2ZVNA

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 32
structure length 148
sequence length 148
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA01
4KSKC 2N7DA 1WIAA 3K9OB 3QX1A 4K7UA 4MJSA 4XZ4A 5D94A 1VCBA 4FHJA 2AWTA 3M63B 2KLCA 2IO1B 4DBGA 3NS8A 3OLMD 2ZNVC 5LLIA 5TR5A 4FADA 2ZZPB 2M8SA 5AZGA 3PLVA 3VQIA 4WQOB 3TJPA 1JRUA 1OQYA 4GIVA 1LQBA 2MLBA 2ZJDA 3NZSA 3CSTA 2KVRA 2KTRB 4MGYE 3QA8A 2JRIB 1WMHA 3QAQA 4FJYA 5LXHA 2JY6A 3APDA 1AARA 3NOBA 2IY0B 4EFOA 3VAWA 2L00B 2PJHA 4LDTB 3KH0A 3A1QA 1J8CA 3DVNU 2FCSA 4NQKE 3HK0A 1YD8U 2LUEA 3B08A 1V80A 3D32A 2C7NB 4GN1A 4HDQA 4NJ6A 3R3MA 3O65B 4GDLB 4BOZB 3IVFA 4MGIE 2CR5A 2PE6B 5JHAA 4MEMA 2UYZB 4B6WA 2LGDA 3GOEA 4AWJA 1WJNA 4BOSC 1C3TA 2L0FA 2L7RA 2OOBB 2KANA 3ZLZA 4BVUC 2AL3A 4W9JA 2LJ5A 3A4RA 2Z0DB 3TMPB 3V60A 4KZCA 4GU2A 3VH4B 2BYEA 4TQ0A 2DZIA 3U7DA 2LZ6A 1V6EA 3HM3A 3RD2A 3RT3B 5CTRC 4TUUA 1PQSA 4JGHB 3PTFC 4IM3A 2K1FA 2O6VB 2PPHA 2EKEC 3AULA 4HVBA 3R66C 1WE6A 3ZRCA 2JZZA 2KWCA 1OTRB 3AI5A 1XT9B 4FHKA 1Z2MA 3DVGX 3H7SA 3DBLI 2MCNB 2LWPA 4MM3A 1UD7A 1WZ0A 1E8WA 1M94A 4NPNA 4G3XB 2MP2B 5L83A 1WYWB 2KX3A 1GUAB 3WAPA 2M17A 2NS5A 3CF6E 4KV2A 2KWUB 3PV1A 4F1SA 3P2BA 2RD0A 2KO3A 5CHVC 1GNUA 2G4DB 2GBRA 1WM2A 2GBKA 5J18A 2C9WB 4BKGA 4OVUA 1Y8RC 2CHZA 5IA7A 2A4ZA 1TTNA 1WR1A 2YVCA 2K8CA 1WXVA 3ZO5B 1WGHA 2L0TA 2ZPYA 4W9HA 3ZNID 3BINA 2DHZA 2RPQA 2Z59B 4BBNC 1V5OA 3ZW3A 2DYMA 2MBHA 3M62B 2B3AA 3PT2B 1E7UA 2G3QB 4A3OA 3ZDTA 2JVCA 3WAMA 2MBQA 1UH6A 2LGXA 3IG3A 2LVQA 4KDLB 3UQAA 4J6IA 2GMIC 3UGBB 1P9DU 2MRPA 3HIZA 1E8ZA 4KSLC 3ZNZB 2KJRA 2VRRB 2MBBB 2KOXA 5AEKB 2FCMA 2R2QA 4KDIC 3H6NA 5BO4B 3KUDB 3SD5A 4AOFA 3DBSA 2ZCCA 4CO7A 3LJ3A 3JW0X 4GDKA 1WJ6A 2D3GA 2DZJA 5LXIB 4K7SA 4ANWA 4OVVA 3ZNHB 2NCNA 4IM0A 4JIOU 1E5WA 3VFKA 4E71A 2MQJA 3DQVA 2KMCA 2RSUA 4NAWB 2JZ3B 1ZW7A 3V62A 3KVFB 1IYFA 2EMSA 4TV3A 2G4SA 2J0KA 1L2NA 4ASWC 2BF8B 2JXXA 4F8CB 1V2YA 1K8RB 4W9CA 1KOTA 3PVLA 2ZPNA 1YX6B 4DWFA 4BKSD 1V49A 3A9JB 1F9JA 2OJRA 2O2VB 4DXAB 3W1YA 4ZDVA 3HHMA 3M3JA 2LI5A 3IBEA 3W1SC 1CMXB 3Q3FA 4EOYA 3ZTCA 3A33B 2D11A 4IWOA 4MSMB 2KDFB 1WRDB 2NR2A 2KQSA 4EUTA 2L3ZA 5JH5C 3JSVA 5C23A 3RULA 3X23A 2DYOA 2FIDA 3TL5A 4WWNA 4IUMB 4W9DA 5D2MB 4M8NA 3OJ4B 2K25A 3PRPB 3S2AA 4NNJB 1YIWA 4LCDE 4E3CA 1UELA 4DDID 1I42A 2KLGA 5J17A 4EZKA 2RGFA 2W9NA 4FULA 4XX5A 3U30A 4BFRA 2BGFA 3QIJA 1WI0A 4KIKA 2KFJA 3ZVVA 5KHOA 1WR6E 3PHXB 3A4SC 1WZ3A 4GOCA 2V3SA 1UBQA 4GSWA 1E8YA 3QARA 4GGQA 2EMTA 2GOWA 2MW5A 3DBRI 5DPTA 4MJSB 2KNBA 3W1SA 4M8MA 4LJOB 4W9LA 1OGWA 1V5TA 3ZKJC 1V86A 3L0WB 3BY4B 4DHZE 2HD5B 5D6JB 2KDBA 3UQBA 1TZ1A 4CHKA 3PREA 2IYDB 3QC8B 3APCA 4II2B 4NQLB 1D3ZA 3TCAA 3VUXA 2FIFA 3KYCD 3L08A 2NPTB 3CMMB 3ONSA 4YL8A 3SDLC 1WMHB 1EF5A 2BWES 3UIPB 4I6LB 3QK0A 4PYUA 3EFUA 2J0MA 4NJ7A 2A5UA 3QQ8B 2KKCA 3V61A 3A1QB 3DDCB 1OEYA 2FAZA 3NY5A 4W9EA 2JPHA 2DZKA 3H1UA 4CYEA 4F7ZA 2KFKA 5HKHA 3DPDA 2I1JA 3JVZX 4ANVA 5G2NA 4FLHA 3V6EB 2ZCBA 3VTUA 3N32A 5CHFA 4URKA 3V6CB 3PRMB 1U4AA 1BT0A 2FNJB 3CSFA 2V4LA 4G11A 2GBJA 4AUQC 2J7QB 5CX3A 2MBEA 1LFDA 4HK2A 3VHTC 2KN5A 4PS3A 1RRBA 3ENEA 4FBJB 1WJUA 4W9FA 2C7HA 2XK5A 4ZYNA 4MDKE 2AL6A 4MGKE 3DBHI 5E6OA 4JL9A 1ZGUB 3QJZA 3VH3B 4WJOA 1XQQA 1FXTB 2N9XA 3AU4A 2L05A 2C7MB 4G50A 1VD2A 1V81A 2CU1A 5DPRA 3WAOA 2BYVE 2LRUA 4WJQA 2KK8A 3H7PA 2DENB 1SGHA 3APFA 2LGYA 2UWQA 3NHEB 2LD9A 4DHZB 1P0RA 3B0AA 2DX5B 4IG7B 1TGZB 3HM6X 3GZNI 3UIOB 3C0RB 3ZDMC 2WX0A 3KYDD 1UGMA 3A9KA 1EO6A 4GMVA 4HPMB 4HPLB 4G0NB 3ZRFA 1WM3A 4I6PA 4WAAA 2N7EA 1ZKHA 5IAAC 1WJ4A 2M1MA 2REXA 2DZMA 1J0GA 1GJZA 5C1ZA 2KD0A 4MGZE 4HLEA 4HCNB 2CS4A 4MH0E 1WGYA 3QWZB 4MELA 3KUZA 2NBVB 4BKTA 3PZDA 2NVUI 2JF5A 4PS7A 4W9GA 2LXAA 3X0WA 1EF1A 3SU8X 2R2OA 2K8BA 4DDGD 1WX9A 3WALA 5JZEB 5DCNA 2D2QA 3B1LX 3KUCB 1OEYJ 1GC7A 1P98A 5FR6A 3EC8A 2M0XA 2N1VA 1NDDA 2C60A 2LRWA 3RZFA 1V9JA 1LXDA 4FJVB 1R4NI 1WF9A 4ICUA 3L17A 2KHWB 4HJKA 2PE9A 4ZRIA 2N9PC 4P7IA 2IO0B 4GDKB 2WDTB 1WX8A 3M95A 4TKNA 2KTRA 1X1MA 4DHJD 1R4MI 2KMAA 3OJ3A 4MSQB 1A5RA 2YLMA 2RR9A 3QCAA 1Q1OA 3ML9A 2DAJA 1LM8B 1RFAA 2N1WA 3JYUA 3QHTA 3UINB 4KVGB 3T9LA 2WWZA 2XEWA 2KQ7A 4ICVA 4B9KA 1J19A 3L13A 2FCQA 4GDLA 3R7QA 4BBNF 1RAXA 2LVPA 4LJPB 4EKUA 5G55A 3EHVA 2LVOA 3DCGA 1H4RA 4HWIB 1WGDA 4EZLA 1HE8A 5JHBA 2MBOA 5D7GA 2NBUA 3PS6A 3L54A 2BYFA 2IZVB 1YJ1A 3JSVB 2M4NA 2HJ8A 1KJTA 4GB9A 4RMAA 4FN2A 2NPTA 2MX2A 4DHJB 4M0WB 2BKRB 2CHXA 4NY0A 2IBIB 2CHWA 2O6VA 4IC7B 2HE7A 4K1RB 2O6VD 4PYZA 1E90A 2ASQA 2MWSB 4JQWC 1WE7A 3VUWA 3PLUA 4JLCA 2LASA 4IWQA 4W9KA 3WANA 4HDOA 2MP2A 5AZFA 3ML8A 3RUIB 3TBLD 4DK5A 2FUHB 2GBNA 2ZVNA 3VDZA 3EECA 4K81A 4KIKB 2PEAA 5CHWA 3N3KB 2KWVB 1SE9A 2KJ6A 2KX0A 2IY1B 2N9EB 2MSED 3ECIA 3IHPC 3DVGY 3WIMA 2K8HA 4ANXA 1KLVA 3PHWB 1WY8A 3NZUA 5EDSA 2KTFA 2IO3B 3I3TB 2ZNVB 2AEHA 3RCZA 1GG3A 3PSEB 3K9PB 3MJWA 3LDZE 3DVNV 4IWPA 5L95C 2D10A 1E7VA 1NBFC 3UF8A 3U8ZA 1EUVB 2KDEB 4EEWA 4IM2A 1RLFA 4WJNA 3ZUNA 4X57B 2FCNA 2N4FA 1WXSA 4A20A 3VTVA 2KJHB 3AXCA 1YX5B 4GXBA 1WXAA 1S3SG 2KC2A 4EZJA 1ISNA 2QHOA 1Q0WB 1QZEA 2HTHA 2J0JA 2K6DB 1WXMA 2CKHB 2C5LC 2KFKB 2ZVOA 4RM8A 1TBEA 3PPAA 2KZRA 1Q5WB 3N30A 2L8JA 2GBMA 3TIXA 4II3B 3RZWC 4ANUA 2LXCA 4N9F4 5AZHA 2L76A 4K7WA 4I6NB 2K39A 4NAWA 4E74A 1UBIA 1SIFA 5GMVA 2KDIA 5J2RA 1P1AA 4XC2A 3PRZA 1WFYA 4HCPB 2AYOB 4TQ1A 1S1QB 3OAWA 2XK5B 4ZRJA 4RM9A 1MG8A 1C1YB 2DYBA 3KW5B 5DPWA 2JT4B 3ZIMA 4FA6A 3IFWB 4WWPA 1G6JA 4PS8A 1I35A 4ZRKA 3A9JA 5DPSA 3VTWA 2Y5BB 2O2VA 4KZ0A 3L10B 1E8XA 1IP9A 2WX1A 2JUOA 3MTNB 3H7PB 4WJPA 2KXJA 2K6QA 2BPSA 2DAFA 2WYQA 3MHSD 4FJZA 3Q3JA 2Z0EB 2KC1A 3R7RA 1GC6A 3ZNGC 2BWFA 1KM7A 1Z5SB 4AJWA 1XD3B 1IPGA 2IO2B 2D07B 3A9KB 4W9IA 2ZEQA 3RYTA 4A3PA 4B95A 2JWZA 4AP4C 2MA9B 1H8CA 2NBWB 3WA0A 1WGGA 3ZTDA 2JRHA 3VUYA 1UZXB 2XBBC 1YQBA 1L7YA 5E6PA 3L16A 5KHQA 4AJYB 3T8MA 3H9DA 4HXDA 3SHQA 4LDTD 3PGEA 4IW0A 4BKSA 2BKFA 2G45B 3DOWA 4WWOA 1T0YA 3VVWB 3VXWA 1WH3A 3ALBA 5E6NA 1WX7A 3AU5A 1P3QU 1NI2A 1WGRA 2I1KA 2V1YA
chains in the Genus database with same CATH superfamily
4KSKC 3N1YC 1WIAA 4MJSA 4FBJB 1YOVB 4A55A 2ZNVC 3HUIA 3MP9A 3NVZA 4WQOB 1JRUA 4GIVA 3NZSA 2WGSA 4YSYB 1TJEA 3QA8A 1WMHA 3NOBA 4RH6A 4LDTB 3KH0A 3A1QA 3DWMA 4NQKE 1YD8U 2LUEA 1TKGA 1V80A 2ICIA 4NJ6A 3IVFA 3E56A 4MGIE 5JHAA 2PE6B 2NTTA 3J9CA 1L0XB 3AMZA 2KQ4X 4AWJA 1C3TA 2L7RA 2H89B 4JX1C 5AUIA 2AL3A 4W9JA 3A4RA 1WWTA 4KZCA 3VH4B 1V6EA 3HM3A 4TUUA 1PQSA 1C9FA 2GRIA 1WYGA 4RF1A 2EKEC 2WXGA 1WE6A 1B1ZA 2KWCA 1OTRB 1XT9B 4FHKA 4TMAB 1Z2MA 2WNMA 4OZBA 1ZXHA 1E8WA 1QOBA 2MP2B 2SAKA 4G3XB 1WYWB 5L83A 3CF6E 2OHFA 4KV2A 3PV1A 1ET9A 4BZAA 3P2BA 2KO3A 2G4DB 1D5MC 3Q8FA 2C9WB 3AB5A 3U52E 1FNVA 1EU3A 1WXVA 4W9HA 5FR3A 3FC4A 1K53A 3M62B 2B3AA 3PT2B 2JVCA 1L4ZB 2MBQA 1UH6A 2LGXA 3IG3A 1QOAA 3AE8B 2V3NA 4YSXB 1DOIA 3ZNZB 4KSLC 3PZ7A 2MBBB 5AEKB 4KDIC 2QCZA 5BO4B 2W3SA 3SD5A 4AOFA 3LYYA 1ZE3D 4A6QA 4OVVA 4IM0A 4JIOU 1E5WA 4E71A 3DQVA 1L0YB 5I4DA 1C78A 2J0KA 4KKIA 4OVZA 4RCOA 1L2NA 4ASWC 2BF8B 2JXXA 1V2YA 1K8RB 1QOGA 4BKSD 3MHZA 2O2VB 4REZA 2JU6X 3HHMA 2LI5A 1CMXB 3A33B 2D11A 2DNFA 3ZQ4A 3GS2A 2DYOA 3TL5A 2DWQA 3OJ4B 3PRPB 4C80A 4NNJB 1YIWA 2GI9A 1UELA 2IPKD 5EE0A 3BVMA 3U30A 1N6ZA 3ZVVA 