZPSA 2IGDA 3BYYB 2MSED 4YL8A 1XD3B 2LRUA 1Z2MA 1N63A 3A9KB 1JW9D 3TMPB 1V49A 1I35A 3RN9C 2N7EA 4NY0A 1TKYA 1P3QU 1ZP0B 3Q14C 2MP2B 2WDVB 1XLQA 1AARA 1WGHA 3AB5A 2JXTA 3SEBA 1FRDA 1HA5A 3NS1A 1GG3A 1FM0D 4ANXA 2L8JA 4MGZE 1D3ZA 3QIJA 1QILA 3RMKC 3ZJVA 2N9XA 1E5WA 3C8YA 4PYUA 1YN5A 1WGGA 3C0RB 4REZA 1N61A 2J0KA 1BUIC 2LUEA 2DYOA 4C4VB 4JWSC 2G1EA 4IOIE 5HHDG 2KFKB 1JWMD 1MHXA 1VD2A 4DXFA 3OAWA 1MPEA 1QF6A 4DBGA 4E74A 2L0FA 2JWUA 2AX5A 4HXDA 5E6PA 1KM7A 3QAQA 1V1PA 2PE9A 1MG8A 2L00B 1IGDA 1V8CA 3KLSX 3H9DA 2Z8LA 1QOBA 1GB1A 3CF6E 1P9DU 3I57A 1WFYA 1PGAA 2PVGC 2MCNB 2M0AA 1V2YA 2R2OA 1RLFA 1SJHD 1F52A 2MRPA 3NJTA 3W1SC 1UUPA 2CHWA 3TEZA 3CMMB 1LM8B 2VH1A 2FE8A 4P1BC 4IM0A 3DVNV 1WRDB 5IA7A 2VZKB 4A8XC 1CQVA 1ZXHA 3R66C 1J7BA 3VR8B 2Z0EB 3GZNI 1G6JA 1PGBA 1JALA 2KN4A 2MA9B 4W9FA 3WAMA 3I5JC 4HKQA 1VZ8A 1VR9A 2KNBA 4JWUC 4MJSB 1QQRA 4X57B 2D10A 2FUHB 3EECA 3NVVA 5DPSA 2LEKA 2LHEA 4CO7A 4RGMA 1WY8A 2CHZA 3Q8FA 1F1HA 3VRAB 4B0MA 3AH7A 1K53A 3SDLC 1HEZE 5IO9A 3OG5A 4ANWA 2KD0A 3Q3OC 2WDQB 1QKZA 2FUG1 2NVUI 2MBHA 5L83A 2KN5A 1P7EA 2O6VD 2R61A 5JXVA 3U52E 2HDEA 1KLUD 4GMVA 2K8CA 3DBSA 4JE3B 2INDC 3N32A 2MBQA 1L7YA 1KOTA 2QEJC 1GAQB 3N30A 2K0PA 4W9HA 1YN4A 3VUYA 2OEDA 4RF0A 2DBYA 3PTFC 3UINB 3IHPC 2QJLA 4LDTB 2OJWA 1EU4A 3AE1B 3QHTA 2LHDA 4RH6A 1WM2A 5LXIB 2KXJA 3X23A 4BAXA 3IAM1 4DXGA 3I63C 3QK0A 3NRZA 2KMCA 5AUIA 2UYZB 5J17A 3JW0X 4GGQA 2XK5B 4M0WB 2O2VB 4BOZB 3L17A 3B0AA 3RUIB 4FXCA 2EELA 4KGSA 4B6WA 1L6UA 4KDLB 2KWUB 3VVWB 2AL3A 4KX6B 5FR3A 3S2AA 4YSZB 2LVQA 1SSNA 1GNUA 3V05A 1DOIA 2O6VA 4LNOA 1M4VA 3JVZX 1I4RA 2VZKD 3QA8A 3PRMB 3QQ8B 4D2KA 2GBMA 3R8BA 3VH3B 3B08A 3PHXB 3U2SC 2DAJA 2KQ7A 2GOWA 2RD0A 3P1MA 4RM9A 1JQ4A 1WXVA 5JZEB 2SAKA 3AE9B 3JYUA 2KT7A 4KSLC 2UWQA 4LNFA 2KJRA 2JX5A 2JY6A 4LTUA 3JSVB 3V60A 2LFIA 5BMGA 1T3QA 3SHQA 1HXYD 2DNFA 5IN7A 4RGNA 1UELA 2AL6A 3IVFA 1ET6A 2MBEA 4WWNA 3Q8CA 2AQ2B 3DBHB 1I4QA 1D5ZC 1STEA 2ACZB 1XQQA 1X1MA 1OTRB 3AECB 3SFEB 3FC4A 4XWWA 3MC9A 2KFKA 3U4EG 2VH2A 4JGHB 1I4GA 2W55A 4I6PA 2G4SA 4AOFA 2H88B 2AQ3B 1IGCA 3ML8A 1JRPA 1S1QB 1EF5A 1WYWB 2N9EB 2WXRA 1XEEA 3SR6A 2BB6A 2PVOD 4L1BA 2R2QA 4NNJB 4MSMB 4FA6A 1E8YA 1L5PA 4KDIC 4WQOB 2PW9A 1SJED 2ZEQA 1FCCC 2KLGA 2L76A 3PLUA 2X38A 4OVUA 2D3GA 1J7CA 1WGKA 1WXMA 2MW5A 1WX7A 2RDGA 1WR1A 3AULA 3FKYA 5J2RA 3Q6BA 2DHZA 4MJSA 1C4AA 1LGRA 2NMQA 2GI9A 4IC7B 1E7PB 4XZ4A 3TEYA 4NJ7A 4K1RB 3NVWA 3RZFA 2KX0A 3EA6A 2PIAA 2K5PA 1XCQL 2AQ1B 4HJKA 4USAA 4HDOA 1E8ZA 1LFDA 2MP2A 1PUTA 3AE7B 2K39A 2CU1A 1JCKB 3DVGY 4OZCA 4AJWA 3NZUA 3VUXA 2FCQA 2Y5CA 5BMHA 2NTTA 2YEPF 2ZPNA 4OW0A 2WXHA 1S3SG 1EUVB 2KFJA 1EWYC 2Y5PA 1TZ1A 5AZFA 3ZDMC 5J18A 1WJ6A 3ZNZB 1L4ZB 1H8CA 2CS4A 2MX2A 3ZKJC 1MI0A 1I4PA 4A55A 3KWLA 1YQ4B 3D32A 3AN1A 4QAYA 4LNKA 1E90A 4K7SA 3ZTCA 1UWXA 4OHJA 3KYCD 1YQBA 1AW7A 3DBLI 3QX1A 3ZIMA 1BXTA 1OQRA 1IBXB 1K8RB 3AEFB 3AI5A 1P1AA 2L05A 1V6EA 1I7HA 2K3UA 1M94A 2LGSA 5T8IA 2KTFA 4B0EA 2O2VA 1TIFA 3QCAA 1MFWA 4C00A 2NCNA 2LMCA 1J0GA 2PMVA 3ECIA 4FLHA 5EDSA 4HLEA 2FIFA 1BMLC 1YJ1A 5BYQA 4HVBA 1R4NB 1C1YB 4AJYB 4W9KA 2KVZA 4G11A 4I6NB 3KUCB 4ZRQA 2OOBB 3URYA 4LCDE 1GUAB 4ZRPA 2KJHB 1QT9A 5TR5A 4G3XB 1HZ5A 3M3JA 4HEA1 1WGDA 5LLIA 3B2GA 1WSPA 3MC0B 1YX6B 1HQRD 4WAFA 1TY2A 2MLBA 4WH4A 1DGJA 3RNFC 3RZWC 2J0JA 2LUMA 3MJ5A 2V3PA 5GMVA 2B3AA 3H7PA 2ZCCA 1N5XA 3KQ4A 3SFDB 4KZ0A 1JWBD 1Q5WB 4MM3B 4DHZE 3RNBC 4BBNC 2IGGA 1TY0A 2L83A 3ZRCA 3L4PA 4MH8A 2CKHB 1F9JA 5EE3A 2LVPA 2BYVE 2JUOA 1WGYA 2LGIA 2INCC 2GBKA 3LYYA 3P63A 3NZSA 4HWIB 4RNAA 3Q8BA 4WWOA 3W5UB 1RYJA 1PDXA 3A33B 3IFWB 3R7RA 1TTNA 1XLNA 4A3PA 1FD6A 4AQ7A 3ETRA 3GOEA 2INPE 2G4DB 3H7PB 1T0QC 4MACA 1J8CA 1D5XC 3RPFC 3EFUA 4A20A 4E71A 5BYSA 4L23A 4FN2A 3NOBA 2M1MA 1SIFA 3ZNGC 3L13A 3B1LX 2C7NB 1FMAD 2FCSA 2LXAA 4GDKB 3APFA 1T0YA 2KWDA 3RNCC 4G50A 4MGIE 3KW5B 3TJPA 1YD8U 1SGHA 5E6OA 3ENEA 4NJCA 1UF0A 1GC7A 1SB3C 4US9A 2LWPA 3R2IA 1C3TA 1L0VB 4BKTA 2NTSA 3C19A 3A9JB 2RSUA 3W5VB 2KDEB 3X0WA 1NENB 1NI3A 3V3XA 4WWMA 4FJZA 2K1FA 3RNEC 4BFRA 4JL9A 4M8NA 2K8BA 2QSDA 3AEBB 3V61A 3PREA 1ZKHA 2BYEA 2W9NA 4W9EA 4NQLB 1JRUA 3N1XC 4J6IA 3UQBA 2XNAC 2BYFA 2J53A 5GXGB 1C76A 2QDFA 2N7JA 4WJPA 4ARIA 4ZHOA 2HE7A 2IDYA 3VTVA 1UZXB 3ZYYX 2B76B 2N0SB 2JT4B 4KGRA 1XF5L 3VH4B 4XDDA 2GRIA 1IBXA 3NZ3A 3O13A 4WJQA 5LNK1 1HZ6A 2K6DB 1OFFA 2CHXA 2K9XA 3ABVB 5EE9A 3L54A 3AU4A 3FILA 2A4ZA 2BWFA 1KH0A 2G3QB 3ZTDA 2WXIA 4XX5A 1ESFA 1D5MC 3LJ3A 1XT9B 4ZRIA 2GMIC 2LXCA 4M00A 2N4FA 1AN8A 2JF5A 3U30A 4MT5A 2PJHA 3AE5B 3AXCA 1WXAA 1K51A 3PGEA 3MC8A 2LGXA 1C4CA 3RT3B 4P6VF 2V4IB 3UGBB 1WE6A 1N60A 2WS3B 3TEWA 4O1NA 1JWSD 1C77A 4GIVA 1YN3A 5FKAC 1MJDA 4NPNA 4YXDB 3MFGA 4KKIA 3SD5A 3DBRB 4MSQB 1TS3A 4HDQA 4CHKA 1WRIA 4W9IA 4TKNA 3APDA 3ZGZA 2N7DA 2HTME 3ZJTA 3P4QB 1RFKA 5KHOA 1ZXIA 1V1PB 1XXGA 5H8YE 4YTMB 2LGYA 4EOYA 2D07B 4KKJA 2D2QA 3RCZA 3NVZA 5IOIA 3PSEB 2WXMA 3NVYA 3WALA 3PRPB 2QHOA 1V9JA 2BS3B 1R4MI 3LXFA 1KTKA 2RPQA 5IKCM 3ZXVA 1L2NA 4MH0E 3AM9A 1A5RA 1ROEA 2WXQA 3DWGC 3IBEA 4ANVA 4IWQA 3GP7A 3N20C 4EFOA 4W9DA 1OQQA 1YJJA 3R2TA 4M0WA 2DWQA 2D5GA 1KFYB 2ZCBA 1C78A 2M8SA 5CX3A 4OZAA 1LQBA 1MVKA 1KJTA 1E7VA 2JRIB 3WA0A 4HJGE 2ZJDA 2VRRB 4DXAB 4EUTA 5CHWA 1E0ZA 4F1SA 3FAHA 1EU3A 1FRRA 2KDMA 2KHWB 3ZW3A 2JXXA 2QC8A 3PS6A 2JYEA 1JWAD 1IPGA 1CK1A 2DZIA 1PGXA 1L0XB 1I4HA 3HUIA 2IY1B 1UNSA 1TS2A 1E8XA 4HKZE 1WZ0A 3TSSA 1FEHA 1V5OA 2KQSA 5C1ZA 2DENB 2BQQA 2KMAA 1E6EB 1YNTE 4HPLB 2FNJB 2INNE 4M01A 1V80A 3PZ8A 2KOXA 2E6XA 4YSYB 2BBCA 3ZQ4A 1FNVA 1TKGA 4ITKA 3DBHI 1E8WA 2KC1A 2ON8A 4M02A 2MBBB 3ZLZA 4RFBA 1P0RA 4BVUC 3CSFA 2N1WA 4TUUA 5G5HA 4ICVA 2FCNA 2WXLA 1KLVA 1IYFA 5D3DA 1E9MA 1VRAB 2RR9A 3HVDA 4XWTA 2WQYB 1KLGD 1WM3A 2I2YA 4ASWC 3Q3FA 4ACFA 1YX5B 4BKSD 3A4RA 1FXAA 2DZMA 3DPDA 4KZCA 4GXBA 3UIOB 1F0ZA 2OHFA 2REXA 3LDZE 4WJOA 2BTEA 3NY5A 1WJNA 3L0WB 2D3BA 2ASQA 2JZ3B 4II2B 4DQOC 2DAFA 3W1YA 1UGJA 2IO2B 2XEWA 2I1KA 3VRBB 2HJ1A 4YWGG 4K7UA 2D3AA 4GDLA 5KHQA 4N58A 2FAZA 2RMMA 3T3NA 3K9PB 4NAMA 5FK9C 2MBOA 2KC2A 2JZZA 4MDKE 1TZOA 3PT2B 2Y3AA 4DK5A 3DCGA 1R4MB 4IKGA 2PLPA 1C4PA 2KO3A 3RD2A 3V62A 3HHMA 1NEKB 2LJ5A 2BB5A 2YEPB 4W9GA 2L7RA 1D6EC 4IWOA 3KUDB 3A1QA 1RRBA 1JWUD 2DZJA 4C4VA 1JMLA 1EO6A 2BF8B 3AMZA 3QWZB 4PYZA 3SU8X 3M95A 3PPAA 4XC2A 2X8XX 1D4BA 1GOZA 5C3JB 1YIWA 3OJ4B 1VJKA 3P4RB 4YSXB 3PHWB 3DBLB 4ZDVA 1DOXA 2TSSA 3BWUD 3IAS1 1BT0A 3DVGX 3U8ZA 5L95C 3GB1A 4LJOB 1N62A 3B2FA 3AU5A 2IO3B 4LJPB 4TMAB 3ZDTA 2QIEB 2CJOA 1HTQA 2IYDB 4WURA 3WCQA 5D3IB 2KTRB 2RDHA 3E56A 3NG0A