1YMHE 2KFJA 4KIKA 1XCQL 4GOCA 2V3SA 1UBQA 3QARA 3DBLB 4WH4A 1KLGD 2MW5A 1QT9A 2KNBA 3W1SA 1XEEA 4W9LA 1OGWA 4OZCA 3L0WB 2HD5B 5D6JB 4CHKA 3AECB 1JALA 4NQLB 1D3ZA 2EELA 2OJWA 4L23A 3CMMB 3ONSA 4PT5A 1E10A 1PGBA 3AEEB 2A5UA 4L2YA 1E7PB 4LNKA 2FAZA 2DZKA 1AYFA 5FK9C 4FXCA 3JVZX 3U7ZA 1XCTL 4FLHA 3V6EB 5CHFA 1U4AA 3AEAB 4OZAA 2J7QB 1E9MA 4ZYNA 1XQQA 2C7MB 4G50A 3Q8BA 3W2DA 1MG4A 1I4PA 2LRUA 2K0PA 3Q69A 4KGSA 2KK8A 3H7PA 3KWLA 1SGHA 3APFA 2MJEA 1P0RA 1TZOA 3ZDMC 1UGMA 2PMVA 4G0NB 1K51A 1ZKHA 2BS3B 2REXA 2KD0A 2CS4A 1WGYA 4MELA 2NBVB 4PS7A 2NVUI 4W9GA 3X0WA 2JZPA 3SFEB 3WALA 5DCNA 2D2QA 2WU2B 2IGHA 4HPPA 3I57A 2BB5A 1I4GA 2C60A 3I9V1 4D2KA 1JWMD 3L17A 3HVZA 4GDKB 2TSSA 4TKNA 1FCLA 4MSQB 2QMTA 3C8YA 2YLMA 1JROA 3QCAA 1Q1OA 3ML9A 3QHTA 1LM8B 3UINB 2XEWA 1AWDA 3R7QA 2M56B 2K3UA 2ONQA 5G55A 2NTSA 3DCGA 3W9CB 1H4RA 4HWIB 4EZLA 1HE8A 1L6UA 2JX5A 2KVZA 4RMAA 4FN2A 5FKAC 4H2AA 4A8XC 4M0WB 3ZYYX 4XWWA 1ROEA 2CHWA 4IC7B 3GE3C 2ASQA 4JQWC 4JLCA 1JQ4A 3FAHA 2MP2A 1KLUD 3ETRA 3TBLD 1QF6A 3KWVA 3AN1A 5CHWA 2IY1B 1YQ3B 4ANXA 3IHPC 1KLVA 3DVGY 2LFIA 4DXFA 1HQRD 3NZUA 2KTFA 3ZJUA 3GZNB 2MEKA 3K9PB 3LDZE 3DVNV 3V05A 5L95C 5EE9A 3UF8A 4ITKA 3ZUNA 1ESFA 4X57B 2FCNA 2K9XA 1VJKA 2QDFA 4A20A 1QZEA 2HTHA 1WXMA 2CKHB 4UDUC 4RM8A 4KKJA 1Q5WB 3N30A 3RZWC 4ANUA 5AZHA 2WXMA 1SIFA 3PRZA 2XN9C 1KF6B 3FKYA 3OAWA 3MJ5A 2X8XX 3ZIMA 2MJ3A 4A9AA 2H88B 2O2VA 2VZKD 2N7JA 3L10B 1IP9A 4BAXA 3MTNB 2V4IB 2K6QA 1XLOA 4L1BA 2D3AA 3R7RA 3ZNGC 2L52A 1QOFA 4AJWA 1XD3B 2KN4A 3DBRB 4W9IA 1TY0A 2JWZA 4AP4C 1H8CA 1UWMA 2XBBC 4HKZE 3T8MA 3H9DA 1PUTA 2BKFA 4WWOA 3DWGC 1I4XA 1WX7A 1ZOYB 4DBGA 1P3QU 1NI2A 2WXJA 2V1YA 2LEKA 5D94A 1VCBA 3GE8C 4FHJA 2AWTA 3NS8A 3OLMD 1VR9A 5LLIA 5TR5A 2PIAA 2M8SA 1M4VA 3VQIA 2KACA 2M19A 2HDEA 1FNWA 3CSTA 3QAQA 4FJYA 5LXHA 2JY6A 1VZ7A 3APDA 4EFOA 1GB1A 2L00B 4OHJA 1V97A 1J8CA 3DVNU 2FCSA 4JPSA 2C7NB 4GN1A 3VRAB 1PGAA 4HDQA 3O13A 3O65B 3Q8EA 3IT6B 5HG2A 2UYZB 1WXQA 3FILB 1C79A 4BOSC 2KANA 2RDBC 1V1OA 4BVUC 2INNE 3RD2A 3RT3B 2FUG1 1QILA 2K1FA 2O6VB 2Y5CA 2MJDA 1EU4A 2DLBA 5IP4D 4HKQA 2KYWA 3AE9B 5T8IA 2MCNB 2LWPA 3TSSA 1AW7A 3T3OA 1GUAB 3WAPA 3TEYA 3KLSX 2KWUB 3ZJVA 4YTPB 3Q3MC 2L1AA 2RD0A 1GNUA 1WM2A 1A70A 2CHZA 4IKGA 2K8CA 1CZPA 2ZPYA 2DHZA 2Z59B 3H8HA 4BBNC 4EE2A 4YTNB 4ZRPA 1FO4A 2IDYA 4A3OA 3RPFC 2INDC 4J6IA 1R4MB 2KWDA 3UGBB 1MHHE 1P9DU 1TS3A 1E8ZA 1YNTE 2HJ1A 3P4SB 1XF5L 3BYYB 1K50A 3H6NA 1N60A 2JWUA 3KUDB 4C56C 2ZCCA 2JQRB 4GDKA 1WJ6A 5LNK1 3VFKA 2MQJA 1TYGB 2RSUA 4MACA 2EMSA 1ACCA 1FFVA 4XDCA 4F8CB 1OQQA 4W9CA 1KOTA 2RDHA 2ZPNA 4N59A 4DWFA 1OFFA 2OJRA 1AN8A 3IBEA 2AQ3B 3PO0A 3ZTCA 3R2TA 5JH5C 4EUTA 1WRDB 3BVZA 4M0WA 1NYQA 1JWUD 4JE3B 2FIDA 4WWMA 1SE4A 3MC0B 2BBCA 2INCC 4DDID 1I42A 4LK0M 3BIID 1D6EC 4FULA 4XX5A 1WI0A 2V9HA 1E8YA 2HTME 1EWCA 3DBRI 2QSDA 4M8MA 1V5TA 3ZKJC 1DOXA 3BY4B 2KDBA 1TZ1A 3P42A 4YXDB 1J7AA 1ZDVA 4PYUA 2J0MA 2PLPA 2KKCA 3V61A 3NY5A 4CYEA 4F7ZA 2AX5A 2BS2B 3DPDA 2J42A 3EFCA 2ZCBA 4URKA 5BMGA 4YWGG 1FMAD 2FNJB 3CSFA 1ENFA 2GBJA 2ZW1A 2RMMA 1WJUA 4W9FA 2C7HA 4MDKE 3U4EG 4MGKE 3VH3B 4WJOA 1V81A 2CU1A 1HTQA 4WJQA 4MM3B 2DENB 1YN4A 2L83A 1ZPSA 3NHEB 1NI3A 2J4XA 1TGZB 3UIOB 4RNAA 4O1NA 1EO6A 4HPLB 3ZRFA 1WM3A 4YTMB 3SEBA 1GAQB 2JXTA 5IAAC 1WJ4A 1GOZA 3AH7A 4N6EB 4HCNB 2QEJC 3NZ3A 2JF5A 3W5UB 2J53A 1SSNA 3URYA 1GC7A 1P98A 4MH8A 2M0XA 2N1VA 1ET6A 4FJVB 1WF9A 1SJED 1WX8A 1X1MA 1GB4A 1R4MI 4OW0A 4HRSA 1FXAA 1UNSA 1A5RA 1KH0A 4GLSC 1TIFA 3JYUA 2V3PA 3T9LA 1YJJA 3BVGA 3RNGC 4EKUA 1L6VA 3FILA 3PS6A 1KJTA 2DBYA 4DHJB 4NY0A 1C77A 1TT5B 2O6VA 2HE7A 4C4VB 2N9LA 2O6VD 1XLQA 2JSVX 1F1HA 1E90A 2GLSA 2LASA 3RNCC 5AZFA 1FM0D 4K81A 2KX0A 2WLBA 3ECIA 2K8HA 1NEKB 1SJHD 5MPOA 1WY8A 1JMLA 5EDSA 2IO3B 4LNFA 4IWPA 2D10A 1RWSA 4EEWA 4QAYA 1RLFA 1SIJA 3P63A 3AE5B 3AXCA 1YX5B 1WXAA 2KC2A 1D5XC 2QHOA 1Q0WB 2QILA 1MFWA 2LHEA 1RYJA 2KFKB 4R3DA 2L8JA 1RM6C 4II3B 1N5XA 4N9F4 3NVWA 4K7WA 4ZHPA 1SBBB 4E74A 2Z8LA 5J2RA 4XC2A 3RNEC 2W3RA 4HCPB 4TQ1A 2XK5B 4FA6A 4ZRKA 3VTWA 2RPVA 2JUOA 1KTKA 2CJOA 2KXJA 4FJZA 2K22A 3Q3JA 2W54A 1WGKA 2Z0EB 1GC6A 1IPGA 2IO2B 3TUOA 3AE4B 1T0SC 2NBWB 3WA0A 1VDVA 2JRHA 4WIPA 2KMMA 3VUYA 2JYEA 5E6PA 5KHQA 1UF0A 3NUHB 3SHQA 4LDTD 3PGEA 4IW0A 3Q2AC 3DOWA 3ALBA 5E6NA 2I1KA 3RN9C 4ARCA 1WGRA 2YVCA 2WXLA 3QX1A 4M02A 4XZ4A 2ZZPB 5AZGA 1L4DB 3AE6B 2KDMA 1BMLC 1IGCA 1BUIC 2ZJDA 2QIEB 2KTRB 1SXTA 1TS2A 1AARA 5BMHA 3VAWA 1C4PA 3B08A 3CIRB 5TSSA 5EE3A 2Y3AA 3CWIA 1C76A 4LTUA 4GDLB 2WXFA 2CR5A 1TS4A 2LGDA 1FCCC 2N0SB 4NJCA 1WJNA 5BMIA 3DHIC 2L0FA 4ZOHC 3ZLZA 1P7FA 3V60A 4GU2A 2WP9B 1ZUD2 4J3OD 1QKZA 4AS1A 1SB3C 3ZJTA 2PPHA 2WXRA 3R66C 3ZRCA 3B2FA 3H7SA 3DBLI 1MPEA 4MM3A 1UD7A 3TEXA 2KX3A 1N63A 5HI1A 2NS5A 4F1SA 2D3BA 5CHVC 1K52A 4BKGA 4OVUA 5IA7A 3ZO5B 1WGHA 2L0TA 1LO5D 3BINA 2RPQA 1V5OA 2PVOD 3ZW3A 1FXIA 1RFKA 2DYMA 2MBHA 2ZW0A 4NZLB 4DQOC 1E7UA 3WAMA 1YQ4B 2AQ1B 2GMIC 2WS3B 3AM9A 1WSPA 3B9JA 2VRRB 2FCMA 3MFGA 5D3DA 1EWYC 2D3GA 2DZJA 4ANWA 3ZNHB 3IXSA 2KMCA 1ZW7A 3V62A 3KVFB 1IYFA 2X38A 2NMQA 3I63C 1I7HA 3BK2A 1XLPA 2RDGA 2K5PA 3PVLA 2PW9A 4WURA 4DXAB 3M3JA 3IT4B 3W1SC 3Q3FA 4EOYA 3N1XC 4MSMB 2KDFB 2KQSA 3RULA 2WXNA 4C4VA 1IBXB 4WWNA 4IUMB 5D2MB 4M8NA 2K25A 3R2IA 5AUKA 4P1CC 4LCDE 4EZKA 2RGFA 3N1ZC 4BFRA 4RGNA 1DYQA 5KHOA 3A4SC 2WXIA 3EA6A 1SEBD 4DXGA 1DOYA 3N20C 2EMTA 2G9HD 2CU3A 4LJOB 1Y56A 1V86A 4DHZE 3PZ8A 3UQBA 3PREA 2W55A 4II2B 3VUXA 3KYCD 1JWAD 1T0RC 3L08A 1EF5A 3UIPB 4RGMA 4I6LB 2OEDA 1V1PB 3QK0A 3EFUA 3GP7A 2BB6A 2MH7A 3DDCB 1OEYA 2JPHA 2KFKA 5HKHA 2YEPF 2Q5WD 2I1JA 1JCKB 4ANVA 4P1BC 5G2NA 3P4QB 3VTUA 3N32A 3PRMB 3U2SC 2V4LA 1C4AA 1B9RA 4AUQC 3VHTC 4HK2A 3KQ4A 4A90A 4ZHOA 1RRBA 3VR8B 2XK5A 5E6OA 4JL9A 3QJZA 3TEZA 2D5GA 2N9XA 2L05A 2BYVE 3LB8C 4LNIA 2LGYA 4DHZB 2BTEA 3B0AA 2DX5B 3NS1A 3GZNI 3C0RB 2WX0A 2KT7A 3KYDD 4GMVA 1GPXA 4HPMB 5HHDG 2PKOA 1FFUA 4WAAA 3RNAC 2M1MA 4C00A 1J0GA 3IAM1 2LGSA 5C1ZA 4MGZE 4YT0B 2WU5B 1UUPA 1HZ6A 3QWZB 3Q8AA 3KUZA 1STEA 4BKTA 1EF1A 4USAA 3SU8X 2R2OA 1WX9A 2WXQA 5JZEB 1OEYJ 4XGAB 3EC8A 3AE3B 1F0ZA 3Q14C 1FNUA 1V9JA 1LXDA 3Q6BA 1NVID 4ZRIA 2N9PC 4P7IA 2IO0B 4AQ7A 2WDTB 2KTRA 1SE3A 1YN5A 2LHDA 2VH2A 3P4PB 3UI3A 2KMAA 3HRDD 5JXVA 4KGRA 3OG5A 5EE1A 2RR9A 3DHHC 2DAJA 2N1WA 4B0MA 1OQRA 1SE2A 2IJ0A 2WQYB 4B9KA 2KQ7A 4ICVA 3SR6A 2FCQA 4GDLA 4BBNF 1RAXA 1TKYA 2LVOA 5E6JA 3IAS1 1WGDA 2I2YA 5JHBA 2MBOA 3C19A 3OWEB 2IZVB 3JSVB 2HJ8A 4GB9A 1ZDXA 2NPTA 2FE8A 2BKRB 2CHXA 3BYTB 1HZ5A 4K1RB 1PDXA 1TS5A 4PYZA 1WE7A 1XLNA 3PLUA 4JWUC 3WANA 3RUIB 1NENB 4HJGE 3N3KB 2KWVB 1SE9A 1N5WA 1E0ZA 2G1EA 2ZNVB 1PGXA 2AEHA 3PSEB 3RI7C 3TEWA 1E7VA 4MT5A 1NBFC 1R7SA 2EKIA 1EUVB 3U8ZA 4IM2A 4WJNA 1P7EA 3VTVA 4JWSC 2KJHB 4GXBA 2J0JA 2K6DB 1J7CA 1TBEA 2GBMA 3TIXA 3AEGB 2E6XA 3NRZA 4I6NB 5GMVA 1L0VB 2KDIA 3AEBB 2R61A 1P1AA 3B2GA 2WDRB 4RF0A 1CJEA 2E3TA 2WHIA 4K3CA 1T5XD 3MC8A 1MG8A 1C1YB 4RM9A 4ZRJA 3KW5B 2JT4B 1VZ6A 3IFWB 4WWPA 1G6JA 5DPSA 3I5JC 5BYSA 3ZGZA 4KZ0A 4WJPA 2WYQA 1LGRA 1F2RI 1KM7A 1Z5SB 2BW2A 1IBXA 2D07B 3A9KB 3RYTA 2MA9B 1WGGA 4S0RA 1UZXB 1YQBA 1L7YA 4KX6B 2WDVB 4AJYB 3R8BA 4S17A 4HXDA 5IN7A 4BKSA 2VZKB 3AU5A 2N7DA 3K9OB 4K7UA 1YN3A 1J7BA 3M63B 