chains in the Genus database with same CATH topology
4BFRA 4JL9A 2IZVB 2O6VD 4BKSA 4M8NA 2K8BA 1GC6A 1WJUA 4GMVA 3TIXA 3V61A 2K8CA 3DBSA 1R4NI 3N32A 4FJYA 2MBQA 2M0XA 4F7ZA 3PREA 1L7YA 3DQVA 1ZKHA 2BYEA 2PEAA 2W9NA 3PVLA 1OEYA 2ZVNA 3L10B 4W9EA 3N30A 1KOTA 3PZDA 4P7IA 3TL5A 4W9HA 1FXTB 4DDID 4NQLB 3VUYA 1JRUA 3NHEB 2FCMA 3QC8B 4J6IA 3UQBA 2ZZPB 1CMXB 4TQ1A 2BYFA 2ZNVB 3PTFC 3VTWA 3UINB 4WJPA 5DPRA 3IHPC 3VHTC 4LDTB 2GBRA 3HM6X 2HE7A 4GU2A 2LI5A 2XBBC 3VTVA 1UZXB 3QHTA 5LXHA 1WIAA 2K8HA 2RGFA 2Z0DB 2LRWA 4TQ0A 1WM2A 5LXIB 2JT4B 4GN1A 4DWFA 3VH4B 2KXJA 3X23A 2K25A 4WJQA 3PV1A 1V5TA 3QK0A 4KSKC 2D11A 2K6DB 2KMCA 3UIPB 2KTRA 3ZVVA 1PQSA 1QZEA 1HE8A 2UYZB 4IUMB 5J17A 2WX1A 3JW0X 4GGQA 1WE7A 2CHXA 2XK5B 3HM3A 3L54A 2C7MB 4M0WB 1WMHB 2O2VB 4BOZB 4HCNB 3L17A 4W9JA 3VDZA 3B0AA 2I1JA 2BWES 3RUIB 3AU4A 4B6WA 2A4ZA 2DYBA 2V3SA 2A5UA 2EMSA 4GDLB 4KDLB 2KWUB 1WX8A 2AL3A 2BWFA 3VVWB 4DDGD 2IO0B 2C9WB 3S2AA 3H1UA 2KK8A 2LVQA 3WAOA 4NAWA 2G3QB 1IP9A 3ZTDA 1GNUA 2V4LA 2O6VA 5JHAA 3JVZX 4XX5A 3PRMB 5G55A 1WGRA 3QA8A 4HCPB 3LJ3A 3QQ8B 4PS8A 1XT9B 4ZRIA 2GMIC 3W1SA 2GBMA 2NPTB 3VH3B 4K81A 1H4RA 3B08A 3PHXB 2LXCA 5JHBA 5D2MB 4BBNF 2YVCA 2N4FA 3WANA 2KQ7A 2DAJA 2GOWA 2RD0A 4RM9A 2JF5A 2ZPYA 3TCAA 3U30A 1WXVA 5JZEB 2AYOB 1WX9A 2BKFA 2PJHA 3VXWA 4B9KA 2MQJA 3AXCA 4JLCA 1WXAA 2M4NA 3A9KA 3JYUA 4KSLC 2UWQA 4FULA 5DPTA 2KJRA 3PGEA 2JY6A 2LGXA 3JSVB 3V6CB 3RT3B 1Z5SB 3DVNU 3V60A 4MELA 3A1QB 5D94A 4CYEA 3SHQA 2BGFA 3UF8A 4B95A 3KH0A 2BKRB 4N9F4 1UELA 2AL6A 2WDTB 1WE6A 3IVFA 3UGBB 2MBEA 4AP4C 4WWNA 4GIVA 3L16A 4NPNA 4IWPA 3ONSA 4AWJA 4KIKB 1XQQA 1X1MA 2NBVB 1OTRB 5HKHA 4NAWB 2V1YA 3SD5A 2KJ6A 2NBWB 2DX5B 3N3KB 4MM3A 4MSQB 4IM3A 2KFKA 4HDQA 4RMAA 4GB9A 4KVGB 2KDFB 4CHKA 4W9IA 4TKNA 3T9LA 1Q1OA 1ZGUB 4FBJB 3APDA 2N7DA 4JGHB 2YLMA 3K9OB 4I6PA 2G4SA 4AOFA 2KVRA 3IG3A 3ML8A 1S1QB 1EF5A 1UBIA 1WYWB 2N9EB 2Y5BB 5KHOA 3WIMA 3KUZA 1WI0A 2R2QA 4NNJB 3ZRFA 2EKEC 2LGYA 4EOYA 2JVCA 4MSMB 4FA6A 4ZRJA 1E8YA 1UBQA 2D07B 4KDIC 4WQOB 4DHZB 2LD9A 5AEKB 2KWVB 3R3MA 3QJZA 2ZEQA 1UD7A 2D2QA 3EHVA 4I6LB 2ZVOA 3RCZA 3PSEB 2KLGA 2L76A 1UGMA 3WALA 4HK2A 3PRPB 4EEWA 2AEHA 1I42A 4IW0A 2QHOA 4DHJD 3APCA 4FHJA 1V9JA 2AWTA 3PLUA 2XK5A 4WWPA 1R4MI 3BINA 2NS5A 5FR6A 4OVUA 2D3GA 4WJNA 2KZRA 2RPQA 1WXMA 2MW5A 3VQIA 4EKUA 3VFKA 3PRZA 1WX7A 2C7HA 2WX0A 3MHSD 4GOCA 4F8CB 2NR2A 1J19A 1L2NA 4MH0E 1WR1A 3AULA 2JWZA 1A5RA 2KANA 2BPSA 5J2RA 4EZJA 2DHZA 3BY4B 4MJSA 4AUQC 4MEMA 2KDBA 3ZO5B 3IBEA 4IC7B 4ANVA 4IWQA 4XZ4A 4IM2A 1RFAA 4NJ7A 4K1RB 3RZFA 2KX0A 4ANUA 1GJZA 5CHFA 3P2BA 4EFOA 2LZ6A 4HJKA 4W9DA 1TBEA 3VTUA 4HDOA 1E8ZA 1LFDA 2KDIA 2MP2A 3O65B 1Q0WB 4EZLA 2K39A 2CU1A 2ZCBA 5DCNA 2M8SA 5CX3A 3DVGY 1LQBA 2JRIB 1KJTA 1E7VA 3A9JA 3WA0A 3NZUA 4AJWA 4LDTD 3VUXA 4BOSC 2FCQA 2ZJDA 2VRRB 4DXAB 4EUTA 5CHWA 2LGDA 4F1SA 2M17A 2ZPNA 3VUWA 2N1VA 4E3CA 1S3SG 4KV2A 2GBNA 2KHWB 1EUVB 4ICUA 2C60A 3NS8A 2KFJA 3R7QA 3ZW3A 4W9LA 1TZ1A 5AZFA 2JXXA 2KX3A 1P98A 5E6NA 3M62B 3PS6A 3ZDMC 5J18A 1WJ6A 3MTNB 3ZNZB 3EC8A 4HPMB 2IO1B 3HK0A 3RULA 4TV3A 4JQWC 2KWCA 1IPGA 1H8CA 2CS4A 2MX2A 2DZIA 4A3OA 3ZKJC 4MGKE 4NJ6A 3Q3JA 5C23A 2IY1B 3KVFB 3QARA 3D32A 3ML9A 2J7QB 3OLMD 2EMTA 1E8XA 1V86A 4FJVB 5CHVC 1E7UA 1VCBA 1WZ0A 3DOWA 4GDKA 1E90A 4K7SA 1UH6A 4IG7B 2IY0B 1V5OA 2KQSA 3ZTCA 5C1ZA 2DENB 2KMAA 1YQBA 3DBLI 3KYCD 3QX1A 2PPHA 2HJ8A 4HPLB 3ZIMA 2L3ZA 1WXSA 2WYQA 1NBFC 4ZRKA 1K8RB 3L08A 2FNJB 3AI5A 4GSWA 1P1AA 2L05A 1V80A 4G0NB 2KOXA 4KIKA 4PS3A 1V6EA 1M94A 5IAAC 3A4SC 2KTFA 3DBHI 2O2VA 3TBLD 1E8WA 3MJWA 2PE6B 2KC1A 1WMHA 2ZNVC 3UQAA 4FHKA 3QCAA 2OJRA 3DBRI 2NCNA 4MGYE 2WWZA 1J0GA 2MBBB 3ZLZA 1SE9A 3ECIA 1P0RA 4FLHA 4WAAA 4BVUC 5EDSA 5JH5C 1TGZB 1WR6E 4HLEA 2FIFA 2O6VB 1YJ1A 3CSFA 4HVBA 2N1WA 4TUUA 3CSTA 1OEYJ 1C1YB 1NDDA 4ICVA 4AJYB 5D7GA 2FCNA 4W9KA 2C5LC 3VAWA 1OGWA 1IYFA 4G11A 1KLVA 5CTRC 4I6NB 3KUCB 2RR9A 2OOBB 2IBIB 1NI2A 5AZGA 4LCDE 2K6QA 2MWSB 1GUAB 2KJHB 1WM3A 5TR5A 1OQYA 4G3XB 4ASWC 3Q3FA 2MSED 4BKGA 4YL8A 1XD3B 2LRUA 1YX5B 1Z2MA 4BKSD 3A4RA 3A9KB 3M3JA 2DZMA 3TMPB 1V49A 1WGDA 3DPDA 4GXBA 4KZCA 3PLVA 5LLIA 2N7EA 1YX6B 4NY0A 1WF9A 1I35A 1P3QU 1LXDA 3UIOB 2MLBA 2REXA 3LDZE 4WJOA 2MP2B 3KYDD 1ZW7A 1AARA 1WGHA 3RZWC 3ZNHB 1WJ4A 3NY5A 1GG3A 1WJNA 2J0JA 3L0WB 2J0MA 4ANXA 2L8JA 4MGZE 5G2NA 1D3ZA 2ASQA 2B3AA 3QIJA 2JZ3B 3H7PA 4II2B 5GMVA 2DAFA 3W1YA 2N9XA 1E5WA 2ZCCA 2Z59B 4PYUA 2IO2B 2XEWA 2I1KA 4OVVA 4KZ0A 1WGGA 3C0RB 1Y8RC 1WZ3A 1Q5WB 2J0KA 3OJ3A 3M63B 4K7UA 2LUEA 2DYOA 2NBUA 4DHZE 4BBNC 2GBJA 2KFKB 2DZKA 4NQKE 3ZRCA 1VD2A 4JIOU 4GDLA 3DDCB 4PS7A 3OAWA 5KHQA 3RYTA 3U7DA 2CKHB 2N9PC 4DBGA 4E74A 1F9JA 2L0FA 2LVPA 2BYVE 2FAZA 2JUOA 4HXDA 1WGYA 3K9PB 5E6PA 1KM7A 2DYMA 3I3TB 3QAQA 2PE9A 1MG8A 2GBKA 2L00B 3ZNID 3NZSA 5D6JB 5AZHA 4HWIB 3T8MA 2MBOA 3H9DA 2KC2A 1EF1A 2JZZA 2NPTA 3CF6E 4MDKE 1P9DU 3PT2B 4WWOA 1WFYA 3H6NA 4DK5A 3DCGA 2MCNB 1V2YA 3A33B 3IFWB 2R2OA 3WAPA 3R7RA 1TTNA 1RLFA 2KO3A 4W9CA 3RD2A 5BO4B 4A3PA 2JPHA 2MRPA 3V62A 3HHMA 4K7WA 3W1SC 2LJ5A 5DPWA 3GOEA 2G4DB 2CHWA 3H7PB 4W9GA 4URKA 4EZKA 2L7RA 2LVOA 1V81A 3CMMB 1LM8B 3KUDB 4II3B 4IWOA 1J8CA 3EFUA 4A20A 4IM0A 3A1QA 4E71A 2L0TA 3DVNV 1WRDB 1RRBA 3HIZA 3NOBA 4FN2A 5IA7A 2DZJA 3R66C 2M1MA 1SIFA 2Z0EB 3GZNI 3L13A 3ZNGC 1WH3A 2CR5A 2C7NB 2JRHA 3B1LX 1G6JA 2MA9B 1EO6A 4W9FA 2FCSA 2BF8B 2LXAA 4GDKB 2KKCA 3APFA 1T0YA 3WAMA 1U4AA 3QWZB 4PYZA 2LASA 4G50A 3ALBA 4MGIE 3SU8X 3KW5B 3M95A 3PPAA 4XC2A 4RM8A 2HTHA 2FIDA 3TJPA 4FADA 2KNBA 4MJSB 1YD8U 1SGHA 4X57B 2D10A 2FUHB 3EECA 3ENEA 5DPSA 5E6OA 3ZUNA 4CO7A 1YIWA 1WY8A 3OJ4B 2CHZA 3PHWB 4ZDVA 1GC7A 2G45B 3JSVA 1BT0A 2LWPA 2HD5B 1ISNA 3DVGX 3U8ZA 3SDLC 1C3TA 5L95C 4LJOB 4DHJB 3AU5A 2IO3B 4LJPB 4BKTA 3H7SA 3ZDTA 4ANWA 2KD0A 2KLCA 3A9JB 2RSUA 2IYDB 4ZYNA 2KDEB 3X0WA 2KTRB 1RAXA 4M8MA 3V6EB 2NVUI 2MBHA 5L83A 2KN5A 4FJZA 2K1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BFR A;  4JL9 A;  2IZV B;  2O6V D;  4BKS A;  4M8N A;  2K8B A;  1GC6 A;  1WJU A;  4GMV A;  3TIX A;  3V61 A;  2K8C A;  3DBS A;  1R4N I;  3N32 A;  4FJY A;  2MBQ A;  2M0X A;  4F7Z A;  3PRE A;  1L7Y A;  3DQV A;  1ZKH A;  2BYE A;  2PEA A;  2W9N A;  3PVL A;  1OEY A;  2ZVN A;  3L10 B;  4W9E A;  3N30 A;  1KOT A;  3PZD A;  4P7I A;  3TL5 A;  4W9H A;  1FXT B;  4DDI D;  4NQL B;  3VUY A;  1JRU A;  3NHE B;  2FCM A;  3QC8 B;  4J6I A;  3UQB A;  2ZZP B;  1CMX B;  4TQ1 A;  2BYF A;  2ZNV B;  3PTF C;  3VTW A;  3UIN B;  4WJP A;  5DPR A;  3IHP C;  3VHT C;  4LDT B;  2GBR A;  3HM6 X;  2HE7 A;  4GU2 A;  2LI5 A;  2XBB C;  3VTV A;  1UZX B;  3QHT A;  5LXH A;  1WIA A;  2K8H A;  2RGF A;  2Z0D B;  2LRW A;  4TQ0 A;  1WM2 A;  5LXI B;  2JT4 B;  4GN1 A;  4DWF A;  3VH4 B;  2KXJ A;  3X23 A;  2K25 A;  4WJQ A;  3PV1 A;  1V5T A;  3QK0 A;  4KSK C;  2D11 A;  2K6D B;  2KMC A;  3UIP B;  2KTR A;  3ZVV A;  1PQS A;  1QZE A;  1HE8 A;  2UYZ B;  4IUM B;  5J17 A;  2WX1 A;  3JW0 X;  4GGQ A;  1WE7 A;  2CHX A;  2XK5 B;  3HM3 A;  3L54 A;  2C7M B;  4M0W B;  1WMH B;  2O2V B;  4BOZ B;  4HCN B;  3L17 A;  4W9J A;  3VDZ A;  3B0A A;  2I1J A;  2BWE S;  3RUI B;  3AU4 A;  4B6W A;  2A4Z A;  2DYB A;  2V3S A;  2A5U A;  2EMS A;  4GDL B;  4KDL B;  2KWU B;  1WX8 A;  2AL3 A;  2BWF A;  3VVW B;  4DDG D;  2IO0 B;  2C9W B;  3S2A A;  3H1U A;  2KK8 A;  2LVQ A;  3WAO A;  4NAW A;  2G3Q B;  1IP9 A;  3ZTD A;  1GNU A;  2V4L A;  2O6V A;  5JHA A;  3JVZ X;  4XX5 A;  3PRM B;  5G55 A;  1WGR A;  3QA8 A;  4HCP B;  3LJ3 A;  3QQ8 B;  4PS8 A;  1XT9 B;  4ZRI A;  2GMI C;  3W1S A;  2GBM A;  2NPT B;  3VH3 B;  4K81 A;  1H4R A;  3B08 A;  3PHX B;  2LXC A;  5JHB A;  5D2M B;  4BBN F;  2YVC A;  2N4F A;  3WAN A;  2KQ7 A;  2DAJ A;  2GOW A;  2RD0 A;  4RM9 A;  2JF5 A;  2ZPY A;  3TCA A;  3U30 A;  1WXV A;  5JZE B;  2AYO B;  1WX9 A;  2BKF A;  2PJH A;  3VXW A;  4B9K A;  2MQJ A;  3AXC A;  4JLC A;  1WXA A;  2M4N A;  3A9K A;  3JYU A;  4KSL C;  2UWQ A;  4FUL A;  5DPT A;  2KJR A;  3PGE A;  2JY6 A;  2LGX A;  3JSV B;  3V6C B;  3RT3 B;  1Z5S B;  3DVN U;  3V60 A;  4MEL A;  3A1Q B;  5D94 A;  4CYE A;  3SHQ A;  2BGF A;  3UF8 A;  4B95 A;  3KH0 A;  2BKR B;  4N9F 4;  1UEL A;  2AL6 A;  2WDT B;  1WE6 A;  3IVF A;  3UGB B;  2MBE A;  4AP4 C;  4WWN A;  4GIV A;  3L16 A;  4NPN A;  4IWP A;  3ONS A;  4AWJ A;  4KIK B;  1XQQ A;  1X1M A;  2NBV B;  1OTR B;  5HKH A;  4NAW B;  2V1Y A;  3SD5 A;  2KJ6 A;  2NBW B;  2DX5 B;  3N3K B;  4MM3 A;  4MSQ B;  4IM3 A;  2KFK A;  4HDQ A;  4RMA A;  4GB9 A;  4KVG B;  2KDF B;  4CHK A;  4W9I A;  4TKN A;  3T9L A;  1Q1O A;  1ZGU B;  4FBJ B;  3APD A;  2N7D A;  4JGH B;  2YLM A;  3K9O B;  4I6P A;  2G4S A;  4AOF A;  2KVR A;  3IG3 A;  3ML8 A;  1S1Q B;  1EF5 A;  1UBI A;  1WYW B;  2N9E B;  2Y5B B;  5KHO A;  3WIM A;  3KUZ A;  1WI0 A;  2R2Q A;  4NNJ B;  3ZRF A;  2EKE C;  2LGY A;  4EOY A;  2JVC A;  4MSM B;  4FA6 A;  4ZRJ A;  1E8Y A;  1UBQ A;  2D07 B;  4KDI C;  4WQO B;  4DHZ B;  2LD9 A;  5AEK B;  2KWV B;  3R3M A;  3QJZ A;  2ZEQ A;  1UD7 A;  2D2Q A;  3EHV A;  4I6L B;  2ZVO A;  3RCZ A;  3PSE B;  2KLG A;  2L76 A;  1UGM A;  3WAL A;  4HK2 A;  3PRP B;  4EEW A;  2AEH A;  1I42 A;  4IW0 A;  2QHO A;  4DHJ D;  3APC A;  4FHJ A;  1V9J A;  2AWT A;  3PLU A;  2XK5 A;  4WWP A;  1R4M I;  3BIN A;  2NS5 A;  5FR6 A;  4OVU A;  2D3G A;  4WJN A;  2KZR A;  2RPQ A;  1WXM A;  2MW5 A;  3VQI A;  4EKU A;  3VFK A;  3PRZ A;  1WX7 A;  2C7H A;  2WX0 A;  3MHS D;  4GOC A;  4F8C B;  2NR2 A;  1J19 A;  1L2N A;  4MH0 E;  1WR1 A;  3AUL A;  2JWZ A;  1A5R A;  2KAN A;  2BPS A;  5J2R A;  4EZJ A;  2DHZ A;  3BY4 B;  4MJS A;  4AUQ C;  4MEM A;  2KDB A;  3ZO5 B;  3IBE A;  4IC7 B;  4ANV A;  4IWQ A;  4XZ4 A;  4IM2 A;  1RFA A;  4NJ7 A;  4K1R B;  3RZF A;  2KX0 A;  4ANU A;  1GJZ A;  5CHF A;  3P2B A;  4EFO A;  2LZ6 A;  4HJK A;  4W9D A;  1TBE A;  3VTU A;  4HDO A;  1E8Z A;  1LFD A;  2KDI A;  2MP2 A;  3O65 B;  1Q0W B;  4EZL A;  2K39 A;  2CU1 A;  2ZCB A;  5DCN A;  2M8S A;  5CX3 A;  3DVG Y;  1LQB A;  2JRI B;  1KJT A;  1E7V A;  3A9J A;  3WA0 A;  3NZU A;  4AJW A;  4LDT D;  3VUX A;  4BOS C;  2FCQ A;  2ZJD A;  2VRR B;  4DXA B;  4EUT A;  5CHW A;  2LGD A;  4F1S A;  2M17 A;  2ZPN A;  3VUW A;  2N1V A;  4E3C A;  1S3S G;  4KV2 A;  2GBN A;  2KHW B;  1EUV B;  4ICU A;  2C60 A;  3NS8 A;  2KFJ A;  3R7Q A;  3ZW3 A;  4W9L A;  1TZ1 A;  5AZF A;  2JXX A;  2KX3 A;  1P98 A;  5E6N A;  3M62 B;  3PS6 A;  3ZDM C;  5J18 A;  1WJ6 A;  3MTN B;  3ZNZ B;  3EC8 A;  4HPM B;  2IO1 B;  3HK0 A;  3RUL A;  4TV3 A;  4JQW C;  2KWC A;  1IPG A;  1H8C A;  2CS4 A;  2MX2 A;  2DZI A;  4A3O A;  3ZKJ C;  4MGK E;  4NJ6 A;  3Q3J A;  5C23 A;  2IY1 B;  3KVF B;  3QAR A;  3D32 A;  3ML9 A;  2J7Q B;  3OLM D;  2EMT A;  1E8X A;  1V86 A;  4FJV B;  5CHV C;  1E7U A;  1VCB A;  1WZ0 A;  3DOW A;  4GDK A;  1E90 A;  4K7S A;  1UH6 A;  4IG7 B;  2IY0 B;  1V5O A;  2KQS A;  3ZTC A;  5C1Z A;  2DEN B;  2KMA A;  1YQB A;  3DBL I;  3KYC D;  3QX1 A;  2PPH A;  2HJ8 A;  4HPL B;  3ZIM A;  2L3Z A;  1WXS A;  2WYQ A;  1NBF C;  4ZRK A;  1K8R B;  3L08 A;  2FNJ B;  3AI5 A;  4GSW