2KLCA 2IO1B 3VR9B 3ZXVA 2L32A 3VRBB 4FADA 3PLVA 1WRIA 4Q2JA 1FIQA 1FD6A 3TJPA 5IKCM 5H92C 1OQYA 1LQBA 2MLBA 1NYRA 2KVRA 4MGYE 2JRIB 5C2TB 1V1PA 1PFDA 2IY0B 3P1MA 2PJHA 4RFBA 3HK0A 5G5HA 3D32A 3RNBC 3DBHB 2CJNA 3R3MA 4BOZB 2IGGA 4MEMA 4B6WA 3GOEA 4XWTA 2OOBB 1JWBD 2PVGC 4CQNA 2J52A 2LJ5A 2Z0DB 3TMPB 2BYEA 4TQ0A 2DZIA 3U7DA 2LZ6A 5CTRC 4JGHB 1MVKA 3PTFC 4ZYSA 4IM3A 4M00A 3AULA 4HVBA 2JZZA 2WXPA 3AI5A 3DVGX 2BT6A 1WZ0A 1M94A 4NPNA 4ACFA 2BS4B 2M17A 3WCQA 5D3IB 4N58A 2GBRA 1VRAB 2GBKA 5J18A 3BK1A 3ZXRA 1Y8RC 2A4ZA 1TTNA 1WR1A 3ZNID 2QJLA 4TSSA 3RMKC 1R4NB 5BYRA 2G3QB 3ZDTA 1SF0A 4KDLB 2XNAC 2LVQA 3NG0A 3UQAA 2MRPA 3HIZA 3GB1A 2KJRA 4P16A 2KOXA 1F52A 2R2QA 1F77A 3DBSA 4CO7A 1TKEA 3LJ3A 3JW0X 3P4RB 5LXIB 1HEZE 4K7SA 2NCNA 2SEBD 2V0GA 4NAWB 2JZ3B 4YSZB 4LNNA 4TV3A 3RFZB 2G4SA 2GB1A 3AE1B 4HEA1 1JRPA 2D3CA 1YX6B 1I4RA 3LXFA 1V49A 4XYCA 3A9JB 2LUMA 2QC8A 1F9JA 2Y5PA 1I4QA 3W1YA 4ZDVA 4IWOA 1HA5A 2NR2A 2L3ZA 3JSVA 5C23A 3X23A 1XXGA 4C7ZA 4W9DA 3S2AA 4E3CA 2KLGA 5J17A 1N62A 1IGDA 1C4CA 2W9NA 3W5VB 1L5PA 3V3XA 5H8YE 2BGFA 3QIJA 3Q8CA 1I4HA 1WR6E 4K3BA 3PHXB 1WZ3A 4GSWA 1MHXA 4GGQA 2GOWA 5DPTA 4MJSB 2WXKA 5C3JB 3AE7B 1MI0A 2IYDB 5IOIA 3QC8B 2N9KA 3NVVA 3APCA 3RNFC 4LNOA 3TCAA 2FIFA 1IUEA 2LMCA 2NPTB 4YL8A 3SDLC 1WMHB 2BWES 4NJ7A 3QQ8B 3A1QB 4W9EA 2W82A 3H1UA 3Q3OC 2KAJA 3Q3NC 3V6CB 1KFYB 1BT0A 4G11A 5CX3A 2MBEA 1LFDA 4XDDA 1T6BX 2KN5A 4PS3A 1VZ8A 3ENEA 2AL6A 3DBHI 4IOIE 1ZGUB 3AU4A 1FXTB 5HFYA 1VD2A 5DPRA 3WAOA 3DHGC 2UWQA 2LD9A 4IG7B 3HM6X 3A9KA 3EGRA 5G5GA 4I6PA 2M0AA 2N7EA 1UWXA 2DZMA 1GJZA 4HLEA 3EUB2 3HVDA 4MH0E 3PZDA 1EM7A 4WQMA 2LXAA 2BQQA 2MHJA 2K8BA 4DDGD 3B1LX 3KUCB 2IGDA 5FR6A 2FBWB 1FRRA 1NDDA 3RZFA 2LRWA 2ON8A 3L4PA 3NJTA 3T3NA 1R4NI 1UGJA 4ICUA 4HJKA 2KHWB 2PE9A 1QQRA 3M95A 5GXGB 4DHJD 2WXOA 3OJ3A 2I38A 1RFAA 3SFDB 1MJDA 4KVGB 2AQ2B 1QLBB 2WWZA 1J19A 3L13A 2LVPA 4LJPB 4IDIA 1D4BA 3EHVA 3E9SA 1HXYD 1FPYA 5IO9A 4KGTA 5D7GA 2NBUA 3L54A 2BYFA 2LJIA 1F2RC 1YJ1A 2M4NA 4PK1A 2MX2A 2IBIB 1Q10A 2BVCA 4RGOS 2MWSB 3VUWA 1TY2A 3BWUD 2YEPB 4IWQA 2JYTA 4W9KA 4HDOA 3ML8A 4DK5A 2FUHB 2GBNA 2ZVNA 3VDZA 1HTOA 3EECA 4KIKB 3NVYA 2PEAA 1KRHA 2PTLA 2WXHA 5BYQA 4WAFA 1PYWD 2KJ6A 2N9EB 2MSED 3WIMA 2WDQB 1JW9D 3PHWB 1FEHA 1V8CA 3I3TB 4US9A 3RCZA 1GG3A 4M01A 3MJWA 1JWSD 1VLBA 2KDEB 4ARIA 2N4FA 1WXSA 3N9YC 4C7YA 3AV8A 3AE2B 1BXTA 1S3SG 4EZJA 4US8A 1ISNA 4B0EA 1T3QA 2B76B 2C5LC 1FRDA 2ZVOA 3PPAA 2KZRA 2LXCA 1DGJA 2L76A 2K39A 4NAWA 2ACZB 1UBIA 4HROA 1CK1A 3AEFB 2BYTA 1WFYA 2AYOB 1S1QB 1YJIA 1XO3A 2DYBA 5DPWA 3AEDB 4PS8A 1I35A 4NAMA 3A9JA 2Y5BB 3BZDB 1ZXIA 4RGTA 1E8XA 2WX1A 2UU7A 4ZRQA 1N61A 3H7PB 4P6VF 2BPSA 2DAFA 3MHSD 1E6EB 2KC1A 2BWFA 2ZEQA 2VH1A 4A3PA 4B95A 3ZTDA 2INPE 4LLGM 4XE0A 1T0QC 1CQVA 3L16A 3ABVB 1ZP0B 2G45B 1T0YA 3VVWB 3VXWA 1WH3A 3MC9A 2LGIA 1D5ZC
chains in the Genus database with same CATH topology
4KSKC 2N7DA 1WIAA 3K9OB 3QX1A 4K7UA 4MJSA 4XZ4A 5D94A 1VCBA 4FHJA 2AWTA 3M63B 2KLCA 2IO1B 4DBGA 3NS8A 3OLMD 2ZNVC 5LLIA 5TR5A 4FADA 2ZZPB 2M8SA 5AZGA 3PLVA 3VQIA 4WQOB 3TJPA 1JRUA 1OQYA 4GIVA 1LQBA 2MLBA 2ZJDA 3NZSA 3CSTA 2KVRA 2KTRB 4MGYE 3QA8A 2JRIB 1WMHA 3QAQA 4FJYA 5LXHA 2JY6A 3APDA 1AARA 3NOBA 2IY0B 4EFOA 3VAWA 2L00B 2PJHA 4LDTB 3KH0A 3A1QA 1J8CA 3DVNU 2FCSA 4NQKE 3HK0A 1YD8U 2LUEA 3B08A 1V80A 3D32A 2C7NB 4GN1A 4HDQA 4NJ6A 3R3MA 3O65B 4GDLB 4BOZB 3IVFA 4MGIE 2CR5A 2PE6B 5JHAA 4MEMA 2UYZB 4B6WA 2LGDA 3GOEA 4AWJA 1WJNA 4BOSC 1C3TA 2L0FA 2L7RA 2OOBB 2KANA 3ZLZA 4BVUC 2AL3A 4W9JA 2LJ5A 3A4RA 2Z0DB 3TMPB 3V60A 4KZCA 4GU2A 3VH4B 2BYEA 4TQ0A 2DZIA 3U7DA 2LZ6A 1V6EA 3HM3A 3RD2A 3RT3B 5CTRC 4TUUA 1PQSA 4JGHB 3PTFC 4IM3A 2K1FA 2O6VB 2PPHA 2EKEC 3AULA 4HVBA 3R66C 1WE6A 3ZRCA 2JZZA 2KWCA 1OTRB 3AI5A 1XT9B 4FHKA 1Z2MA 3DVGX 3H7SA 3DBLI 2MCNB 2LWPA 4MM3A 1UD7A 1WZ0A 1E8WA 1M94A 4NPNA 4G3XB 2MP2B 5L83A 1WYWB 2KX3A 1GUAB 3WAPA 2M17A 2NS5A 3CF6E 4KV2A 2KWUB 3PV1A 4F1SA 3P2BA 2RD0A 2KO3A 5CHVC 1GNUA 2G4DB 2GBRA 1WM2A 2GBKA 5J18A 2C9WB 4BKGA 4OVUA 1Y8RC 2CHZA 5IA7A 2A4ZA 1TTNA 1WR1A 2YVCA 2K8CA 1WXVA 3ZO5B 1WGHA 2L0TA 2ZPYA 4W9HA 3ZNID 3BINA 2DHZA 2RPQA 2Z59B 4BBNC 1V5OA 3ZW3A 2DYMA 2MBHA 3M62B 2B3AA 3PT2B 1E7UA 2G3QB 4A3OA 3ZDTA 2JVCA 3WAMA 2MBQA 1UH6A 2LGXA 3IG3A 2LVQA 4KDLB 3UQAA 4J6IA 2GMIC 3UGBB 1P9DU 2MRPA 3HIZA 1E8ZA 4KSLC 3ZNZB 2KJRA 2VRRB 2MBBB 2KOXA 5AEKB 2FCMA 2R2QA 4KDIC 3H6NA 5BO4B 3KUDB 3SD5A 4AOFA 3DBSA 2ZCCA 4CO7A 3LJ3A 3JW0X 4GDKA 1WJ6A 2D3GA 2DZJA 5LXIB 4K7SA 4ANWA 4OVVA 3ZNHB 2NCNA 4IM0A 4JIOU 1E5WA 3VFKA 4E71A 2MQJA 3DQVA 2KMCA 2RSUA 4NAWB 2JZ3B 1ZW7A 3V62A 3KVFB 1IYFA 2EMSA 4TV3A 2G4SA 2J0KA 1L2NA 4ASWC 2BF8B 2JXXA 4F8CB 1V2YA 1K8RB 4W9CA 1KOTA 3PVLA 2ZPNA 1YX6B 4DWFA 4BKSD 1V49A 3A9JB 1F9JA 2OJRA 2O2VB 4DXAB 3W1YA 4ZDVA 3HHMA 3M3JA 2LI5A 3IBEA 3W1SC 1CMXB 3Q3FA 4EOYA 3ZTCA 3A33B 2D11A 4IWOA 4MSMB 2KDFB 1WRDB 2NR2A 2KQSA 4EUTA 2L3ZA 5JH5C 3JSVA 5C23A 3RULA 3X23A 2DYOA 2FIDA 3TL5A 4WWNA 4IUMB 4W9DA 5D2MB 4M8NA 3OJ4B 2K25A 3PRPB 3S2AA 4NNJB 1YIWA 4LCDE 4E3CA 1UELA 4DDID 1I42A 2KLGA 5J17A 4EZKA 2RGFA 2W9NA 4FULA 4XX5A 3U30A 4BFRA 2BGFA 3QIJA 1WI0A 4KIKA 2KFJA 3ZVVA 5KHOA 1WR6E 3PHXB 3A4SC 1WZ3A 4GOCA 2V3SA 1UBQA 4GSWA 1E8YA 3QARA 4GGQA 2EMTA 2GOWA 2MW5A 3DBRI 5DPTA 4MJSB 2KNBA 3W1SA 4M8MA 4LJOB 4W9LA 1OGWA 1V5TA 3ZKJC 1V86A 3L0WB 3BY4B 4DHZE 2HD5B 5D6JB 2KDBA 3UQBA 1TZ1A 4CHKA 3PREA 2IYDB 3QC8B 3APCA 4II2B 4NQLB 1D3ZA 3TCAA 3VUXA 2FIFA 3KYCD 3L08A 2NPTB 3CMMB 3ONSA 4YL8A 3SDLC 1WMHB 1EF5A 2BWES 3UIPB 4I6LB 3QK0A 4PYUA 3EFUA 2J0MA 4NJ7A 2A5UA 3QQ8B 2KKCA 3V61A 3A1QB 3DDCB 1OEYA 2FAZA 3NY5A 4W9EA 2JPHA 2DZKA 3H1UA 4CYEA 4F7ZA 2KFKA 5HKHA 3DPDA 2I1JA 3JVZX 4ANVA 5G2NA 4FLHA 3V6EB 2ZCBA 3VTUA 3N32A 5CHFA 4URKA 3V6CB 3PRMB 1U4AA 1BT0A 2FNJB 3CSFA 2V4LA 4G11A 2GBJA 4AUQC 2J7QB 5CX3A 2MBEA 1LFDA 4HK2A 3VHTC 2KN5A 4PS3A 1RRBA 3ENEA 4FBJB 1WJUA 4W9FA 2C7HA 2XK5A 4ZYNA 4MDKE 2AL6A 4MGKE 3DBHI 5E6OA 4JL9A 1ZGUB 3QJZA 3VH3B 4WJOA 1XQQA 1FXTB 2N9XA 3AU4A 2L05A 2C7MB 4G50A 1VD2A 1V81A 2CU1A 5DPRA 3WAOA 2BYVE 2LRUA 4WJQA 2KK8A 3H7PA 2DENB 1SGHA 3APFA 2LGYA 2UWQA 3NHEB 2LD9A 4DHZB 1P0RA 3B0AA 2DX5B 4IG7B 1TGZB 3HM6X 3GZNI 3UIOB 3C0RB 3ZDMC 2WX0A 3KYDD 1UGMA 3A9KA 1EO6A 4GMVA 4HPMB 4HPLB 4G0NB 3ZRFA 1WM3A 4I6PA 4WAAA 2N7EA 1ZKHA 5IAAC 1WJ4A 2M1MA 2REXA 2DZMA 1J0GA 1GJZA 5C1ZA 2KD0A 4MGZE 4HLEA 4HCNB 2CS4A 4MH0E 1WGYA 3QWZB 4MELA 3KUZA 2NBVB 4BKTA 3PZDA 2NVUI 2JF5A 4PS7A 4W9GA 2LXAA 3X0WA 1EF1A 3SU8X 2R2OA 2K8BA 4DDGD 1WX9A 3WALA 5JZEB 5DCNA 2D2QA 3B1LX 3KUCB 1OEYJ 1GC7A 1P98A 5FR6A 3EC8A 2M0XA 2N1VA 1NDDA 2C60A 2LRWA 3RZFA 1V9JA 1LXDA 4FJVB 1R4NI 1WF9A 4ICUA 3L17A 2KHWB 4HJKA 2PE9A 4ZRIA 2N9PC 4P7IA 2IO0B 4GDKB 2WDTB 1WX8A 3M95A 4TKNA 2KTRA 1X1MA 4DHJD 1R4MI 2KMAA 3OJ3A 4MSQB 1A5RA 2YLMA 2RR9A 3QCAA 1Q1OA 3ML9A 2DAJA 1LM8B 1RFAA 2N1WA 3JYUA 3QHTA 3UINB 4KVGB 3T9LA 2WWZA 2XEWA 2KQ7A 4ICVA 4B9KA 1J19A 3L13A 2FCQA 4GDLA 3R7QA 4BBNF 1RAXA 2LVPA 4LJPB 4EKUA 5G55A 3EHVA 2LVOA 3DCGA 1H4RA 4HWIB 1WGDA 4EZLA 1HE8A 5JHBA 2MBOA 5D7GA 2NBUA 3PS6A 3L54A 2BYFA 2IZVB 1YJ1A 3JSVB 2M4NA 2HJ8A 1KJTA 4GB9A 4RMAA 4FN2A 2NPTA 2MX2A 4DHJB 4M0WB 2BKRB 2CHXA 4NY0A 2IBIB 2CHWA 2O6VA 4IC7B 