A;  1P1A A;  2L05 A;  1V80 A;  4G0N B;  2KOX A;  4KIK A;  4PS3 A;  1V6E A;  1M94 A;  5IAA C;  3A4S C;  2KTF A;  3DBH I;  2O2V A;  3TBL D;  1E8W A;  3MJW A;  2PE6 B;  2KC1 A;  1WMH A;  2ZNV C;  3UQA A;  4FHK A;  3QCA A;  2OJR A;  3DBR I;  2NCN A;  4MGY E;  2WWZ A;  1J0G A;  2MBB B;  3ZLZ A;  1SE9 A;  3ECI A;  1P0R A;  4FLH A;  4WAA A;  4BVU C;  5EDS A;  5JH5 C;  1TGZ B;  1WR6 E;  4HLE A;  2FIF A;  2O6V B;  1YJ1 A;  3CSF A;  4HVB A;  2N1W A;  4TUU A;  3CST A;  1OEY J;  1C1Y B;  1NDD A;  4ICV A;  4AJY B;  5D7G A;  2FCN A;  4W9K A;  2C5L C;  3VAW A;  1OGW A;  1IYF A;  4G11 A;  1KLV A;  5CTR C;  4I6N B;  3KUC B;  2RR9 A;  2OOB B;  2IBI B;  1NI2 A;  5AZG A;  4LCD E;  2K6Q A;  2MWS B;  1GUA B;  2KJH B;  1WM3 A;  5TR5 A;  1OQY A;  4G3X B;  4ASW C;  3Q3F A;  2MSE D;  4BKG A;  4YL8 A;  1XD3 B;  2LRU A;  1YX5 B;  1Z2M A;  4BKS D;  3A4R A;  3A9K B;  3M3J A;  2DZM A;  3TMP B;  1V49 A;  1WGD A;  3DPD A;  4GXB A;  4KZC A;  3PLV A;  5LLI A;  2N7E A;  1YX6 B;  4NY0 A;  1WF9 A;  1I35 A;  1P3Q U;  1LXD A;  3UIO B;  2MLB A;  2REX A;  3LDZ E;  4WJO A;  2MP2 B;  3KYD D;  1ZW7 A;  1AAR A;  1WGH A;  3RZW C;  3ZNH B;  1WJ4 A;  3NY5 A;  1GG3 A;  1WJN A;  2J0J A;  3L0W B;  2J0M A;  4ANX A;  2L8J A;  4MGZ E;  5G2N A;  1D3Z A;  2ASQ A;  2B3A A;  3QIJ A;  2JZ3 B;  3H7P A;  4II2 B;  5GMV A;  2DAF A;  3W1Y A;  2N9X A;  1E5W A;  2ZCC A;  2Z59 B;  4PYU A;  2IO2 B;  2XEW A;  2I1K A;  4OVV A;  4KZ0 A;  1WGG A;  3C0R B;  1Y8R C;  1WZ3 A;  1Q5W B;  2J0K A;  3OJ3 A;  3M63 B;  4K7U A;  2LUE A;  2DYO A;  2NBU A;  4DHZ E;  4BBN C;  2GBJ A;  2KFK B;  2DZK A;  4NQK E;  3ZRC A;  1VD2 A;  4JIO U;  4GDL A;  3DDC B;  4PS7 A;  3OAW A;  5KHQ A;  3RYT A;  3U7D A;  2CKH B;  2N9P C;  4DBG A;  4E74 A;  1F9J A;  2L0F A;  2LVP A;  2BYV E;  2FAZ A;  2JUO A;  4HXD A;  1WGY A;  3K9P B;  5E6P A;  1KM7 A;  2DYM A;  3I3T B;  3QAQ A;  2PE9 A;  1MG8 A;  2GBK A;  2L00 B;  3ZNI D;  3NZS A;  5D6J B;  5AZH A;  4HWI B;  3T8M A;  2MBO A;  3H9D A;  2KC2 A;  1EF1 A;  2JZZ A;  2NPT A;  3CF6 E;  4MDK E;  1P9D U;  3PT2 B;  4WWO A;  1WFY A;  3H6N A;  4DK5 A;  3DCG A;  2MCN B;  1V2Y A;  3A33 B;  3IFW B;  2R2O A;  3WAP A;  3R7R A;  1TTN A;  1RLF A;  2KO3 A;  4W9C A;  3RD2 A;  5BO4 B;  4A3P A;  2JPH A;  2MRP A;  3V62 A;  3HHM A;  4K7W A;  3W1S C;  2LJ5 A;  5DPW A;  3GOE A;  2G4D B;  2CHW A;  3H7P B;  4W9G A;  4URK A;  4EZK A;  2L7R A;  2LVO A;  1V81 A;  3CMM B;  1LM8 B;  3KUD B;  4II3 B;  4IWO A;  1J8C A;  3EFU A;  4A20 A;  4IM0 A;  3A1Q A;  4E71 A;  2L0T A;  3DVN V;  1WRD B;  1RRB A;  3HIZ A;  3NOB A;  4FN2 A;  5IA7 A;  2DZJ A;  3R66 C;  2M1M A;  1SIF A;  2Z0E B;  3GZN I;  3L13 A;  3ZNG C;  1WH3 A;  2CR5 A;  2C7N B;  2JRH A;  3B1L X;  1G6J A;  2MA9 B;  1EO6 A;  4W9F A;  2FCS A;  2BF8 B;  2LXA A;  4GDK B;  2KKC A;  3APF A;  1T0Y A;  3WAM A;  1U4A A;  3QWZ B;  4PYZ A;  2LAS A;  4G50 A;  3ALB A;  4MGI E;  3SU8 X;  3KW5 B;  3M95 A;  3PPA A;  4XC2 A;  4RM8 A;  2HTH A;  2FID A;  3TJP A;  4FAD A;  2KNB A;  4MJS B;  1YD8 U;  1SGH A;  4X57 B;  2D10 A;  2FUH B;  3EEC A;  3ENE A;  5DPS A;  5E6O A;  3ZUN A;  4CO7 A;  1YIW A;  1WY8 A;  3OJ4 B;  2CHZ A;  3PHW B;  4ZDV A;  1GC7 A;  2G45 B;  3JSV A;  1BT0 A;  2LWP A;  2HD5 B;  1ISN A;  3DVG X;  3U8Z A;  3SDL C;  1C3T A;  5L95 C;  4LJO B;  4DHJ B;  3AU5 A;  2IO3 B;  4LJP B;  4BKT A;  3H7S A;  3ZDT A;  4ANW A;  2KD0 A;  2KLC A;  3A9J B;  2RSU A;  2IYD B;  4ZYN A;  2KDE B;  3X0W A;  2KTR B;  1RAX A;  4M8M A;  3V6E B;  2NVU I;  2MBH A;  5L83 A;  2KN5 A;  4FJZ A;  2K1F A; 
#chains in the Genus database with same CATH topology
 1SXT A;  4HRO A;  1I4X A;  5G5G A;  1GC6 A;  1R4N I;  1QOA A;  3H8H A;  3DQV A;  1QOG A;  4Q2J A;  3PVL A;  1FNW A;  2ZVN A;  3L10 B;  1T0S C;  4P7I A;  3TL5 A;  1ZUD 2;  3Q8A A;  3QC8 B;  5I4D A;  2ZZP B;  4YT0 B;  4TQ1 A;  2WGS A;  4LK0 M;  1FFU A;  1LO5 D;  3VTW A;  3I9V 1;  3VHT C;  1ET9 A;  2GBR A;  4GU2 A;  2LI5 A;  2W3S A;  2QCZ A;  2G9H D;  2RGF A;  2Z0D B;  5HFY A;  1N5W A;  4L2Y A;  2ZW1 A;  2L52 A;  3P42 A;  1SE3 A;  1RM6 C;  4C7Z A;  1V5T A;  2D11 A;  3UIP B;  2KTR A;  1QZE A;  2WX1 A;  1WE7 A;  2RPV A;  2C7M B;  4W9J A;  4JX1 C;  3AE3 B;  2BWE S;  3W9C B;  2A5U A;  2EMS A;  1ZE3 D;  4DDG D;  1V97 A;  2IO0 B;  3WAO A;  1YQ3 B;  5JHA A;  2QIL A;  2E3T A;  1MHH E;  2QMT A;  5G55 A;  4HCP B;  1L4D B;  4PS8 A;  3W1S A;  5MPO A;  1GB4 A;  1PYW D;  2NPT B;  4K81 A;  3OWE B;  5D2M B;  4A90 A;  5JHB A;  4BBN F;  3WAN A;  1TJE A;  2ZPY A;  3TCA A;  2WXO A;  1SEB D;  2BKF A;  3VXW A;  2MQJ A;  4ZOH C;  4OVZ A;  1YMH E;  4RGO S;  5DPT A;  1Z5S B;  4CYE A;  3UF8 A;  4B95 A;  2BKR B;  3BVM A;  4N9F 4;  2WDT B;  3MP9 A;  2JQR B;  1F2R C;  3L16 A;  4NZL B;  3ONS A;  4AWJ A;  5BYR A;  2KJ6 A;  4MM3 A;  4IM3 A;  3Q8E A;  1L0Y B;  1Q1O A;  1ZGU B;  4RGT A;  3P4S B;  2YLM A;  3EUB 2;  2KAJ A;  2SEB D;  3HRD D;  1L6V A;  1FPY A;  3WIM A;  2J52 A;  4N59 A;  1YOV B;  3BK2 A;  3P4P B;  4ZRJ A;  2LD9 A;  2KWV B;  4A6Q A;  1CZP A;  4C80 A;  4HK2 A;  4EEW A;  4IW0 A;  4DHJ D;  1R7S A;  3APC A;  4FHJ A;  2AWT A;  1Q10 A;  4WWP A;  3DHI C;  3BIN A;  2NS5 A;  1FIQ A;  3AE4 B;  1JRO A;  3VFK A;  3PRZ A;  3UI3 A;  3MHS D;  4F8C B;  1J19 A;  2WU5 B;  2BPS A;  3BY4 B;  4AUQ C;  4MEM A;  3ZO5 B;  4IM2 A;  1RFA A;  4ANU A;  5CHF A;  3EFC A;  4LNI A;  2MH7 A;  2WXG A;  2KDI A;  3O65 B;  5TSS A;  3IT4 B;  2V0G A;  1C79 A;  3FIL B;  4RCO A;  2PKO A;  3A9J A;  4BOS C;  4P1C C;  1XCT L;  1ZDX A;  2LGD A;  2M17 A;  3VUW A;  2D3C A;  2GBN A;  3R7Q A;  2C60 A;  3PO0 A;  4ZYS A;  4JPS A;  2KX3 A;  1T5X D;  3MTN B;  4HPM B;  2BYT A;  4TV3 A;  1T0R C;  4MGK E;  4NJ6 A;  1RWS A;  3Q3J A;  5C23 A;  3GZN B;  2N9L A;  4IDI A;  4ZHP A;  3KVF B;  1KRH A;  3IT6 B;  3QAR A;  3ML9 A;  2J7Q B;  3OLM D;  2EMT A;  1F77 A;  4FJV B;  5CHV C;  1PFD A;  3DOW A;  1UH6 A;  4IG7 B;  3TUO A;  2IY0 B;  1TT5 B;  2PPH A;  2L3Z A;  2WXK A;  1UWM A;  4ZRK A;  1CJE A;  3IXS A;  4GSW A;  5BMI A;  4KIK A;  4EE2 A;  2JYT A;  2BW2 A;  1K52 A;  3NUH B;  3UQA A;  1DYQ A;  1WMH A;  2ZNV C;  1EWC A;  2CJN A;  3DBR I;  3Q69 A;  4MGY E;  2W3R A;  2WWZ A;  2L1A A;  4UDU C;  1TGZ B;  1WR6 E;  2O6V B;  3CST A;  1VLB A;  1ACC A;  5D7G A;  3VAW A;  2IJ0 A;  3T3O A;  2L32 A;  5CTR C;  2GB1 A;  2RDB C;  2IBI B;  2K6Q A;  3VR9 B;  2JSV X;  1OQY A;  2PTL A;  1WXQ A;  4BKG A;  5EE0 A;  4YTN B;  2W82 A;  5HG2 A;  3PLV A;  1WF9 A;  1LXD A;  3KYD D;  1ZW7 A;  3ZNH B;  1WJ4 A;  3ZXR A;  2J0M A;  1XLO A;  1SE2 A;  2H89 B;  5G2N A;  3W2D A;  4PK1 A;  2Z59 B;  5EE1 A;  4OVV A;  4C56 C;  1Y8R C;  1WZ3 A;  1P7F A;  3M63 B;  3OJ3 A;  2NBU A;  2GBJ A;  1WWT A;  2JU6 X;  2DZK A;  4LNN A;  4NQK E;  4JIO U;  3DDC B;  4PS7 A;  3RYT A;  1SE4 A;  3U7D A;  3AEA B;  1AWD A;  2N9P C;  2MHJ A;  3N1Y C;  2DYM A;  3I3T B;  3ZNI D;  5D6J B;  5AZH A;  3T8M A;  1EF1 A;  2NPT A;  3RNG C;  1TS4 A;  3H6N A;  3WAP A;  4W9C A;  5BO4 B;  2JPH A;  4K7W A;  1ZDV A;  2WXP A;  5DPW A;  2BVC A;  1SF0 A;  2WP9 B;  4URK A;  4EZK A;  1AYF A;  2LVO A;  1V81 A;  4II3 B;  2KMM A;  3BZD B;  2L0T A;  3TEX A;  3HIZ A;  1FFV A;  4XE0 A;  2I38 A;  1WH3 A;  2CR5 A;  2JRH A;  2WXN A;  4YTP B;  3BII D;  2KKC A;  1U4A A;  2LAS A;  3ALB A;  4RM8 A;  2HTH A;  2FID A;  2ICI A;  4FAD A;  3ZUN A;  1NYR A;  4HRS A;  4LLG M;  2G45 B;  3JSV A;  2J42 A;  2HD5 B;  1ISN A;  1SBB B;  5AUK A;  4GLS C;  4DHJ B;  3MHZ A;  3N1Z C;  3H7S A;  1WYG A;  2KLC A;  3AE2 B;  1XO3 A;  2M56 B;  4ZYN A;  2JZP A;  1FCL A;  1RAX A;  4M8M A;  3V6E B;  3AEE B;  2IZV B;  4BKS A;  2Q5W D;  1K50 A;  1WJU A;  3TIX A;  4FJY A;  2M0X A;  4F7Z A;  2PEA A;  2DLB A;  1OEY A;  1E10 A;  3PZD A;  1FXT B;  4DDI D;  3NHE B;  2FBW B;  2FCM A;  3E9S A;  1CMX B;  2ZNV B;  1NYQ A;  2WDR B;  4US8 A;  5DPR A;  1GPX A;  4N6E B;  3HM6 X;  3Q3N C;  3AED B;  2XBB C;  2GLS A;  5LXH A;  1WIA A;  2K8H A;  3HVZ A;  2LRW A;  2CU3 A;  4TQ0 A;  4RF1 A;  4DWF A;  4GN1 A;  2K25 A;  4R3D A;  4S17 A;  3PV1 A;  4HPP A;  4OZB A;  4KSK C;  3ZVV A;  1PQS A;  1HE8 A;  4IUM B;  4AS1 A;  2K22 A;  2J4X A;  3HM3 A;  1T6B X;  1WMH B;  1J7A A;  1F2R I;  2IPK D;  4HCN B;  2ZW0 A;  3VDZ A;  1XLP A;  2I1J A;  5HI1 A;  3GS2 A;  2DYB A;  2V3S A;  4GDL B;  2MEK A;  1WX8 A;  1TKE A;  2C9W B;  3H1U A;  2KK8 A;  4NAW A;  1IP9 A;  4J3O D;  1KF6 B;  2V4L A;  2WXF A;  1WGR A;  2IGH A;  3RNA C;  2BS2 B;  1H4R A;  1FO4 A;  2YVC A;  1N6Z A;  2AYO B;  1WX9 A;  4B9K A;  4JLC A;  3ZJU A;  2UU7 A;  2M4N A;  3A9K A;  4FUL A;  4K3B A;  1ZOY B;  3V6C B;  3DVN U;  4MEL A;  3A1Q B;  5D94 A;  2BGF A;  3KH0 A;  1V1O A;  2M19 A;  4AP4 C;  4IWP A;  4KIK B;  2NBV B;  5HKH A;  4NAW B;  3BVG A;  2V1Y A;  3BK1 A;  2NBW B;  2DX5 B;  3N3K B;  2WLB A;  4RMA A;  4GB9 A;  4KVG B;  2KDF B;  3T9L A;  3N9Y C;  1FNU A;  4FBJ B;  2WXJ A;  3CIR B;  3K9O B;  2KVR A;  3IG3 A;  1UBI A;  1VZ6 A;  2Y5B B;  3DWM A;  3DHH C;  1VDV A;  4H2A A;  1VZ7 A;  3KUZ A;  1WI0 A;  3ZRF A;  2EKE C;  2JVC A;  4TSS A;  1UBQ A;  4DHZ B;  5AEK B;  3R3M A;  4S0R A;  3QJZ A;  1UD7 A;  3EHV A;  4I6L B;  2ZVO A;  1A70 A;  1UGM A;  2ONQ A;  2AEH A;  2BT6 A;  4P16 A;  1SIJ A;  1TYG B;  1I42 A;  2WHI A;  3RI7 C;  2W54 A;  4XGA B;  2XK5 A;  4KGT A;  2MJE A;  5FR6 A;  4WJN A;  2KZR A;  5E6J A;  2LJI A;  3BYT B;  3VQI A;  4EKU A;  4GOC A;  2C7H A;  2WX0 A;  3PZ7 A;  3Q2A C;  3RFZ B;  1MG4 A;  2NR2 A;  1EM7 A;  2JWZ A;  2MJD A;  2KAN A;  4K3C A;  1IUE A;  4EZJ A;  2KDB A;  3LB8 C;  1TS5 A;  5H92 C;  4BZA A;  1GJZ A;  3AV8 A;  3P2B A;  2KQ4 X;  3AE8 B;  2LZ6 A;  1TBE A;  3VTU A;  2V3N A;  1Q0W B;  4EZL A;  3U7Z A;  2EKI A;  3EGR A;  2V9H A;  3KWV A;  5DCN A;  1QLB B;  4LDT D;  1B1Z A;  2N1V A;  4E3C A;  4KV2 A;  2KAC A;  4ICU A;  3NS8 A;  4W9L A;  1P98 A;  5E6N A;  3M62 B;  3EC8 A;  2IO1 B;  3HK0 A;  3RUL A;  3B9J A;  3Q3M C;  3GE3 C;  4JQW C;  2KWC A;  3GE8 C;  4A3O A;  2N9K A;  2WNM A;  1HTO A;  4A9A A;  4ARC A;  3CWI A;  1ENF A;  4XYC A;  1V86 A;  1NVI D;  1E7U A;  1VCB A;  4GDK A;  1C9F A;  4WIP A;  3AE6 B;  2MJ3 A;  1Y56 A;  4XDC A;  3BVZ A;  1YJI A;  2HJ8 A;  1WXS A;  2KYW A;  2WU2 B;  2WYQ A;  1NBF C;  3J9C A;  3L08 A;  3AEG B;  4G0N B;  4PS3 A;  1DOY A;  5IAA C;  5C2T B;  3A4S C;  3TBL D;  1QOF A;  3MJW A;  2PE6 B;  4C7Y A;  3DHG C;  4FHK A;  1B9R A;  4PT5 A;  4WQM A;  4CQN A;  2OJR A;  1FXI A;  1SE9 A;  2BS4 B;  4WAA A;  5JH5 C;  1OEY J;  1NDD A;  2C5L C;  5IP4 D;  1OGW A;  2XN9 C;  1NI2 A;  5AZG A;  2MWS B;  1ZPS A;  2IGD A;  3BYY B;  2MSE D;  4YL8 A;  1XD3 B;  2LRU A;  1Z2M A;  1N63 A;  3A9K B;  1JW9 D;  3TMP B;  1V49 A;  1I35 A;  3RN9 C;  2N7E A;  4NY0 A;  1TKY A;  1P3Q U;  1ZP0 B;  3Q14 C;  2MP2 B;  2WDV B;  1XLQ A;  1AAR A;  1WGH A;  3AB5 A;  2JXT A;  3SEB A;  1FRD A;  1HA5 A;  3NS1 A;  1GG3 A;  1FM0 D;  4ANX A;  2L8J A;  4MGZ E;  1D3Z A;  3QIJ A;  1QIL A;  3RMK C;  3ZJV A;  2N9X A;  1E5W A;  3C8Y A;  4PYU A;  1YN5 A;  1WGG A;  3C0R B;  4REZ A;  1N61 A;  2J0K A;  1BUI C;  2LUE A;  2DYO A;  4C4V B;  4JWS C;  2G1E A;  4IOI E;  5HHD G;  2KFK B;  1JWM D;  1MHX A;  1VD2 A;  4DXF A;  3OAW A;  1MPE A;  1QF6 A;  4DBG A;  4E74 A;  2L0F A;  2JWU A;  2AX5 A;  4HXD A;  5E6P A;  1KM7 A;  3QAQ A;  1V1P A;  2PE9 A;  1MG8 A;  2L00 B;  1IGD A;  1V8C A;  3KLS X;  3H9D A;  2Z8L A;  1QOB A;  1GB1 A;  3CF6 E;  1P9D U;  3I57 A;  1WFY A;  1PGA A;  2PVG C;  2MCN B;  2M0A A;  1V2Y A;  2R2O A;  1RLF A;  1SJH D;  1F52 A;  2MRP A;  3NJT A;  3W1S C;  1UUP A;  2CHW A;  3TEZ A;  3CMM B;  1LM8 B;  2VH1 A;  2FE8 A;  4P1B C;  