2HE7A 4K1RB 2O6VD 4PYZA 1E90A 2ASQA 2MWSB 4JQWC 1WE7A 3VUWA 3PLUA 4JLCA 2LASA 4IWQA 4W9KA 3WANA 4HDOA 2MP2A 5AZFA 3ML8A 3RUIB 3TBLD 4DK5A 2FUHB 2GBNA 2ZVNA 3VDZA 3EECA 4K81A 4KIKB 2PEAA 5CHWA 3N3KB 2KWVB 1SE9A 2KJ6A 2KX0A 2IY1B 2N9EB 2MSED 3ECIA 3IHPC 3DVGY 3WIMA 2K8HA 4ANXA 1KLVA 3PHWB 1WY8A 3NZUA 5EDSA 2KTFA 2IO3B 3I3TB 2ZNVB 2AEHA 3RCZA 1GG3A 3PSEB 3K9PB 3MJWA 3LDZE 3DVNV 4IWPA 5L95C 2D10A 1E7VA 1NBFC 3UF8A 3U8ZA 1EUVB 2KDEB 4EEWA 4IM2A 1RLFA 4WJNA 3ZUNA 4X57B 2FCNA 2N4FA 1WXSA 4A20A 3VTVA 2KJHB 3AXCA 1YX5B 4GXBA 1WXAA 1S3SG 2KC2A 4EZJA 1ISNA 2QHOA 1Q0WB 1QZEA 2HTHA 2J0JA 2K6DB 1WXMA 2CKHB 2C5LC 2KFKB 2ZVOA 4RM8A 1TBEA 3PPAA 2KZRA 1Q5WB 3N30A 2L8JA 2GBMA 3TIXA 4II3B 3RZWC 4ANUA 2LXCA 4N9F4 5AZHA 2L76A 4K7WA 4I6NB 2K39A 4NAWA 4E74A 1UBIA 1SIFA 5GMVA 2KDIA 5J2RA 1P1AA 4XC2A 3PRZA 1WFYA 4HCPB 2AYOB 4TQ1A 1S1QB 3OAWA 2XK5B 4ZRJA 4RM9A 1MG8A 1C1YB 2DYBA 3KW5B 5DPWA 2JT4B 3ZIMA 4FA6A 3IFWB 4WWPA 1G6JA 4PS8A 1I35A 4ZRKA 3A9JA 5DPSA 3VTWA 2Y5BB 2O2VA 4KZ0A 3L10B 1E8XA 1IP9A 2WX1A 2JUOA 3MTNB 3H7PB 4WJPA 2KXJA 2K6QA 2BPSA 2DAFA 2WYQA 3MHSD 4FJZA 3Q3JA 2Z0EB 2KC1A 3R7RA 1GC6A 3ZNGC 2BWFA 1KM7A 1Z5SB 4AJWA 1XD3B 1IPGA 2IO2B 2D07B 3A9KB 4W9IA 2ZEQA 3RYTA 4A3PA 4B95A 2JWZA 4AP4C 2MA9B 1H8CA 2NBWB 3WA0A 1WGGA 3ZTDA 2JRHA 3VUYA 1UZXB 2XBBC 1YQBA 1L7YA 5E6PA 3L16A 5KHQA 4AJYB 3T8MA 3H9DA 4HXDA 3SHQA 4LDTD 3PGEA 4IW0A 4BKSA 2BKFA 2G45B 3DOWA 4WWOA 1T0YA 3VVWB 3VXWA 1WH3A 3ALBA 5E6NA 1WX7A 3AU5A 1P3QU 1NI2A 1WGRA 2I1KA 2V1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSK C;  2N7D A;  1WIA A;  3K9O B;  3QX1 A;  4K7U A;  4MJS A;  4XZ4 A;  5D94 A;  1VCB A;  4FHJ A;  2AWT A;  3M63 B;  2KLC A;  2IO1 B;  4DBG A;  3NS8 A;  3OLM D;  2ZNV C;  5LLI A;  5TR5 A;  4FAD A;  2ZZP B;  2M8S A;  5AZG A;  3PLV A;  3VQI A;  4WQO B;  3TJP A;  1JRU A;  1OQY A;  4GIV A;  1LQB A;  2MLB A;  2ZJD A;  3NZS A;  3CST A;  2KVR A;  2KTR B;  4MGY E;  3QA8 A;  2JRI B;  1WMH A;  3QAQ A;  4FJY A;  5LXH A;  2JY6 A;  3APD A;  1AAR A;  3NOB A;  2IY0 B;  4EFO A;  3VAW A;  2L00 B;  2PJH A;  4LDT B;  3KH0 A;  3A1Q A;  1J8C A;  3DVN U;  2FCS A;  4NQK E;  3HK0 A;  1YD8 U;  2LUE A;  3B08 A;  1V80 A;  3D32 A;  2C7N B;  4GN1 A;  4HDQ A;  4NJ6 A;  3R3M A;  3O65 B;  4GDL B;  4BOZ B;  3IVF A;  4MGI E;  2CR5 A;  2PE6 B;  5JHA A;  4MEM A;  2UYZ B;  4B6W A;  2LGD A;  3GOE A;  4AWJ A;  1WJN A;  4BOS C;  1C3T A;  2L0F A;  2L7R A;  2OOB B;  2KAN A;  3ZLZ A;  4BVU C;  2AL3 A;  4W9J A;  2LJ5 A;  3A4R A;  2Z0D B;  3TMP B;  3V60 A;  4KZC A;  4GU2 A;  3VH4 B;  2BYE A;  4TQ0 A;  2DZI A;  3U7D A;  2LZ6 A;  1V6E A;  3HM3 A;  3RD2 A;  3RT3 B;  5CTR C;  4TUU A;  1PQS A;  4JGH B;  3PTF C;  4IM3 A;  2K1F A;  2O6V B;  2PPH A;  2EKE C;  3AUL A;  4HVB A;  3R66 C;  1WE6 A;  3ZRC A;  2JZZ A;  2KWC A;  1OTR B;  3AI5 A;  1XT9 B;  4FHK A;  1Z2M A;  3DVG X;  3H7S A;  3DBL I;  2MCN B;  2LWP A;  4MM3 A;  1UD7 A;  1WZ0 A;  1E8W A;  1M94 A;  4NPN A;  4G3X B;  2MP2 B;  5L83 A;  1WYW B;  2KX3 A;  1GUA B;  3WAP A;  2M17 A;  2NS5 A;  3CF6 E;  4KV2 A;  2KWU B;  3PV1 A;  4F1S A;  3P2B A;  2RD0 A;  2KO3 A;  5CHV C;  1GNU A;  2G4D B;  2GBR A;  1WM2 A;  2GBK A;  5J18 A;  2C9W B;  4BKG A;  4OVU A;  1Y8R C;  2CHZ A;  5IA7 A;  2A4Z A;  1TTN A;  1WR1 A;  2YVC A;  2K8C A;  1WXV A;  3ZO5 B;  1WGH A;  2L0T A;  2ZPY A;  4W9H A;  3ZNI D;  3BIN A;  2DHZ A;  2RPQ A;  2Z59 B;  4BBN C;  1V5O A;  3ZW3 A;  2DYM A;  2MBH A;  3M62 B;  2B3A A;  3PT2 B;  1E7U A;  2G3Q B;  4A3O A;  3ZDT A;  2JVC A;  3WAM A;  2MBQ A;  1UH6 A;  2LGX A;  3IG3 A;  2LVQ A;  4KDL B;  3UQA A;  4J6I A;  2GMI C;  3UGB B;  1P9D U;  2MRP A;  3HIZ A;  1E8Z A;  4KSL C;  3ZNZ B;  2KJR A;  2VRR B;  2MBB B;  2KOX A;  5AEK B;  2FCM A;  2R2Q A;  4KDI C;  3H6N A;  5BO4 B;  3KUD B;  3SD5 A;  4AOF A;  3DBS A;  2ZCC A;  4CO7 A;  3LJ3 A;  3JW0 X;  4GDK A;  1WJ6 A;  2D3G A;  2DZJ A;  5LXI B;  4K7S A;  4ANW A;  4OVV A;  3ZNH B;  2NCN A;  4IM0 A;  4JIO U;  1E5W A;  3VFK A;  4E71 A;  2MQJ A;  3DQV A;  2KMC A;  2RSU A;  4NAW B;  2JZ3 B;  1ZW7 A;  3V62 A;  3KVF B;  1IYF A;  2EMS A;  4TV3 A;  2G4S A;  2J0K A;  1L2N A;  4ASW C;  2BF8 B;  2JXX A;  4F8C B;  1V2Y A;  1K8R B;  4W9C A;  1KOT A;  3PVL A;  2ZPN A;  1YX6 B;  4DWF A;  4BKS D;  1V49 A;  3A9J B;  1F9J A;  2OJR A;  2O2V B;  4DXA B;  3W1Y A;  4ZDV A;  3HHM A;  3M3J A;  2LI5 A;  3IBE A;  3W1S C;  1CMX B;  3Q3F A;  4EOY A;  3ZTC A;  3A33 B;  2D11 A;  4IWO A;  4MSM B;  2KDF B;  1WRD B;  2NR2 A;  2KQS A;  4EUT A;  2L3Z A;  5JH5 C;  3JSV A;  5C23 A;  3RUL A;  3X23 A;  2DYO A;  2FID A;  3TL5 A;  4WWN A;  4IUM B;  4W9D A;  5D2M B;  4M8N A;  3OJ4 B;  2K25 A;  3PRP B;  3S2A A;  4NNJ B;  1YIW A;  4LCD E;  4E3C A;  1UEL A;  4DDI D;  1I42 A;  2KLG A;  5J17 A;  4EZK A;  2RGF A;  2W9N A;  4FUL A;  4XX5 A;  3U30 A;  4BFR A;  2BGF A;  3QIJ A;  1WI0 A;  4KIK A;  2KFJ A;  3ZVV A;  5KHO A;  1WR6 E;  3PHX B;  3A4S C;  1WZ3 A;  4GOC A;  2V3S A;  1UBQ A;  4GSW A;  1E8Y A;  3QAR A;  4GGQ A;  2EMT A;  2GOW A;  2MW5 A;  3DBR I;  5DPT A;  4MJS B;  2KNB A;  3W1S A;  4M8M A;  4LJO B;  4W9L A;  1OGW A;  1V5T A;  3ZKJ C;  1V86 A;  3L0W B;  3BY4 B;  4DHZ E;  2HD5 B;  5D6J B;  2KDB A;  3UQB A;  1TZ1 A;  4CHK A;  3PRE A;  2IYD B;  3QC8 B;  3APC A;  4II2 B;  4NQL B;  1D3Z A;  3TCA A;  3VUX A;  2FIF A;  3KYC D;  3L08 A;  2NPT B;  3CMM B;  3ONS A;  4YL8 A;  3SDL C;  1WMH B;  1EF5 A;  2BWE S;  3UIP B;  4I6L B;  3QK0 A;  4PYU A;  3EFU A;  2J0M A;  4NJ7 A;  2A5U A;  3QQ8 B;  2KKC A;  3V61 A;  3A1Q B;  3DDC B;  1OEY A;  2FAZ A;  3NY5 A;  4W9E A;  2JPH A;  2DZK A;  3H1U A;  4CYE A;  4F7Z A;  2KFK A;  5HKH A;  3DPD A;  2I1J A;  3JVZ X;  4ANV A;  5G2N A;  4FLH A;  3V6E B;  2ZCB A;  3VTU A;  3N32 A;  5CHF A;  4URK A;  3V6C B;  3PRM B;  1U4A A;  1BT0 A;  2FNJ B;  3CSF A;  2V4L A;  4G11 A;  2GBJ A;  4AUQ C;  2J7Q B;  5CX3 A;  2MBE A;  1LFD A;  4HK2 A;  3VHT C;  2KN5 A;  4PS3 A;  1RRB A;  3ENE A;  4FBJ B;  1WJU A;  4W9F A;  2C7H A;  2XK5 A;  4ZYN A;  4MDK E;  2AL6 A;  4MGK E;  3DBH I;  5E6O A;  4JL9 A;  1ZGU B;  3QJZ A;  3VH3 B;  4WJO A;  1XQQ A;  1FXT B;  2N9X A;  3AU4 A;  2L05 A;  2C7M B;  4G50 A;  1VD2 A;  1V81 A;  2CU1 A;  5DPR A;  3WAO A;  2BYV E;  2LRU A;  4WJQ A;  2KK8 A;  3H7P A;  2DEN B;  1SGH A;  3APF A;  2LGY A;  2UWQ A;  3NHE B;  2LD9 A;  4DHZ B;  1P0R A;  3B0A A;  2DX5 B;  4IG7 B;  1TGZ B;  3HM6 X;  3GZN I;  3UIO B;  3C0R B;  3ZDM C;  2WX0 A;  3KYD D;  1UGM A;  3A9K A;  1EO6 A;  4GMV A;  4HPM B;  4HPL B;  4G0N B;  3ZRF A;  1WM3 A;  4I6P A;  4WAA A;  2N7E A;  1ZKH A;  5IAA C;  1WJ4 A;  2M1M A;  2REX A;  2DZM A;  1J0G A;  1GJZ A;  5C1Z A;  2KD0 A;  4MGZ E;  4HLE A;  4HCN B;  2CS4 A;  4MH0 E;  1WGY A;  3QWZ B;  4MEL A;  3KUZ A;  2NBV B;  4BKT A;  3PZD A;  2NVU I;  2JF5 A;  4PS7 A;  4W9G A;  2LXA A;  3X0W A;  1EF1 A;  3SU8 X;  2R2O A;  2K8B A;  4DDG D;  1WX9 A;  3WAL A;  5JZE B;  5DCN A;  2D2Q A;  3B1L X;  3KUC B;  1OEY J;  1GC7 A;  1P98 A;  5FR6 A;  3EC8 A;  2M0X A;  2N1V A;  1NDD A;  2C60 A;  2LRW A;  3RZF A;  1V9J A;  1LXD A;  4FJV B;  1R4N I;  1WF9 A;  4ICU A;  3L17 A;  2KHW B;  4HJK A;  2PE9 A;  4ZRI A;  2N9P C;  4P7I A;  2IO0 B;  4GDK B;  2WDT B;  1WX8 A;  3M95 A;  4TKN A;  2KTR A;  1X1M A;  4DHJ D;  1R4M I;  2KMA A;  3OJ3 A;  4MSQ B;  1A5R A;  2YLM A;  2RR9 A;  3QCA A;  1Q1O A;  3ML9 A;  2DAJ A;  1LM8 B;  1RFA A;  2N1W A;  3JYU A;  3QHT A;  3UIN B;  4KVG B;  3T9L A;  2WWZ A;  2XEW A;  2KQ7 A;  4ICV A;  4B9K A;  1J19 A;  3L13 A;  2FCQ A;  4GDL A;  3R7Q A;  4BBN F;  1RAX A;  2LVP A;  4LJP B;  4EKU A;  5G55 A;  3EHV A;  2LVO A;  3DCG A;  1H4R A;  4HWI B;  1WGD A;  4EZL A;  1HE8 A;  5JHB A;  2MBO A;  5D7G A;  2NBU A;  3PS6 A;  3L54 A;  2BYF A;  2IZV B;  1YJ1 A;  3JSV B;  2M4N A;  2HJ8 A;  1KJT A;  4GB9 A;  4RMA A;  4FN2 A;  2NPT A;  2MX2 A;  4DHJ B;  4M0W B;  2BKR B;  2CHX A;  4NY0 A;  2IBI B;  2CHW A;  2O6V A;  4IC7 B;  2HE7 A;  4K1R B;  2O6V D;  4PYZ A;  1E90 A;  2ASQ A;  2MWS B;  4JQW C;  1WE7 A;  3VUW A;  3PLU A;  4JLC A;  2LAS A;  4IWQ A;  4W9K A;  3WAN A;  4HDO A;  2MP2 A;  5AZF A;  3ML8 A;  3RUI B;  3TBL D;  4DK5 A;  2FUH B;  2GBN A;  2ZVN A;  3VDZ A;  3EEC A;  4K81 A;  4KIK B;  2PEA A;  5CHW A;  3N3K B;  2KWV B;  1SE9 A;  2KJ6 A;  2KX0 A;  2IY1 B;  2N9E B;  2MSE D;  3ECI A;  3IHP C;  3DVG Y;  3WIM A;  2K8H A;  4ANX A;  1KLV A;  3PHW B;  1WY8 A;  3NZU A;  5EDS A;  2KTF A;  2IO3 B;  3I3T B;  2ZNV B;  2AEH A;  3RCZ A;  1GG3 A;  3PSE B;  3K9P B;  3MJW A;  3LDZ E;  3DVN V;  4IWP A;  5L95 C;  2D10 A;  1E7V A;  1NBF C;  3UF8 A;  3U8Z A;  1EUV B;  2KDE B;  4EEW A;  4IM2 A;  1RLF A;  4WJN A;  3ZUN A;  4X57 B;  2FCN A;  2N4F A;  1WXS A;  4A20 A;  3VTV A;  2KJH B;  3AXC A;  1YX5 B;  4GXB A;  1WXA A;  1S3S G;  2KC2 A;  4EZJ A;  1ISN A;  2QHO A;  1Q0W B;  1QZE A;  2HTH A;  2J0J A;  2K6D B;  1WXM A;  2CKH B;  2C5L C;  2KFK B;  2ZVO A;  4RM8 A;  1TBE A;  3PPA A;  2KZR A;  1Q5W B;  3N30 A;  2L8J A;  2GBM A;  3TIX A;  4II3 B;  3RZW C;  4ANU A;  2LXC A;  4N9F 4;  5AZH A;  2L76 A;  4K7W A;  4I6N B;  2K39 A;  4NAW A;  4E74 A;  1UBI A;  1SIF A;  5GMV A;  2KDI A;  5J2R A;  1P1A A;  4XC2 A;  3PRZ A;  1WFY A;  4HCP B;  2AYO B;  4TQ1 A;  1S1Q B;  3OAW A;  2XK5 B;  4ZRJ A;  4RM9 A;  1MG8 A;  1C1Y B;  2DYB A;  3KW5 B;  5DPW A;  2JT4 B;  3ZIM A;  4FA6 A;  3IFW B;  4WWP A;  1G6J A;  4PS8 A;  1I35 A;  4ZRK A;  3A9J A;  5DPS A;  3VTW A;  2Y5B B;  2O2V A;  4KZ0 A;  3L10 B;  1E8X A;  1IP9 A;  2WX1 A;  2JUO A;  3MTN B;  3H7P B;  4WJP A;  2KXJ A;  2K6Q A;  2BPS A;  2DAF A;  2WYQ A;  3MHS D;  4FJZ A;  3Q3J A;  2Z0E B;  2KC1 A;  3R7R A;  1GC6 A;  3ZNG C;  2BWF A;  1KM7 A;  1Z5S B;  4AJW A;  1XD3 B;  1IPG A;  2IO2 B;  2D07 B;  3A9K B;  4W9I A;  2ZEQ A;  3RYT A;  4A3P A;  4B95 A;  2JWZ A;  4AP4 C;  2MA9 B;  1H8C A;  2NBW B;  3WA0 A;  1WGG A;  3ZTD A;  2JRH A;  3VUY A;  1UZX B;  2XBB C;  1YQB A;  1L7Y A;  5E6P A;  3L16 A;  5KHQ A;  4AJY B;  3T8M A;  3H9D A;  4HXD A;  3SHQ A;  4LDT D;  3PGE A;  4IW0 A;  4BKS A;  2BKF A;  2G45 B;  3DOW A;  4WWO A;  1T0Y A;  3VVW B;  3VXW A;  1WH3 A;  3ALB A;  5E6N A;  1WX7 A;  3AU5 A;  1P3Q U;  1NI2 A;  1WGR A;  2I1K A;  2V1Y A; 
#chains in the Genus database with same CATH topology
 4KSK C;  3N1Y C;  1WIA A;  4MJS A;  4FBJ B;  1YOV B;  4A55 A;  2ZNV C;  3HUI A;  3MP9 A;  3NVZ A;  4WQO B;  1JRU A;  4GIV A;  3NZS A;  2WGS A;  4YSY B;  1TJE A;  3QA8 A;  1WMH A;  3NOB A;  4RH6 A;  4LDT B;  3KH0 A;  3A1Q A;  3DWM A;  4NQK E;  1YD8 U;  2LUE A;  1TKG A;  1V80 A;  2ICI A;  4NJ6 A;  3IVF A;  3E56 A;  4MGI E;  5JHA A;  2PE6 B;  2NTT A;  3J9C A;  1L0X B;  3AMZ A;  2KQ4 X;  4AWJ A;  1C3T A;  2L7R A;  2H89 B;  4JX1 C;  5AUI A;  2AL3 A;  4W9J A;  3A4R A;  1WWT A;  4KZC A;  3VH4 B;  1V6E A;  3HM3 A;  4TUU A;  1PQS A;  1C9F A;  2GRI A;  1WYG A;  4RF1 A;  2EKE C;  2WXG A;  1WE6 A;  1B1Z A;  2KWC A;  1OTR B;  1XT9 B;  4FHK A;  4TMA B;  1Z2M A;  2WNM A;  4OZB A;  1ZXH A;  1E8W A;  1QOB A;  2MP2 B;  2SAK A;  4G3X B;  1WYW B;  5L83 A;  3CF6 E;  2OHF A;  4KV2 A;  3PV1 A;  1ET9 A;  4BZA A;  3P2B A;  2KO3 A;  2G4D B;  1D5M C;  3Q8F A;  2C9W B;  3AB5 A;  3U52 E;  1FNV A;  1EU3 A;  1WXV A;  4W9H A;  5FR3 A;  3FC4 A;  1K53 A;  3M62 B;  2B3A A;  3PT2 B;  2JVC A;  1L4Z B;  2MBQ A;  1UH6 A;  2LGX A;  3IG3 A;  1QOA A;  3AE8 B;  2V3N A;  4YSX B;  1DOI A;  3ZNZ B;  4KSL C;  3PZ7 A;  2MBB B;  5AEK B;  4KDI C;  2QCZ A;  5BO4 B;  2W3S A;  3SD5 A;  4AOF A;  3LYY A;  1ZE3 D;  4A6Q A;  4OVV A;  4IM0 A;  4JIO U;  1E5W A;  4E71 A;  3DQV A;  1L0Y B;  5I4D A;  1C78 A;  2J0K A;  4KKI A;  4OVZ A;  4RCO A;  1L2N A;  4ASW C;  2BF8 B;  2JXX A;  1V2Y A;  1K8R B;  1QOG A;  4BKS D;  3MHZ A;  2O2V B;  4REZ A;  2JU6 X;  3HHM A;  2LI5 A;  1CMX B;  3A33 B;  2D11 A;  2DNF A;  3ZQ4 A;  3GS2 A;  2DYO A;  3TL5 A;  2DWQ A;  3OJ4 B;  3PRP B;  4C80 A;  4NNJ B;  1YIW A;  2GI9 A;  1UEL A;  2IPK D;  5EE0 A;  3BVM A;  3U30 A;  1N6Z A;  3ZVV A;  1YMH E;  2KFJ A;  4KIK A;  1XCQ L;  4GOC A;  2V3S A;  1UBQ A;  3QAR A;  3DBL B;  4WH4 A;  1KLG D;  2MW5 A;  1QT9 A;  2KNB A;  3W1S A;  1XEE A;  4W9L A;  1OGW A;  4OZC A;  3L0W B;  2HD5 B;  5D6J B;  4CHK A;  3AEC B;  1JAL A;  4NQL B;  1D3Z A;  2EEL A;  2OJW A;  4L23 A;  3CMM B;  3ONS A;  4PT5 A;  1E10 A;  1PGB A;  3AEE B;  2A5U A;  4L2Y A;  1E7P B;  4LNK A;  2FAZ A;  2DZK A;  1AYF A;  5FK9 C;  4FXC A;  3JVZ X;  3U7Z A;  1XCT L;  4FLH A;  3V6E B;  5CHF A;  1U4A A;  3AEA B;  4OZA A;  2J7Q B;  1E9M A;  4ZYN A;  1XQQ A;  2C7M B;  4G50 A;  3Q8B A;  3W2D A;  1MG4 A;  1I4P A;  2LRU A;  2K0P A;  3Q69 A;  4KGS A;  2KK8 A;  3H7P A;  3KWL A;  1SGH A;  3APF A;  2MJE A;  1P0R A;  1TZO A;  3ZDM C;  1UGM A;  2PMV A;  4G0N B;  1K51 A;  1ZKH A;  2BS3 B;  2REX A;  2KD0 A;  2CS4 A;  1WGY A;  4MEL A;  2NBV B;  4PS7 A;  2NVU I;  4W9G A;  3X0W A;  2JZP A;  3SFE B;  3WAL A;  5DCN A;  2D2Q A;  2WU2 B;  2IGH A;  4HPP A;  3I57 A;  2BB5 A;  1I4G A;  2C60 A;  3I9V 1;  4D2K A;  1JWM D;  3L17 A;  3HVZ A;  4GDK B;  2TSS A;  4TKN A;  1FCL A;  4MSQ B;  2QMT A;  3C8Y A;  2YLM A;  1JRO A;  3QCA A;  1Q1O A;  3ML9 A;  3QHT A;  1LM8 B;  3UIN B;  2XEW A;  1AWD A;  3R7Q A;  2M56 B;  2K3U A;  2ONQ A;  5G55 A;  2NTS A;  3DCG A;  3W9C B;  1H4R A;  4HWI B;  4EZL A;  1HE8 A;  1L6U A;  2JX5 A;  2KVZ A;  4RMA A;  4FN2 A;  5FKA C;  4H2A A;  4A8X C;  4M0W B;  3ZYY X;  4XWW A;  1ROE A;  2CHW A;  4IC7 B;  3GE3 C;  2ASQ A;  4JQW C;  4JLC A;  1JQ4 A;  3FAH A;  2MP2 A;  1KLU D;  3ETR A;  3TBL D;  1QF6 A;  3KWV A;  3AN1 A;  5CHW A;  2IY1 B;  1YQ3 B;  4ANX A;  3IHP C;  1KLV A;  3DVG Y;  2LFI A;  4DXF A;  1HQR D;  3NZU A;  2KTF A;  3ZJU A;  3GZN B;  2MEK A;  3K9P B;  3LDZ E;  3DVN V;  3V05 A;  5L95 C;  5EE9 A;  3UF8 A;  4ITK A;  3ZUN A;  1ESF A;  4X57 B;  2FCN A;  2K9X A;  1VJK A;  2QDF A;  4A20 A;  1QZE A;  2HTH A;  1WXM A;  2CKH B;  4UDU C;  4RM8 A;  4KKJ A;  1Q5W B;  3N30 A;  3RZW C;  4ANU A;  5AZH A;  2WXM A;  1SIF A;  3PRZ A;  2XN9 C;  1KF6 B;  3FKY A;  3OAW A;  3MJ5 A;  2X8X X;  3ZIM A;  2MJ3 A;  4A9A A;  2H88 B;  2O2V A;  2VZK D;  2N7J A;  3L10 B;  1IP9 A;  4BAX A;  3MTN B;  2V4I B;  2K6Q A;  1XLO A;  4L1B A;  2D3A A;  3R7R A;  3ZNG C;  2L52 A;  1QOF A;  4AJW A;  1XD3 B;  2KN4 A;  