4IM0 A;  3DVN V;  1WRD B;  5IA7 A;  2VZK B;  4A8X C;  1CQV A;  1ZXH A;  3R66 C;  1J7B A;  3VR8 B;  2Z0E B;  3GZN I;  1G6J A;  1PGB A;  1JAL A;  2KN4 A;  2MA9 B;  4W9F A;  3WAM A;  3I5J C;  4HKQ A;  1VZ8 A;  1VR9 A;  2KNB A;  4JWU C;  4MJS B;  1QQR A;  4X57 B;  2D10 A;  2FUH B;  3EEC A;  3NVV A;  5DPS A;  2LEK A;  2LHE A;  4CO7 A;  4RGM A;  1WY8 A;  2CHZ A;  3Q8F A;  1F1H A;  3VRA B;  4B0M A;  3AH7 A;  1K53 A;  3SDL C;  1HEZ E;  5IO9 A;  3OG5 A;  4ANW A;  2KD0 A;  3Q3O C;  2WDQ B;  1QKZ A;  2FUG 1;  2NVU I;  2MBH A;  5L83 A;  2KN5 A;  1P7E A;  2O6V D;  2R61 A;  5JXV A;  3U52 E;  2HDE A;  1KLU D;  4GMV A;  2K8C A;  3DBS A;  4JE3 B;  2IND C;  3N32 A;  2MBQ A;  1L7Y A;  1KOT A;  2QEJ C;  1GAQ B;  3N30 A;  2K0P A;  4W9H A;  1YN4 A;  3VUY A;  2OED A;  4RF0 A;  2DBY A;  3PTF C;  3UIN B;  3IHP C;  2QJL A;  4LDT B;  2OJW A;  1EU4 A;  3AE1 B;  3QHT A;  2LHD A;  4RH6 A;  1WM2 A;  5LXI B;  2KXJ A;  3X23 A;  4BAX A;  3IAM 1;  4DXG A;  3I63 C;  3QK0 A;  3NRZ A;  2KMC A;  5AUI A;  2UYZ B;  5J17 A;  3JW0 X;  4GGQ A;  2XK5 B;  4M0W B;  2O2V B;  4BOZ B;  3L17 A;  3B0A A;  3RUI B;  4FXC A;  2EEL A;  4KGS A;  4B6W A;  1L6U A;  4KDL B;  2KWU B;  3VVW B;  2AL3 A;  4KX6 B;  5FR3 A;  3S2A A;  4YSZ B;  2LVQ A;  1SSN A;  1GNU A;  3V05 A;  1DOI A;  2O6V A;  4LNO A;  1M4V A;  3JVZ X;  1I4R A;  2VZK D;  3QA8 A;  3PRM B;  3QQ8 B;  4D2K A;  2GBM A;  3R8B A;  3VH3 B;  3B08 A;  3PHX B;  3U2S C;  2DAJ A;  2KQ7 A;  2GOW A;  2RD0 A;  3P1M A;  4RM9 A;  1JQ4 A;  1WXV A;  5JZE B;  2SAK A;  3AE9 B;  3JYU A;  2KT7 A;  4KSL C;  2UWQ A;  4LNF A;  2KJR A;  2JX5 A;  2JY6 A;  4LTU A;  3JSV B;  3V60 A;  2LFI A;  5BMG A;  1T3Q A;  3SHQ A;  1HXY D;  2DNF A;  5IN7 A;  4RGN A;  1UEL A;  2AL6 A;  3IVF A;  1ET6 A;  2MBE A;  4WWN A;  3Q8C A;  2AQ2 B;  3DBH B;  1I4Q A;  1D5Z C;  1STE A;  2ACZ B;  1XQQ A;  1X1M A;  1OTR B;  3AEC B;  3SFE B;  3FC4 A;  4XWW A;  3MC9 A;  2KFK A;  3U4E G;  2VH2 A;  4JGH B;  1I4G A;  2W55 A;  4I6P A;  2G4S A;  4AOF A;  2H88 B;  2AQ3 B;  1IGC A;  3ML8 A;  1JRP A;  1S1Q B;  1EF5 A;  1WYW B;  2N9E B;  2WXR A;  1XEE A;  3SR6 A;  2BB6 A;  2PVO D;  4L1B A;  2R2Q A;  4NNJ B;  4MSM B;  4FA6 A;  1E8Y A;  1L5P A;  4KDI C;  4WQO B;  2PW9 A;  1SJE D;  2ZEQ A;  1FCC C;  2KLG A;  2L76 A;  3PLU A;  2X38 A;  4OVU A;  2D3G A;  1J7C A;  1WGK A;  1WXM A;  2MW5 A;  1WX7 A;  2RDG A;  1WR1 A;  3AUL A;  3FKY A;  5J2R A;  3Q6B A;  2DHZ A;  4MJS A;  1C4A A;  1LGR A;  2NMQ A;  2GI9 A;  4IC7 B;  1E7P B;  4XZ4 A;  3TEY A;  4NJ7 A;  4K1R B;  3NVW A;  3RZF A;  2KX0 A;  3EA6 A;  2PIA A;  2K5P A;  1XCQ L;  2AQ1 B;  4HJK A;  4USA A;  4HDO A;  1E8Z A;  1LFD A;  2MP2 A;  1PUT A;  3AE7 B;  2K39 A;  2CU1 A;  1JCK B;  3DVG Y;  4OZC A;  4AJW A;  3NZU A;  3VUX A;  2FCQ A;  2Y5C A;  5BMH A;  2NTT A;  2YEP F;  2ZPN A;  4OW0 A;  2WXH A;  1S3S G;  1EUV B;  2KFJ A;  1EWY C;  2Y5P A;  1TZ1 A;  5AZF A;  3ZDM C;  5J18 A;  1WJ6 A;  3ZNZ B;  1L4Z B;  1H8C A;  2CS4 A;  2MX2 A;  3ZKJ C;  1MI0 A;  1I4P A;  4A55 A;  3KWL A;  1YQ4 B;  3D32 A;  3AN1 A;  4QAY A;  4LNK A;  1E90 A;  4K7S A;  3ZTC A;  1UWX A;  4OHJ A;  3KYC D;  1YQB A;  1AW7 A;  3DBL I;  3QX1 A;  3ZIM A;  1BXT A;  1OQR A;  1IBX B;  1K8R B;  3AEF B;  3AI5 A;  1P1A A;  2L05 A;  1V6E A;  1I7H A;  2K3U A;  1M94 A;  2LGS A;  5T8I A;  2KTF A;  4B0E A;  2O2V A;  1TIF A;  3QCA A;  1MFW A;  4C00 A;  2NCN A;  2LMC A;  1J0G A;  2PMV A;  3ECI A;  4FLH A;  5EDS A;  4HLE A;  2FIF A;  1BML C;  1YJ1 A;  5BYQ A;  4HVB A;  1R4N B;  1C1Y B;  4AJY B;  4W9K A;  2KVZ A;  4G11 A;  4I6N B;  3KUC B;  4ZRQ A;  2OOB B;  3URY A;  4LCD E;  1GUA B;  4ZRP A;  2KJH B;  1QT9 A;  5TR5 A;  4G3X B;  1HZ5 A;  3M3J A;  4HEA 1;  1WGD A;  5LLI A;  3B2G A;  1WSP A;  3MC0 B;  1YX6 B;  1HQR D;  4WAF A;  1TY2 A;  2MLB A;  4WH4 A;  1DGJ A;  3RNF C;  3RZW C;  2J0J A;  2LUM A;  3MJ5 A;  2V3P A;  5GMV A;  2B3A A;  3H7P A;  2ZCC A;  1N5X A;  3KQ4 A;  3SFD B;  4KZ0 A;  1JWB D;  1Q5W B;  4MM3 B;  4DHZ E;  3RNB C;  4BBN C;  2IGG A;  1TY0 A;  2L83 A;  3ZRC A;  3L4P A;  4MH8 A;  2CKH B;  1F9J A;  5EE3 A;  2LVP A;  2BYV E;  2JUO A;  1WGY A;  2LGI A;  2INC C;  2GBK A;  3LYY A;  3P63 A;  3NZS A;  4HWI B;  4RNA A;  3Q8B A;  4WWO A;  3W5U B;  1RYJ A;  1PDX A;  3A33 B;  3IFW B;  3R7R A;  1TTN A;  1XLN A;  4A3P A;  1FD6 A;  4AQ7 A;  3ETR A;  3GOE A;  2INP E;  2G4D B;  3H7P B;  1T0Q C;  4MAC A;  1J8C A;  1D5X C;  3RPF C;  3EFU A;  4A20 A;  4E71 A;  5BYS A;  4L23 A;  4FN2 A;  3NOB A;  2M1M A;  1SIF A;  3ZNG C;  3L13 A;  3B1L X;  2C7N B;  1FMA D;  2FCS A;  2LXA A;  4GDK B;  3APF A;  1T0Y A;  2KWD A;  3RNC C;  4G50 A;  4MGI E;  3KW5 B;  3TJP A;  1YD8 U;  1SGH A;  5E6O A;  3ENE A;  4NJC A;  1UF0 A;  1GC7 A;  1SB3 C;  4US9 A;  2LWP A;  3R2I A;  1C3T A;  1L0V B;  4BKT A;  2NTS A;  3C19 A;  3A9J B;  2RSU A;  3W5V B;  2KDE B;  3X0W A;  1NEN B;  1NI3 A;  3V3X A;  4WWM A;  4FJZ A;  2K1F A;  3RNE C;  4BFR A;  4JL9 A;  4M8N A;  2K8B A;  2QSD A;  3AEB B;  3V61 A;  3PRE A;  1ZKH A;  2BYE A;  2W9N A;  4W9E A;  4NQL B;  1JRU A;  3N1X C;  4J6I A;  3UQB A;  2XNA C;  2BYF A;  2J53 A;  5GXG B;  1C76 A;  2QDF A;  2N7J A;  4WJP A;  4ARI A;  4ZHO A;  2HE7 A;  2IDY A;  3VTV A;  1UZX B;  3ZYY X;  2B76 B;  2N0S B;  2JT4 B;  4KGR A;  1XF5 L;  3VH4 B;  4XDD A;  2GRI A;  1IBX A;  3NZ3 A;  3O13 A;  4WJQ A;  5LNK 1;  1HZ6 A;  2K6D B;  1OFF A;  2CHX A;  2K9X A;  3ABV B;  5EE9 A;  3L54 A;  3AU4 A;  3FIL A;  2A4Z A;  2BWF A;  1KH0 A;  2G3Q B;  3ZTD A;  2WXI A;  4XX5 A;  1ESF A;  1D5M C;  3LJ3 A;  1XT9 B;  4ZRI A;  2GMI C;  2LXC A;  4M00 A;  2N4F A;  1AN8 A;  2JF5 A;  3U30 A;  4MT5 A;  2PJH A;  3AE5 B;  3AXC A;  1WXA A;  1K51 A;  3PGE A;  3MC8 A;  2LGX A;  1C4C A;  3RT3 B;  4P6V F;  2V4I B;  3UGB B;  1WE6 A;  1N60 