3DBR B;  4W9I A;  1TY0 A;  2JWZ A;  4AP4 C;  1H8C A;  1UWM A;  2XBB C;  4HKZ E;  3T8M A;  3H9D A;  1PUT A;  2BKF A;  4WWO A;  3DWG C;  1I4X A;  1WX7 A;  1ZOY B;  4DBG A;  1P3Q U;  1NI2 A;  2WXJ A;  2V1Y A;  2LEK A;  5D94 A;  1VCB A;  3GE8 C;  4FHJ A;  2AWT A;  3NS8 A;  3OLM D;  1VR9 A;  5LLI A;  5TR5 A;  2PIA A;  2M8S A;  1M4V A;  3VQI A;  2KAC A;  2M19 A;  2HDE A;  1FNW A;  3CST A;  3QAQ A;  4FJY A;  5LXH A;  2JY6 A;  1VZ7 A;  3APD A;  4EFO A;  1GB1 A;  2L00 B;  4OHJ A;  1V97 A;  1J8C A;  3DVN U;  2FCS A;  4JPS A;  2C7N B;  4GN1 A;  3VRA B;  1PGA A;  4HDQ A;  3O13 A;  3O65 B;  3Q8E A;  3IT6 B;  5HG2 A;  2UYZ B;  1WXQ A;  3FIL B;  1C79 A;  4BOS C;  2KAN A;  2RDB C;  1V1O A;  4BVU C;  2INN E;  3RD2 A;  3RT3 B;  2FUG 1;  1QIL A;  2K1F A;  2O6V B;  2Y5C A;  2MJD A;  1EU4 A;  2DLB A;  5IP4 D;  4HKQ A;  2KYW A;  3AE9 B;  5T8I A;  2MCN B;  2LWP A;  3TSS A;  1AW7 A;  3T3O A;  1GUA B;  3WAP A;  3TEY A;  3KLS X;  2KWU B;  3ZJV A;  4YTP B;  3Q3M C;  2L1A A;  2RD0 A;  1GNU A;  1WM2 A;  1A70 A;  2CHZ A;  4IKG A;  2K8C A;  1CZP A;  2ZPY A;  2DHZ A;  2Z59 B;  3H8H A;  4BBN C;  4EE2 A;  4YTN B;  4ZRP A;  1FO4 A;  2IDY A;  4A3O A;  3RPF C;  2IND C;  4J6I A;  1R4M B;  2KWD A;  3UGB B;  1MHH E;  1P9D U;  1TS3 A;  1E8Z A;  1YNT E;  2HJ1 A;  3P4S B;  1XF5 L;  3BYY B;  1K50 A;  3H6N A;  1N60 A;  2JWU A;  3KUD B;  4C56 C;  2ZCC A;  2JQR B;  4GDK A;  1WJ6 A;  5LNK 1;  3VFK A;  2MQJ A;  1TYG B;  2RSU A;  4MAC A;  2EMS A;  1ACC A;  1FFV A;  4XDC A;  4F8C B;  1OQQ A;  4W9C A;  1KOT A;  2RDH A;  2ZPN A;  4N59 A;  4DWF A;  1OFF A;  2OJR A;  1AN8 A;  3IBE A;  2AQ3 B;  3PO0 A;  3ZTC A;  3R2T A;  5JH5 C;  4EUT A;  1WRD B;  3BVZ A;  4M0W A;  1NYQ A;  1JWU D;  4JE3 B;  2FID A;  4WWM A;  1SE4 A;  3MC0 B;  2BBC A;  2INC C;  4DDI D;  1I42 A;  4LK0 M;  3BII D;  1D6E C;  4FUL A;  4XX5 A;  1WI0 A;  2V9H A;  1E8Y A;  2HTM E;  1EWC A;  3DBR I;  2QSD A;  4M8M A;  1V5T A;  3ZKJ C;  1DOX A;  3BY4 B;  2KDB A;  1TZ1 A;  3P42 A;  4YXD B;  1J7A A;  1ZDV A;  4PYU A;  2J0M A;  2PLP A;  2KKC A;  3V61 A;  3NY5 A;  4CYE A;  4F7Z A;  2AX5 A;  2BS2 B;  3DPD A;  2J42 A;  3EFC A;  2ZCB A;  4URK A;  5BMG A;  4YWG G;  1FMA D;  2FNJ B;  3CSF A;  1ENF A;  2GBJ A;  2ZW1 A;  2RMM A;  1WJU A;  4W9F A;  2C7H A;  4MDK E;  3U4E G;  4MGK E;  3VH3 B;  4WJO A;  1V81 A;  2CU1 A;  1HTQ A;  4WJQ A;  4MM3 B;  2DEN B;  1YN4 A;  2L83 A;  1ZPS A;  3NHE B;  1NI3 A;  2J4X A;  1TGZ B;  3UIO B;  4RNA A;  4O1N A;  1EO6 A;  4HPL B;  3ZRF A;  1WM3 A;  4YTM B;  3SEB A;  1GAQ B;  2JXT A;  5IAA C;  1WJ4 A;  1GOZ A;  3AH7 A;  4N6E B;  4HCN B;  2QEJ C;  3NZ3 A;  2JF5 A;  3W5U B;  2J53 A;  1SSN A;  3URY A;  1GC7 A;  1P98 A;  4MH8 A;  2M0X A;  2N1V A;  1ET6 A;  4FJV B;  1WF9 A;  1SJE D;  1WX8 A;  1X1M A;  1GB4 A;  1R4M I;  4OW0 A;  4HRS A;  1FXA A;  1UNS A;  1A5R A;  1KH0 A;  4GLS C;  1TIF A;  3JYU A;  2V3P A;  3T9L A;  1YJJ A;  3BVG A;  3RNG C;  4EKU A;  1L6V A;  3FIL A;  3PS6 A;  1KJT A;  2DBY A;  4DHJ B;  4NY0 A;  1C77 A;  1TT5 B;  2O6V A;  2HE7 A;  4C4V B;  2N9L A;  2O6V D;  1XLQ A;  2JSV X;  1F1H A;  1E90 A;  2GLS A;  2LAS A;  3RNC C;  5AZF A;  1FM0 D;  4K81 A;  2KX0 A;  2WLB A;  3ECI A;  2K8H A;  1NEK B;  1SJH D;  5MPO A;  1WY8 A;  1JML A;  5EDS A;  2IO3 B;  4LNF A;  4IWP A;  2D10 A;  1RWS A;  4EEW A;  4QAY A;  1RLF A;  1SIJ A;  3P63 A;  3AE5 B;  3AXC A;  1YX5 B;  1WXA A;  2KC2 A;  1D5X C;  2QHO A;  1Q0W B;  2QIL A;  1MFW A;  2LHE A;  1RYJ A;  2KFK B;  4R3D A;  2L8J A;  1RM6 C;  4II3 B;  1N5X A;  4N9F 4;  3NVW A;  4K7W A;  4ZHP A;  1SBB B;  4E74 A;  2Z8L A;  5J2R A;  4XC2 A;  3RNE C;  2W3R A;  4HCP B;  4TQ1 A;  2XK5 B;  4FA6 A;  4ZRK A;  3VTW A;  2RPV A;  2JUO A;  1KTK A;  2CJO A;  2KXJ A;  4FJZ A;  2K22 A;  3Q3J A;  2W54 A;  1WGK A;  2Z0E B;  1GC6 A;  1IPG A;  2IO2 B;  3TUO A;  3AE4 B;  1T0S C;  2NBW B;  3WA0 A;  1VDV A;  2JRH A;  4WIP A;  2KMM A;  3VUY A;  2JYE A;  5E6P A;  5KHQ A;  1UF0 A;  3NUH B;  3SHQ A;  4LDT D;  3PGE A;  4IW0 A;  3Q2A C;  3DOW A;  3ALB A;  5E6N A;  2I1K A;  3RN9 C;  4ARC A;  1WGR A;  2YVC A;  2WXL A;  3QX1 A;  4M02 A;  4XZ4 A;  2ZZP B;  5AZG A;  1L4D B;  3AE6 B;  2KDM A;  1BML C;  1IGC A;  1BUI C;  2ZJD A;  2QIE B;  2KTR B;  1SXT A;  1TS2 A;  1AAR A;  5BMH A;  3VAW A;  1C4P A;  3B08 A;  3CIR B;  5TSS A;  5EE3 A;  2Y3A A;  3CWI A;  1C76 A;  4LTU A;  4GDL B;  2WXF A;  2CR5 A;  1TS4 A;  2LGD A;  1FCC C;  2N0S B;  4NJC A;  1WJN A;  5BMI A;  3DHI C;  2L0F A;  4ZOH C;  3ZLZ A;  1P7F A;  3V60 A;  4GU2 A;  2WP9 B;  1ZUD 2;  4J3O D;  1QKZ A;  4AS1 A;  1SB3 C;  3ZJT A;  2PPH A;  2WXR A;  3R66 C;  3ZRC A;  3B2F A;  3H7S A;  3DBL I;  1MPE A;  4MM3 A;  1UD7 A;  3TEX A;  2KX3 A;  1N63 A;  5HI1 A;  2NS5 A;  4F1S A;  2D3B A;  5CHV C;  1K52 A;  4BKG A;  4OVU A;  5IA7 A;  3ZO5 B;  1WGH A;  2L0T A;  1LO5 D;  3BIN A;  2RPQ A;  1V5O A;  2PVO D;  3ZW3 A;  1FXI A;  1RFK A;  2DYM A;  2MBH A;  2ZW0 A;  4NZL B;  4DQO C;  1E7U A;  3WAM A;  1YQ4 B;  2AQ1 B;  2GMI C;  2WS3 B;  3AM9 A;  1WSP A;  3B9J A;  2VRR B;  2FCM A;  3MFG A;  5D3D A;  1EWY C;  2D3G A;  2DZJ A;  4ANW A;  3ZNH B;  3IXS A;  2KMC A;  1ZW7 A;  3V62 A;  3KVF B;  1IYF A;  2X38 A;  2NMQ A;  3I63 C;  1I7H A;  3BK2 A;  1XLP A;  2RDG A;  2K5P A;  3PVL A;  2PW9 A;  4WUR A;  4DXA B;  3M3J A;  3IT4 B;  3W1S C;  3Q3F A;  4EOY A;  3N1X C;  4MSM B;  2KDF B;  2KQS A;  3RUL A;  2WXN A;  4C4V A;  1IBX B;  4WWN A;  4IUM B;  5D2M B;  4M8N A;  2K25 A;  3R2I A;  5AUK A;  4P1C C;  4LCD E;  4EZK A;  2RGF A;  3N1Z C;  4BFR A;  4RGN A;  1DYQ A;  5KHO A;  3A4S C;  2WXI A;  3EA6 A;  1SEB D;  4DXG A;  1DOY A;  3N20 C;  2EMT A;  2G9H D;  2CU3 A;  4LJO B;  1Y56 A;  1V86 A;  4DHZ E;  3PZ8 A;  3UQB A;  3PRE A;  2W55 A;  4II2 B;  3VUX A;  3KYC D;  1JWA D;  1T0R C;  3L08 A;  1EF5 A;  3UIP B;  4RGM A;  4I6L B;  2OED A;  1V1P B;  3QK0 A;  3EFU A;  3GP7 A;  2BB6 A;  2MH7 A;  3DDC B;  1OEY A;  2JPH A;  2KFK A;  5HKH A;  2YEP F;  2Q5W D;  2I1J A;  1JCK B;  4ANV A;  4P1B C;  5G2N A;  3P4Q B;  3VTU A;  3N32 A;  3PRM B;  3U2S C;  2V4L A;  1C4A A;  1B9R A;  4AUQ C;  3VHT C;  4HK2 A;  3KQ4 A;  4A90 A;  4ZHO A;  1RRB A;  3VR8 B;  2XK5 A;  5E6O A;  4JL9 A;  3QJZ A;  3TEZ A;  2D5G A;  2N9X A;  2L05 A;  2BYV E;  3LB8 C;  4LNI A;  2LGY A;  4DHZ B;  2BTE A;  3B0A A;  2DX5 B;  3NS1 A;  3GZN I;  3C0R B;  2WX0 A;  2KT7 A;  3KYD D;  4GMV A;  1GPX A;  4HPM B;  5HHD G;  2PKO A;  1FFU A;  4WAA A;  3RNA C;  2M1M A;  4C00 A;  1J0G A;  3IAM 1;  2LGS A;  5C1Z A;  4MGZ E;  4YT0 B;  2WU5 B;  1UUP A;  1HZ6 A;  3QWZ B;  3Q8A A;  3KUZ A;  1STE A;  4BKT A;  1EF1 A;  4USA A;  3SU8 X;  2R2O A;  1WX9 A;  2WXQ A;  5JZE B;  1OEY J;  4XGA B;  3EC8 A;  3AE3 B;  1F0Z A;  3Q14 C;  1FNU A;  1V9J A;  1LXD A;  3Q6B A;  1NVI D;  4ZRI A;  2N9P C;  4P7I A;  2IO0 B;  4AQ7 A;  2WDT B;  2KTR A;  1SE3 A;  1YN5 A;  2LHD A;  2VH2 A;  3P4P B;  3UI3 A;  2KMA A;  3HRD D;  5JXV A;  4KGR A;  3OG5 A;  5EE1 A;  2RR9 A;  3DHH C;  2DAJ A;  2N1W A;  4B0M A;  1OQR A;  1SE2 A;  2IJ0 A;  2WQY B;  4B9K A;  2KQ7 A;  4ICV A;  3SR6 A;  2FCQ A;  4GDL A;  4BBN F;  1RAX A;  1TKY A;  2LVO A;  5E6J A;  3IAS 1;  1WGD A;  2I2Y A;  5JHB A;  2MBO A;  3C19 A;  3OWE B;  2IZV B;  3JSV B;  2HJ8 A;  4GB9 A;  1ZDX A;  2NPT A;  2FE8 A;  2BKR B;  2CHX A;  3BYT B;  1HZ5 A;  4K1R B;  1PDX A;  1TS5 A;  4PYZ A;  1WE7 A;  1XLN A;  3PLU A;  4JWU C;  3WAN A;  3RUI B;  1NEN B;  4HJG E;  3N3K B;  2KWV B;  1SE9 A;  1N5W A;  1E0Z A;  2G1E A;  2ZNV B;  1PGX A;  2AEH A;  3PSE B;  3RI7 C;  3TEW A;  1E7V A;  4MT5 A;  1NBF C;  1R7S A;  2EKI A;  1EUV B;  3U8Z A;  4IM2 A;  4WJN A;  1P7E A;  3VTV A;  4JWS C;  2KJH B;  4GXB A;  2J0J A;  2K6D B;  1J7C A;  1TBE A;  2GBM A;  3TIX A;  3AEG B;  2E6X A;  3NRZ A;  4I6N B;  5GMV A;  1L0V B;  2KDI A;  3AEB B;  2R61 A;  1P1A A;  3B2G A;  2WDR B;  4RF0 A;  1CJE A;  2E3T A;  2WHI A;  4K3C A;  1T5X D;  3MC8 A;  1MG8 A;  1C1Y B;  4RM9 A;  4ZRJ A;  3KW5 B;  2JT4 B;  1VZ6 A;  3IFW B;  4WWP A;  1G6J A;  5DPS A;  3I5J C;  5BYS A;  3ZGZ A;  4KZ0 A;  4WJP A;  2WYQ A;  1LGR A;  1F2R I;  1KM7 A;  1Z5S B;  2BW2 A;  1IBX A;  2D07 B;  3A9K B;  3RYT A;  2MA9 B;  1WGG A;  4S0R A;  1UZX B;  1YQB A;  1L7Y A;  4KX6 B;  2WDV B;  4AJY B;  3R8B A;  4S17 A;  4HXD A;  5IN7 A;  4BKS A;  2VZK B;  3AU5 A;  2N7D A;  3K9O B;  4K7U A;  1YN3 A;  1J7B A;  3M63 B;  2KLC A;  2IO1 B;  3VR9 B;  3ZXV A;  2L32 A;  3VRB B;  4FAD A;  3PLV A;  1WRI A;  4Q2J A;  1FIQ A;  1FD6 A;  3TJP A;  5IKC M;  5H92 C;  1OQY A;  1LQB A;  2MLB A;  1NYR A;  2KVR A;  4MGY E;  2JRI B;  5C2T B;  1V1P A;  1PFD A;  2IY0 B;  3P1M A;  2PJH A;  4RFB A;  3HK0 A;  5G5H A;  3D32 A;  3RNB C;  3DBH B;  2CJN A;  3R3M A;  4BOZ B;  2IGG A;  4MEM A;  4B6W A;  3GOE A;  4XWT A;  2OOB B;  1JWB D;  2PVG C;  4CQN A;  2J52 A;  2LJ5 A;  2Z0D B;  3TMP B;  2BYE A;  4TQ0 A;  2DZI A;  3U7D A;  2LZ6 A;  5CTR C;  4JGH B;  1MVK A;  3PTF C;  4ZYS A;  4IM3 A;  4M00 A;  3AUL A;  4HVB A;  2JZZ A;  2WXP A;  3AI5 A;  3DVG X;  2BT6 A;  1WZ0 A;  1M94 A;  4NPN A;  4ACF A;  2BS4 B;  2M17 A;  3WCQ A;  5D3I B;  4N58 A;  2GBR A;  1VRA B;  2GBK A;  5J18 A;  3BK1 A;  3ZXR A;  1Y8R C;  2A4Z A;  1TTN A;  1WR1 A;  3ZNI D;  2QJL A;  4TSS A;  3RMK C;  1R4N B;  5BYR A;  2G3Q B;  3ZDT A;  1SF0 A;  4KDL B;  2XNA C;  2LVQ A;  3NG0 A;  3UQA A;  2MRP A;  3HIZ A;  3GB1 A;  2KJR A;  4P16 A;  2KOX A;  1F52 A;  2R2Q A;  1F77 A;  3DBS A;  4CO7 A;  1TKE A;  3LJ3 A;  3JW0 X;  3P4R B;  5LXI B;  1HEZ E;  4K7S A;  2NCN A;  2SEB D;  2V0G A;  4NAW B;  2JZ3 B;  4YSZ B;  4LNN A;  4TV3 A;  3RFZ B;  2G4S A;  2GB1 A;  3AE1 B;  4HEA 1;  1JRP A;  2D3C A;  1YX6 B;  1I4R A;  3LXF A;  1V49 A;  4XYC A;  3A9J B;  2LUM A;  2QC8 A;  1F9J A;  2Y5P A;  1I4Q A;  3W1Y A;  4ZDV A;  4IWO A;  1HA5 A;  2NR2 A;  2L3Z A;  3JSV A;  5C23 A;  3X23 A;  1XXG A;  4C7Z A;  4W9D A;  3S2A A;  4E3C A;  2KLG A;  5J17 A;  1N62 A;  1IGD A;  1C4C A;  2W9N A;  3W5V B;  1L5P A;  3V3X A;  5H8Y E;  2BGF A;  3QIJ A;  3Q8C A;  1I4H A;  1WR6 E;  4K3B A;  3PHX B;  1WZ3 A;  4GSW A;  1MHX A;  4GGQ A;  2GOW A;  5DPT A;  4MJS B;  2WXK A;  5C3J B;  3AE7 B;  1MI0 A;  2IYD B;  5IOI A;  3QC8 B;  2N9K A;  3NVV A;  3APC A;  3RNF C;  4LNO A;  3TCA A;  2FIF A;  1IUE A;  2LMC A;  2NPT B;  4YL8 A;  3SDL C;  1WMH B;  2BWE S;  4NJ7 A;  3QQ8 B;  3A1Q B;  4W9E A;  2W82 A;  3H1U A;  3Q3O C;  2KAJ A;  3Q3N C;  3V6C B;  1KFY B;  1BT0 A;  4G11 A;  5CX3 A;  2MBE A;  1LFD A;  4XDD A;  1T6B X;  2KN5 A;  4PS3 A;  1VZ8 A;  3ENE A;  2AL6 A;  3DBH I;  4IOI E;  1ZGU B;  3AU4 A;  1FXT B;  5HFY A;  1VD2 A;  5DPR A;  3WAO A;  3DHG C;  2UWQ A;  2LD9 A;  4IG7 B;  3HM6 X;  3A9K A;  3EGR A;  5G5G A;  4I6P A;  2M0A A;  2N7E A;  1UWX A;  2DZM A;  1GJZ A;  4HLE A;  3EUB 2;  3HVD A;  4MH0 E;  3PZD A;  1EM7 A;  4WQM A;  2LXA A;  2BQQ A;  2MHJ A;  2K8B A;  4DDG D;  3B1L X;  3KUC B;  2IGD A;  5FR6 A;  2FBW B;  1FRR A;  1NDD A;  3RZF A;  2LRW A;  2ON8 A;  3L4P A;  3NJT A;  3T3N A;  1R4N I;  1UGJ A;  4ICU A;  4HJK A;  2KHW B;  2PE9 A;  1QQR A;  3M95 A;  5GXG B;  4DHJ D;  2WXO A;  3OJ3 A;  2I38 A;  1RFA A;  3SFD B;  1MJD A;  4KVG B;  2AQ2 B;  1QLB B;  2WWZ A;  1J19 A;  3L13 A;  2LVP A;  4LJP B;  4IDI A;  1D4B A;  3EHV A;  3E9S A;  1HXY D;  1FPY A;  5IO9 A;  4KGT A;  5D7G A;  2NBU A;  3L54 A;  2BYF A;  2LJI A;  1F2R C;  1YJ1 A;  2M4N A;  4PK1 A;  2MX2 A;  2IBI B;  1Q10 A;  2BVC A;  4RGO S;  2MWS B;  3VUW A;  1TY2 A;  3BWU D;  2YEP B;  4IWQ A;  2JYT A;  4W9K A;  4HDO A;  3ML8 A;  4DK5 A;  2FUH B;  2GBN A;  2ZVN A;  3VDZ A;  1HTO A;  3EEC A;  4KIK B;  3NVY A;  2PEA A;  1KRH A;  2PTL A;  2WXH A;  5BYQ A;  4WAF A;  1PYW D;  2KJ6 A;  2N9E B;  2MSE D;  3WIM A;  2WDQ B;  1JW9 D;  3PHW B;  1FEH A;  1V8C A;  3I3T B;  4US9 A;  3RCZ A;  1GG3 A;  4M01 A;  3MJW A;  1JWS D;  1VLB A;  2KDE B;  4ARI A;  2N4F A;  1WXS A;  3N9Y C;  4C7Y A;  3AV8 A;  3AE2 B;  1BXT A;  1S3S G;  4EZJ A;  4US8 A;  1ISN A;  4B0E A;  1T3Q A;  2B76 B;  2C5L C;  1FRD A;  2ZVO A;  3PPA A;  2KZR A;  2LXC A;  1DGJ A;  2L76 A;  2K39 A;  4NAW A;  2ACZ B;  1UBI A;  4HRO A;  1CK1 A;  3AEF B;  2BYT A;  1WFY A;  2AYO B;  1S1Q B;  1YJI A;  1XO3 A;  2DYB A;  5DPW A;  3AED B;  4PS8 A;  1I35 A;  4NAM A;  3A9J A;  2Y5B B;  3BZD B;  1ZXI A;  4RGT A;  1E8X A;  2WX1 A;  2UU7 A;  4ZRQ A;  1N61 A;  3H7P B;  4P6V F;  2BPS A;  2DAF A;  3MHS D;  1E6E B;  2KC1 A;  2BWF A;  2ZEQ A;  2VH1 A;  4A3P A;  4B95 A;  3ZTD A;  2INP E;  4LLG M;  4XE0 A;  1T0Q C;  1CQV A;  3L16 A;  3ABV B;  1ZP0 B;  2G45 B;  1T0Y A;  3VVW B;  3VXW A;  1WH3 A;  3MC9 A;  2LGI A;  1D5Z C; 
#chains in the Genus database with same CATH homology
 4KSK C;  2N7D A;  1WIA A;  3K9O B;  3QX1 A;  4K7U A;  4MJS A;  4XZ4 A;  5D94 A;  1VCB A;  4FHJ A;  2AWT A;  3M63 B;  2KLC A;  2IO1 B;  4DBG A;  3NS8 A;  3OLM D;  2ZNV C;  5LLI A;  5TR5 A;  4FAD A;  2ZZP B;  2M8S A;  5AZG A;  3PLV A;  3VQI A;  4WQO B;  3TJP A;  1JRU A;  1OQY A;  4GIV A;  1LQB A;  2MLB A;  2ZJD A;  3NZS A;  3CST A;  2KVR A;  2KTR B;  4MGY E;  3QA8 A;  2JRI B;  1WMH A;  3QAQ A;  4FJY A;  5LXH A;  2JY6 A;  3APD A;  1AAR A;  3NOB A;  2IY0 B;  4EFO A;  3VAW A;  2L00 B;  2PJH A;  4LDT B;  3KH0 A;  3A1Q A;  1J8C A;  3DVN U;  2FCS A;  4NQK E;  3HK0 A;  1YD8 U;  2LUE A;  3B08 A;  1V80 A;  3D32 A;  2C7N B;  4GN1 A;  4HDQ A;  4NJ6 A;  3R3M A;  3O65 B;  4GDL B;  4BOZ B;  3IVF A;  4MGI E;  2CR5 A;  2PE6 B;  5JHA A;  4MEM A;  2UYZ B;  4B6W A;  2LGD A;  3GOE A;  4AWJ A;  1WJN A;  4BOS C;  1C3T A;  2L0F A;  2L7R A;  2OOB B;  2KAN A;  3ZLZ A;  4BVU C;  2AL3 A;  4W9J A;  2LJ5 A;  3A4R A;  2Z0D B;  3TMP B;  3V60 A;  4KZC A;  4GU2 A;  3VH4 B;  2BYE A;  4TQ0 A;  2DZI A;  3U7D A;  2LZ6 A;  1V6E A;  3HM3 A;  3RD2 A;  3RT3 B;  5CTR C;  4TUU A;  1PQS A;  4JGH B;  3PTF C;  4IM3 A;  2K1F A;  2O6V B;  2PPH A;  2EKE C;  3AUL A;  4HVB A;  3R66 C;  1WE6 A;  3ZRC A;  2JZZ A;  2KWC A;  1OTR B;  3AI5 A;  1XT9 B;  4FHK A;  1Z2M A;  3DVG X;  3H7S A;  3DBL I;  2MCN B;  2LWP A;  4MM3 A;  1UD7 A;  1WZ0 A;  1E8W A;  1M94 A;  4NPN A;  4G3X B;  2MP2 B;  5L83 A;  1WYW B;  2KX3 A;  1GUA B;  3WAP A;  2M17 A;  2NS5 A;  3CF6 E;  4KV2 A;  2KWU B;  3PV1 A;  4F1S A;  3P2B A;  2RD0 A;  2KO3 