A;  2WS3 B;  3TEW A;  4O1N A;  1JWS D;  1C77 A;  4GIV A;  1YN3 A;  5FKA C;  1MJD A;  4NPN A;  4YXD B;  3MFG A;  4KKI A;  3SD5 A;  3DBR B;  4MSQ B;  1TS3 A;  4HDQ A;  4CHK A;  1WRI A;  4W9I A;  4TKN A;  3APD A;  3ZGZ A;  2N7D A;  2HTM E;  3ZJT A;  3P4Q B;  1RFK A;  5KHO A;  1ZXI A;  1V1P B;  1XXG A;  5H8Y E;  4YTM B;  2LGY A;  4EOY A;  2D07 B;  4KKJ A;  2D2Q A;  3RCZ A;  3NVZ A;  5IOI A;  3PSE B;  2WXM A;  3NVY A;  3WAL A;  3PRP B;  2QHO A;  1V9J A;  2BS3 B;  1R4M I;  3LXF A;  1KTK A;  2RPQ A;  5IKC M;  3ZXV A;  1L2N A;  4MH0 E;  3AM9 A;  1A5R A;  1ROE A;  2WXQ A;  3DWG C;  3IBE A;  4ANV A;  4IWQ A;  3GP7 A;  3N20 C;  4EFO A;  4W9D A;  1OQQ A;  1YJJ A;  3R2T A;  4M0W A;  2DWQ A;  2D5G A;  1KFY B;  2ZCB A;  1C78 A;  2M8S A;  5CX3 A;  4OZA A;  1LQB A;  1MVK A;  1KJT A;  1E7V A;  2JRI B;  3WA0 A;  4HJG E;  2ZJD A;  2VRR B;  4DXA B;  4EUT A;  5CHW A;  1E0Z A;  4F1S A;  3FAH A;  1EU3 A;  1FRR A;  2KDM A;  2KHW B;  3ZW3 A;  2JXX A;  2QC8 A;  3PS6 A;  2JYE A;  1JWA D;  1IPG A;  1CK1 A;  2DZI A;  1PGX A;  1L0X B;  1I4H A;  3HUI A;  2IY1 B;  1UNS A;  1TS2 A;  1E8X A;  4HKZ E;  1WZ0 A;  3TSS A;  1FEH A;  1V5O A;  2KQS A;  5C1Z A;  2DEN B;  2BQQ A;  2KMA A;  1E6E B;  1YNT E;  4HPL B;  2FNJ B;  2INN E;  4M01 A;  1V80 A;  3PZ8 A;  2KOX A;  2E6X A;  4YSY B;  2BBC A;  3ZQ4 A;  1FNV A;  1TKG A;  4ITK A;  3DBH I;  1E8W A;  2KC1 A;  2ON8 A;  4M02 A;  2MBB B;  3ZLZ A;  4RFB A;  1P0R A;  4BVU C;  3CSF A;  2N1W A;  4TUU A;  5G5H A;  4ICV A;  2FCN A;  2WXL A;  1KLV A;  1IYF A;  5D3D A;  1E9M A;  1VRA B;  2RR9 A;  3HVD A;  4XWT A;  2WQY B;  1KLG D;  1WM3 A;  2I2Y A;  4ASW C;  3Q3F A;  4ACF A;  1YX5 B;  4BKS D;  3A4R A;  1FXA A;  2DZM A;  3DPD A;  4KZC A;  4GXB A;  3UIO B;  1F0Z A;  2OHF A;  2REX A;  3LDZ E;  4WJO A;  2BTE A;  3NY5 A;  1WJN A;  3L0W B;  2D3B A;  2ASQ A;  2JZ3 B;  4II2 B;  4DQO C;  2DAF A;  3W1Y A;  1UGJ A;  2IO2 B;  2XEW A;  2I1K A;  3VRB B;  2HJ1 A;  4YWG G;  4K7U A;  2D3A A;  4GDL A;  5KHQ A;  4N58 A;  2FAZ A;  2RMM A;  3T3N A;  3K9P B;  4NAM A;  5FK9 C;  2MBO A;  2KC2 A;  2JZZ A;  4MDK E;  1TZO A;  3PT2 B;  2Y3A A;  4DK5 A;  3DCG A;  1R4M B;  4IKG A;  2PLP A;  1C4P A;  2KO3 A;  3RD2 A;  3V62 A;  3HHM A;  1NEK B;  2LJ5 A;  2BB5 A;  2YEP B;  4W9G A;  2L7R A;  1D6E C;  4IWO A;  3KUD B;  3A1Q A;  1RRB A;  1JWU D;  2DZJ A;  4C4V A;  1JML A;  1EO6 A;  2BF8 B;  3AMZ A;  3QWZ B;  4PYZ A;  3SU8 X;  3M95 A;  3PPA A;  4XC2 A;  2X8X X;  1D4B A;  1GOZ A;  5C3J B;  1YIW A;  3OJ4 B;  1VJK A;  3P4R B;  4YSX B;  3PHW B;  3DBL B;  4ZDV A;  1DOX A;  2TSS A;  3BWU D;  3IAS 1;  1BT0 A;  3DVG X;  3U8Z A;  5L95 C;  3GB1 A;  4LJO B;  1N62 A;  3B2F A;  3AU5 A;  2IO3 B;  4LJP B;  4TMA B;  3ZDT A;  2QIE B;  2CJO A;  1HTQ A;  2IYD B;  4WUR A;  3WCQ A;  5D3I B;  2KTR B;  2RDH A;  3E56 A;  3NG0 A; 
#chains in the Genus database with same CATH homology
 4BFR A;  4JL9 A;  2IZV B;  2O6V D;  4BKS A;  4M8N A;  2K8B A;  1GC6 A;  1WJU A;  4GMV A;  3TIX A;  3V61 A;  2K8C A;  3DBS A;  1R4N I;  3N32 A;  4FJY A;  2MBQ A;  2M0X A;  4F7Z A;  3PRE A;  1L7Y A;  3DQV A;  1ZKH A;  2BYE A;  2PEA A;  2W9N A;  3PVL A;  1OEY A;  2ZVN A;  3L10 B;  4W9E A;  3N30 A;  1KOT A;  3PZD A;  4P7I A;  3TL5 A;  4W9H A;  1FXT B;  4DDI D;  4NQL B;  3VUY A;  1JRU A;  3NHE B;  2FCM A;  3QC8 B;  4J6I A;  3UQB A;  2ZZP B;  1CMX B;  4TQ1 A;  2BYF A;  2ZNV B;  3PTF C;  3VTW A;  3UIN B;  4WJP A;  5DPR A;  3IHP C;  3VHT C;  4LDT B;  2GBR A;  3HM6 X;  2HE7 A;  4GU2 A;  2LI5 A;  2XBB C;  3VTV A;  1UZX B;  3QHT A;  5LXH A;  1WIA A;  2K8H A;  2RGF A;  2Z0D B;  2LRW A;  4TQ0 A;  1WM2 A;  5LXI B;  2JT4 B;  4GN1 A;  4DWF A;  3VH4 B;  2KXJ A;  3X23 A;  2K25 A;  4WJQ A;  3PV1 A;  1V5T A;  3QK0 A;  4KSK C;  2D11 A;  2K6D B;  2KMC A;  3UIP B;  2KTR A;  3ZVV A;  1PQS A;  1QZE A;  1HE8 A;  2UYZ B;  4IUM B;  5J17 A;  2WX1 A;  3JW0 X;  4GGQ A;  1WE7 A;  2CHX A;  2XK5 B;  3HM3 A;  3L54 A;  2C7M B;  4M0W B;  1WMH B;  2O2V B;  4BOZ B;  4HCN B;  3L17 A;  4W9J A;  3VDZ A;  3B0A A;  2I1J A;  2BWE S;  3RUI B;  3AU4 A;  4B6W A;  2A4Z A;  2DYB A;  2V3S A;  2A5U A;  2EMS A;  4GDL B;  4KDL B;  2KWU B;  1WX8 A;  2AL3 A;  2BWF A;  3VVW B;  4DDG D;  2IO0 B;  2C9W B;  3S2A A;  3H1U A;  2KK8 A;  2LVQ A;  3WAO A;  4NAW A;  2G3Q B;  1IP9 A;  3ZTD A;  1GNU A;  2V4L A;  2O6V A;  5JHA A;  3JVZ X;  4XX5 A;  3PRM B;  5G55 A;  1WGR A;  3QA8 A;  4HCP B;  3LJ3 A;  3QQ8 B;  4PS8 A;  1XT9 B;  4ZRI A;  2GMI C;  3W1S A;  2GBM A;  2NPT B;  3VH3 B;  4K81 A;  1H4R A;  3B08 A;  3PHX B;  2LXC A;  5JHB A;  5D2M B;  4BBN F;  2YVC A;  2N4F A;  3WAN A;  2KQ7 A;  2DAJ A;  2GOW A;  2RD0 A;  4RM9 A;  2JF5 A;  2ZPY A;  3TCA A;  3U30 A;  1WXV A;  5JZE B;  2AYO B;  1WX9 A;  2BKF A;  2PJH A;  3VXW A;  4B9K A;  2MQJ A;  3AXC A;  4JLC A;  1WXA A;  2M4N A;  3A9K A;  3JYU A;  4KSL C;  2UWQ A;  4FUL A;  5DPT A;  2KJR A;  3PGE A;  2JY6 A;  2LGX A;  3JSV B;  3V6C B;  3RT3 B;  1Z5S B;  3DVN U;  3V60 A;  4MEL A;  3A1Q B;  5D94 A;  4CYE A;  3SHQ A;  2BGF A;  3UF8 A;  4B95 A;  3KH0 A;  2BKR B;  4N9F 4;  1UEL A;  2AL6 A;  2WDT B;  1WE6 A;  3IVF A;  3UGB B;  2MBE A;  4AP4 C;  4WWN A;  4GIV A;  3L16 A;  4NPN A;  4IWP A;  3ONS A;  4AWJ A;  4KIK B;  1XQQ A;  1X1M A;  2NBV B;  1OTR B;  5HKH A;  4NAW B;  2V1Y A;  3SD5 A;  2KJ6 A;  2NBW B;  2DX5 B;  3N3K B;  4MM3 A;  4MSQ B;  4IM3 A;  2KFK A;  4HDQ A;  4RMA A;  4GB9 A;  4KVG B;  2KDF B;  4CHK A;  4W9I A;  4TKN A;  3T9L A;  1Q1O A;  1ZGU B;  4FBJ B;  3APD A;  2N7D A;  4JGH B;  2YLM A;  3K9O B;  4I6P A;  2G4S A;  4AOF A;  2KVR A;  3IG3 A;  3ML8 A;  1S1Q B;  1EF5 A;  1UBI A;  1WYW B;  2N9E B;  2Y5B B;  5KHO A;  3WIM A;  3KUZ A;  1WI0 A;  2R2Q A;  4NNJ B;  3ZRF A;  2EKE C;  2LGY A;  4EOY A;  2JVC A;  4MSM B;  