A;  5CHV C;  1GNU A;  2G4D B;  2GBR A;  1WM2 A;  2GBK A;  5J18 A;  2C9W B;  4BKG A;  4OVU A;  1Y8R C;  2CHZ A;  5IA7 A;  2A4Z A;  1TTN A;  1WR1 A;  2YVC A;  2K8C A;  1WXV A;  3ZO5 B;  1WGH A;  2L0T A;  2ZPY A;  4W9H A;  3ZNI D;  3BIN A;  2DHZ A;  2RPQ A;  2Z59 B;  4BBN C;  1V5O A;  3ZW3 A;  2DYM A;  2MBH A;  3M62 B;  2B3A A;  3PT2 B;  1E7U A;  2G3Q B;  4A3O A;  3ZDT A;  2JVC A;  3WAM A;  2MBQ A;  1UH6 A;  2LGX A;  3IG3 A;  2LVQ A;  4KDL B;  3UQA A;  4J6I A;  2GMI C;  3UGB B;  1P9D U;  2MRP A;  3HIZ A;  1E8Z A;  4KSL C;  3ZNZ B;  2KJR A;  2VRR B;  2MBB B;  2KOX A;  5AEK B;  2FCM A;  2R2Q A;  4KDI C;  3H6N A;  5BO4 B;  3KUD B;  3SD5 A;  4AOF A;  3DBS A;  2ZCC A;  4CO7 A;  3LJ3 A;  3JW0 X;  4GDK A;  1WJ6 A;  2D3G A;  2DZJ A;  5LXI B;  4K7S A;  4ANW A;  4OVV A;  3ZNH B;  2NCN A;  4IM0 A;  4JIO U;  1E5W A;  3VFK A;  4E71 A;  2MQJ A;  3DQV A;  2KMC A;  2RSU A;  4NAW B;  2JZ3 B;  1ZW7 A;  3V62 A;  3KVF B;  1IYF A;  2EMS A;  4TV3 A;  2G4S A;  2J0K A;  1L2N A;  4ASW C;  2BF8 B;  2JXX A;  4F8C B;  1V2Y A;  1K8R B;  4W9C A;  1KOT A;  3PVL A;  2ZPN A;  1YX6 B;  4DWF A;  4BKS D;  1V49 A;  3A9J B;  1F9J A;  2OJR A;  2O2V B;  4DXA B;  3W1Y A;  4ZDV A;  3HHM A;  3M3J A;  2LI5 A;  3IBE A;  3W1S C;  1CMX B;  3Q3F A;  4EOY A;  3ZTC A;  3A33 B;  2D11 A;  4IWO A;  4MSM B;  2KDF B;  1WRD B;  2NR2 A;  2KQS A;  4EUT A;  2L3Z A;  5JH5 C;  3JSV A;  5C23 A;  3RUL A;  3X23 A;  2DYO A;  2FID A;  3TL5 A;  4WWN A;  4IUM B;  4W9D A;  5D2M B;  4M8N A;  3OJ4 B;  2K25 A;  3PRP B;  3S2A A;  4NNJ B;  1YIW A;  4LCD E;  4E3C A;  1UEL A;  4DDI D;  1I42 A;  2KLG A;  5J17 A;  4EZK A;  2RGF A;  2W9N A;  4FUL A;  4XX5 A;  3U30 A;  4BFR A;  2BGF A;  3QIJ A;  1WI0 A;  4KIK A;  2KFJ A;  3ZVV A;  5KHO A;  1WR6 E;  3PHX B;  3A4S C;  1WZ3 A;  4GOC A;  2V3S A;  1UBQ A;  4GSW A;  1E8Y A;  3QAR A;  4GGQ A;  2EMT A;  2GOW A;  2MW5 A;  3DBR I;  5DPT A;  4MJS B;  2KNB A;  3W1S A;  4M8M A;  4LJO B;  4W9L A;  1OGW A;  1V5T A;  3ZKJ C;  1V86 A;  3L0W B;  3BY4 B;  4DHZ E;  2HD5 B;  5D6J B;  2KDB A;  3UQB A;  1TZ1 A;  4CHK A;  3PRE A;  2IYD B;  3QC8 B;  3APC A;  4II2 B;  4NQL B;  1D3Z A;  3TCA A;  3VUX A;  2FIF A;  3KYC D;  3L08 A;  2NPT B;  3CMM B;  3ONS A;  4YL8 A;  3SDL C;  1WMH B;  1EF5 A;  2BWE S;  3UIP B;  4I6L B;  3QK0 A;  4PYU A;  3EFU A;  2J0M A;  4NJ7 A;  2A5U A;  3QQ8 B;  2KKC A;  3V61 A;  3A1Q B;  3DDC B;  1OEY A;  2FAZ A;  3NY5 A;  4W9E A;  2JPH A;  2DZK A;  3H1U A;  4CYE A;  4F7Z A;  2KFK A;  5HKH A;  3DPD A;  2I1J A;  3JVZ X;  4ANV A;  5G2N A;  4FLH A;  3V6E B;  2ZCB A;  3VTU A;  3N32 A;  5CHF A;  4URK A;  3V6C B;  3PRM B;  1U4A A;  1BT0 A;  2FNJ B;  3CSF A;  2V4L A;  4G11 A;  2GBJ A;  4AUQ C;  2J7Q B;  5CX3 A;  2MBE A;  1LFD A;  4HK2 A;  3VHT C;  2KN5 A;  4PS3 A;  1RRB A;  3ENE A;  4FBJ B;  1WJU A;  4W9F A;  2C7H A;  2XK5 A;  4ZYN A;  4MDK E;  2AL6 A;  4MGK E;  3DBH I;  5E6O A;  4JL9 A;  1ZGU B;  3QJZ A;  3VH3 B;  4WJO A;  1XQQ A;  1FXT B;  2N9X A;  3AU4 A;  2L05 A;  2C7M B;  4G50 A;  1VD2 A;  1V81 A;  2CU1 A;  5DPR A;  3WAO A;  2BYV E;  2LRU A;  4WJQ A;  2KK8 A;  3H7P A;  2DEN B;  1SGH A;  3APF A;  2LGY A;  2UWQ A;  3NHE B;  2LD9 A;  4DHZ B;  1P0R A;  3B0A A;  2DX5 B;  4IG7 B;  1TGZ B;  3HM6 X;  3GZN I;  3UIO B;  3C0R B;  3ZDM C;  2WX0 A;  3KYD D;  1UGM A;  3A9K A;  1EO6 A;  4GMV A;  4HPM B;  4HPL B;  4G0N B;  3ZRF A;  1WM3 A;  4I6P A;  4WAA A;  2N7E A;  1ZKH A;  5IAA C;  1WJ4 A;  2M1M A;  2REX A;  2DZM A;  1J0G A;  1GJZ A;  5C1Z A;  2KD0 A;  4MGZ E;  4HLE A;  4HCN B;  2CS4 A;  4MH0 E;  1WGY A;  3QWZ B;  4MEL A;  3KUZ A;  2NBV B;  4BKT A;  3PZD A;  2NVU I;  2JF5 A;  4PS7 A;  4W9G A;  2LXA A;  3X0W A;  1EF1 A;  3SU8 X;  2R2O A;  2K8B A;  4DDG D;  1WX9 A;  3WAL A;  5JZE B;  5DCN A;  2D2Q A;  3B1L X;  3KUC B;  1OEY J;  1GC7 A;  1P98 A;  5FR6 A;  3EC8 A;  2M0X A;  2N1V A;  1NDD A;  2C60 A;  2LRW A;  3RZF A;  1V9J A;  1LXD A;  4FJV B;  1R4N I;  1WF9 A;  4ICU A;  3L17 A;  2KHW B;  4HJK A;  2PE9 A;  4ZRI A;  2N9P C;  4P7I A;  2IO0 B;  4GDK B;  2WDT B;  1WX8 A;  3M95 A;  4TKN A;  2KTR A;  1X1M A;  4DHJ D;  1R4M I;  2KMA A;  3OJ3 A;  4MSQ B;  1A5R A;  2YLM A;  2RR9 A;  3QCA A;  1Q1O A;  3ML9 A;  2DAJ A;  1LM8 B;  1RFA A;  2N1W A;  3JYU A;  3QHT A;  3UIN B;  4KVG B;  3T9L A;  2WWZ A;  2XEW A;  2KQ7 A;  4ICV A;  4B9K A;  1J19 A;  3L13 A;  2FCQ A;  4GDL A;  3R7Q A;  4BBN F;  1RAX A;  2LVP A;  4LJP B;  4EKU A;  5G55 A;  3EHV A;  2LVO A;  3DCG A;  1H4R A;  4HWI B;  1WGD A;  4EZL A;  1HE8 A;  5JHB A;  2MBO A;  5D7G A;  2NBU A;  3PS6 A;  3L54 A;  2BYF A;  2IZV B;  1YJ1 A;  3JSV B;  2M4N A;  2HJ8 A;  1KJT A;  4GB9 A;  4RMA A;  4FN2 A;  2NPT A;  2MX2 A;  4DHJ B;  4M0W B;  2BKR B;  2CHX A;  4NY0 A;  2IBI B;  2CHW A;  2O6V A;  4IC7 B;  2HE7 A;  4K1R B;  2O6V D;  4PYZ A;  1E90 A;  2ASQ A;  2MWS B;  4JQW C;  1WE7 A;  3VUW A;  3PLU A;  4JLC A;  2LAS A;  4IWQ A;  4W9K A;  3WAN A;  4HDO A;  2MP2 A;  5AZF A;  3ML8 A;  3RUI B;  3TBL D;  4DK5 A;  2FUH B;  2GBN A;  2ZVN A;  3VDZ A;  3EEC A;  4K81 A;  4KIK B;  2PEA A;  5CHW A;  3N3K B;  2KWV B;  1SE9 A;  2KJ6 A;  2KX0 A;  2IY1 B;  2N9E B;  2MSE D;  3ECI A;  3IHP C;  3DVG Y;  3WIM A;  2K8H A;  4ANX A;  1KLV A;  3PHW B;  1WY8 A;  3NZU A;  5EDS A;  2KTF A;  2IO3 B;  3I3T B;  2ZNV B;  2AEH A;  3RCZ A;  1GG3 A;  3PSE B;  3K9P B;  3MJW A;  3LDZ E;  3DVN V;  4IWP A;  5L95 C;  2D10 A;  1E7V A;  1NBF C;  3UF8 A;  3U8Z A;  1EUV B;  2KDE B;  4EEW A;  4IM2 A;  1RLF A;  4WJN A;  3ZUN A;  4X57 B;  2FCN A;  2N4F A;  1WXS A;  4A20 A;  3VTV A;  2KJH B;  3AXC A;  1YX5 B;  4GXB A;  1WXA A;  1S3S G;  2KC2 A;  4EZJ A;  1ISN A;  2QHO A;  1Q0W B;  1QZE A;  2HTH A;  2J0J A;  2K6D B;  1WXM A;  2CKH B;  2C5L C;  2KFK B;  2ZVO A;  4RM8 A;  1TBE A;  3PPA A;  2KZR A;  1Q5W B;  3N30 A;  2L8J A;  2GBM A;  3TIX A;  4II3 B;  3RZW C;  4ANU A;  2LXC A;  4N9F 4;  5AZH A;  2L76 A;  4K7W A;  4I6N B;  2K39 A;  4NAW A;  4E74 A;  1UBI A;  1SIF A;  5GMV A;  2KDI A;  5J2R A;  1P1A A;  4XC2 A;  3PRZ A;  1WFY A;  4HCP B;  2AYO B;  4TQ1 A;  1S1Q B;  3OAW A;  2XK5 B;  4ZRJ A;  4RM9 A;  1MG8 A;  1C1Y B;  2DYB A;  3KW5 B;  5DPW A;  2JT4 B;  3ZIM A;  4FA6 A;  3IFW B;  4WWP A;  1G6J A;  4PS8 A;  1I35 A;  4ZRK A;  3A9J A;  5DPS A;  3VTW A;  2Y5B B;  2O2V A;  4KZ0 A;  3L10 B;  1E8X A;  1IP9 A;  2WX1 A;  2JUO A;  3MTN B;  3H7P B;  4WJP A;  2KXJ A;  2K6Q A;  2BPS A;  2DAF A;  2WYQ A;  3MHS D;  4FJZ A;  3Q3J A;  2Z0E B;  2KC1 A;  3R7R A;  1GC6 A;  3ZNG C;  2BWF A;  1KM7 A;  1Z5S B;  4AJW A;  1XD3 B;  1IPG A;  2IO2 B;  2D07 B;  3A9K B;  4W9I A;  2ZEQ A;  3RYT A;  4A3P A;  4B95 A;  2JWZ A;  4AP4 C;  2MA9 B;  1H8C A;  2NBW B;  3WA0 A;  1WGG A;  3ZTD A;  2JRH A;  3VUY A;  1UZX B;  2XBB C;  1YQB A;  1L7Y A;  5E6P A;  3L16 A;  5KHQ A;  4AJY B;  3T8M A;  3H9D A;  4HXD A;  3SHQ A;  4LDT D;  3PGE A;  4IW0 A;  4BKS A;  2BKF A;  2G45 B;  3DOW A;  4WWO A;  1T0Y A;  3VVW B;  3VXW A;  1WH3 A;  3ALB A;  5E6N A;  1WX7 A;  3AU5 A;  1P3Q U;  1NI2 A;  1WGR A;  2I1K A;  2V1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...