4FA6 A;  4ZRJ A;  1E8Y A;  1UBQ A;  2D07 B;  4KDI C;  4WQO B;  4DHZ B;  2LD9 A;  5AEK B;  2KWV B;  3R3M A;  3QJZ A;  2ZEQ A;  1UD7 A;  2D2Q A;  3EHV A;  4I6L B;  2ZVO A;  3RCZ A;  3PSE B;  2KLG A;  2L76 A;  1UGM A;  3WAL A;  4HK2 A;  3PRP B;  4EEW A;  2AEH A;  1I42 A;  4IW0 A;  2QHO A;  4DHJ D;  3APC A;  4FHJ A;  1V9J A;  2AWT A;  3PLU A;  2XK5 A;  4WWP A;  1R4M I;  3BIN A;  2NS5 A;  5FR6 A;  4OVU A;  2D3G A;  4WJN A;  2KZR A;  2RPQ A;  1WXM A;  2MW5 A;  3VQI A;  4EKU A;  3VFK A;  3PRZ A;  1WX7 A;  2C7H A;  2WX0 A;  3MHS D;  4GOC A;  4F8C B;  2NR2 A;  1J19 A;  1L2N A;  4MH0 E;  1WR1 A;  3AUL A;  2JWZ A;  1A5R A;  2KAN A;  2BPS A;  5J2R A;  4EZJ A;  2DHZ A;  3BY4 B;  4MJS A;  4AUQ C;  4MEM A;  2KDB A;  3ZO5 B;  3IBE A;  4IC7 B;  4ANV A;  4IWQ A;  4XZ4 A;  4IM2 A;  1RFA A;  4NJ7 A;  4K1R B;  3RZF A;  2KX0 A;  4ANU A;  1GJZ A;  5CHF A;  3P2B A;  4EFO A;  2LZ6 A;  4HJK A;  4W9D A;  1TBE A;  3VTU A;  4HDO A;  1E8Z A;  1LFD A;  2KDI A;  2MP2 A;  3O65 B;  1Q0W B;  4EZL A;  2K39 A;  2CU1 A;  2ZCB A;  5DCN A;  2M8S A;  5CX3 A;  3DVG Y;  1LQB A;  2JRI B;  1KJT A;  1E7V A;  3A9J A;  3WA0 A;  3NZU A;  4AJW A;  4LDT D;  3VUX A;  4BOS C;  2FCQ A;  2ZJD A;  2VRR B;  4DXA B;  4EUT A;  5CHW A;  2LGD A;  4F1S A;  2M17 A;  2ZPN A;  3VUW A;  2N1V A;  4E3C A;  1S3S G;  4KV2 A;  2GBN A;  2KHW B;  1EUV B;  4ICU A;  2C60 A;  3NS8 A;  2KFJ A;  3R7Q A;  3ZW3 A;  4W9L A;  1TZ1 A;  5AZF A;  2JXX A;  2KX3 A;  1P98 A;  5E6N A;  3M62 B;  3PS6 A;  3ZDM C;  5J18 A;  1WJ6 A;  3MTN B;  3ZNZ B;  3EC8 A;  4HPM B;  2IO1 B;  3HK0 A;  3RUL A;  4TV3 A;  4JQW C;  2KWC A;  1IPG A;  1H8C A;  2CS4 A;  2MX2 A;  2DZI A;  4A3O A;  3ZKJ C;  4MGK E;  4NJ6 A;  3Q3J A;  5C23 A;  2IY1 B;  3KVF B;  3QAR A;  3D32 A;  3ML9 A;  2J7Q B;  3OLM D;  2EMT A;  1E8X A;  1V86 A;  4FJV B;  5CHV C;  1E7U A;  1VCB A;  1WZ0 A;  3DOW A;  4GDK A;  1E90 A;  4K7S A;  1UH6 A;  4IG7 B;  2IY0 B;  1V5O A;  2KQS A;  3ZTC A;  5C1Z A;  2DEN B;  2KMA A;  1YQB A;  3DBL I;  3KYC D;  3QX1 A;  2PPH A;  2HJ8 A;  4HPL B;  3ZIM A;  2L3Z A;  1WXS A;  2WYQ A;  1NBF C;  4ZRK A;  1K8R B;  3L08 A;  2FNJ B;  3AI5 A;  4GSW A;  1P1A A;  2L05 A;  1V80 A;  4G0N B;  2KOX A;  4KIK A;  4PS3 A;  1V6E A;  1M94 A;  5IAA C;  3A4S C;  2KTF A;  3DBH I;  2O2V A;  3TBL D;  1E8W A;  3MJW A;  2PE6 B;  2KC1 A;  1WMH A;  2ZNV C;  3UQA A;  4FHK A;  3QCA A;  2OJR A;  3DBR I;  2NCN A;  4MGY E;  2WWZ A;  1J0G A;  2MBB B;  3ZLZ A;  1SE9 A;  3ECI A;  1P0R A;  4FLH A;  4WAA A;  4BVU C;  5EDS A;  5JH5 C;  1TGZ B;  1WR6 E;  4HLE A;  2FIF A;  2O6V B;  1YJ1 A;  3CSF A;  4HVB A;  2N1W A;  4TUU A;  3CST A;  1OEY J;  1C1Y B;  1NDD A;  4ICV A;  4AJY B;  5D7G A;  2FCN A;  4W9K A;  2C5L C;  3VAW A;  1OGW A;  1IYF A;  4G11 A;  1KLV A;  5CTR C;  4I6N B;  3KUC B;  2RR9 A;  2OOB B;  2IBI B;  1NI2 A;  5AZG A;  4LCD E;  2K6Q A;  2MWS B;  1GUA B;  2KJH B;  1WM3 A;  5TR5 A;  1OQY A;  4G3X B;  4ASW C;  3Q3F A;  2MSE D;  4BKG A;  4YL8 A;  1XD3 B;  2LRU A;  1YX5 B;  1Z2M A;  4BKS D;  3A4R A;  3A9K B;  3M3J A;  2DZM A;  3TMP B;  1V49 A;  1WGD A;  3DPD A;  4GXB A;  4KZC A;  3PLV A;  5LLI A;  2N7E A;  1YX6 B;  4NY0 A;  1WF9 A;  1I35 A;  1P3Q U;  1LXD A;  3UIO B;  2MLB A;  2REX A;  3LDZ E;  4WJO A;  2MP2 B;  3KYD D;  1ZW7 A;  1AAR A;  1WGH A;  3RZW C;  3ZNH B;  1WJ4 A;  3NY5 A;  1GG3 A;  1WJN A;  2J0J A;  3L0W B;  2J0M A;  4ANX A;  2L8J A;  4MGZ E;  5G2N A;  1D3Z A;  2ASQ A;  2B3A A;  3QIJ A;  2JZ3 B;  3H7P A;  4II2 B;  5GMV A;  2DAF A;  3W1Y A;  2N9X A;  1E5W A;  2ZCC A;  2Z59 B;  4PYU A;  2IO2 B;  2XEW A;  2I1K A;  4OVV A;  4KZ0 A;  1WGG A;  3C0R B;  1Y8R C;  1WZ3 A;  1Q5W B;  2J0K A;  3OJ3 A;  3M63 B;  4K7U A;  2LUE A;  2DYO A;  2NBU A;  4DHZ E;  4BBN C;  2GBJ A;  2KFK B;  2DZK A;  4NQK E;  3ZRC A;  1VD2 A;  4JIO U;  4GDL A;  3DDC B;  4PS7 A;  3OAW A;  5KHQ A;  3RYT A;  3U7D A;  2CKH B;  2N9P C;  4DBG A;  4E74 A;  1F9J A;  2L0F A;  2LVP A;  2BYV E;  2FAZ A;  2JUO A;  4HXD A;  1WGY A;  3K9P B;  5E6P A;  1KM7 A;  2DYM A;  3I3T B;  3QAQ A;  2PE9 A;  1MG8 A;  2GBK A;  2L00 B;  3ZNI D;  3NZS A;  5D6J B;  5AZH A;  4HWI B;  3T8M A;  2MBO A;  3H9D A;  2KC2 A;  1EF1 A;  2JZZ A;  2NPT A;  3CF6 E;  4MDK E;  1P9D U;  3PT2 B;  4WWO A;  1WFY A;  3H6N A;  4DK5 A;  3DCG A;  2MCN B;  1V2Y A;  3A33 B;  3IFW B;  2R2O A;  3WAP A;  3R7R A;  1TTN A;  1RLF A;  2KO3 A;  4W9C A;  3RD2 A;  5BO4 B;  4A3P A;  2JPH A;  2MRP A;  3V62 A;  3HHM A;  4K7W A;  3W1S C;  2LJ5 A;  5DPW A;  3GOE A;  2G4D B;  2CHW A;  3H7P B;  4W9G A;  4URK A;  4EZK A;  2L7R A;  2LVO A;  1V81 A;  3CMM B;  1LM8 B;  3KUD B;  4II3 B;  4IWO A;  1J8C A;  3EFU A;  4A20 A;  4IM0 A;  3A1Q A;  4E71 A;  2L0T A;  3DVN V;  1WRD B;  1RRB A;  3HIZ A;  3NOB A;  4FN2 A;  5IA7 A;  2DZJ A;  3R66 C;  2M1M A;  1SIF A;  2Z0E B;  3GZN I;  3L13 A;  3ZNG C;  1WH3 A;  2CR5 A;  2C7N B;  2JRH A;  3B1L X;  1G6J A;  2MA9 B;  1EO6 A;  4W9F A;  2FCS A;  2BF8 B;  2LXA A;  4GDK B;  2KKC A;  3APF A;  1T0Y A;  3WAM A;  1U4A A;  3QWZ B;  4PYZ A;  2LAS A;  4G50 A;  3ALB A;  4MGI E;  3SU8 X;  3KW5 B;  3M95 A;  3PPA A;  4XC2 A;  4RM8 A;  2HTH A;  2FID A;  3TJP A;  4FAD A;  2KNB A;  4MJS B;  1YD8 U;  1SGH A;  4X57 B;  2D10 A;  2FUH B;  3EEC A;  3ENE A;  5DPS A;  5E6O A;  3ZUN A;  4CO7 A;  1YIW A;  1WY8 A;  3OJ4 B;  2CHZ A;  3PHW B;  4ZDV A;  1GC7 A;  2G45 B;  3JSV A;  1BT0 A;  2LWP A;  2HD5 B;  1ISN A;  3DVG X;  3U8Z A;  3SDL C;  1C3T A;  5L95 C;  4LJO B;  4DHJ B;  3AU5 A;  2IO3 B;  4LJP B;  4BKT A;  3H7S A;  3ZDT A;  4ANW A;  2KD0 A;  2KLC A;  3A9J B;  2RSU A;  2IYD B;  4ZYN A;  2KDE B;  3X0W A;  2KTR B;  1RAX A;  4M8M A;  3V6E B;  2NVU I;  2MBH A;  5L83 A;  2KN5 A;  4FJZ A;  2K1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...