2ZVNA

Nemo cozi domain incomplex with diubiquitin in p212121 space group
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords UBC protein
total genus 32
structure length 148
sequence length 148
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvnA01
2KDBA 4MELA 5L83A 2M17A 4DK5A 4HDQA 3B1LX 2MA9B 2M4NA 3L16A 2G4DB 2LWPA 2MSED 3S2AA 3L10B 2KX0A 1WR6E 2K25A 3L08A 4NQLB 3ZNZB 2DHZA 5LLIA 4EOYA 4KDIC 3IBEA 1V81A 1UBIA 3JYUA 1WY8A 3I3TB 4ZDVA 5JZEB 1ZGUB 4IM3A 4HDOA 3RULA 3TMPB 2CHXA 3UF8A 3PT2B 3DBRI 1UBQA 1WGHA 3NHEB 4JLCA 4JL9A 2K1FA 2N4FA 2LRWA 2GOWA 3ONSA 1LM8B 3OAWA 4MEMA 1V5TA 2AEHA 3HHMA 2N7DA 4HLEA 1H8CA 2KDIA 2IO1B 4EZKA 1L2NA 5IAAC 2LVOA 2FNJB 4KDLB 1GC7A 4W9LA 2DZJA 3C0RB 4F1SA 1UH6A 4RM9A 1FXTB 2BKFA 3RUIB 4BBNF 1NI2A 4IWQA 3M95A 3UGBB 3VH3B 4GOCA 2MBOA 2V1YA 3KYCD 2KJ6A 5CHFA 3CSFA 4TV3A 1GG3A 1Z5SB 1KOTA 1E7VA 3PHXB 4ZYNA 1CMXB 4HCNB 2MRPA 4TUUA 1WXVA 2FCNA 3V6CB 2IZVB 4MGYE 2C5LC 3H6NA 2JT4B 4DHZB 5JH5C 2RGFA 4FBJB 5G2NA 1OGWA 3GZNI 3VVWB 1C1YB 2CS4A 5J17A 4ICVA 5C1ZA 5AZHA 3WAOA 1EF1A 2KXJA 4W9GA 4BKGA 4XZ4A 4OVUA 1KJTA 3NZSA 2BWFA 3VUWA 4II2B 3KH0A 2FCMA 2LGXA 2JRHA 2PJHA 5LXHA 4ZRJA 2DAJA 1V80A 1OQYA 2FUHB 4KIKA 2KC2A 3CMMB 2LVQA 3MJWA 2FIDA 2WX0A 4BOZB 2ASQA 2IY1B 2JY6A 1WX9A 3BY4B 2KQSA 3A9JB 3NZUA 4IUMB 4AWJA 1IP9A 3H7PB 3AI5A 4FJVB 1RAXA 4GIVA 3QJZA 4WJPA 2K8BA 3VH4B 3R66C 2HE7A 1GJZA 1OTRB 4MSMB 3TJPA 3PTFC 3ZNHB 4AOFA 1U4AA 4BKSD 1UZXB 1WFYA 4WJOA 2KTFA 2DZKA 5D7GA 1WH3A 3APDA 3GOEA 5DPRA 2BPSA 4LDTB 3WALA 1XQQA 3PSEB 4W9JA 3PS6A 3A4RA 3ZDMC 1Q1OA 2YVCA 3DQVA 4XC2A 3RZFA 1Y8RC 1RLFA 3CSTA 2W9NA 4CHKA 2AL6A 2LD9A 2ZZPB 1E8YA 2L76A 3SDLC 4KZCA 2RPQA 4DXAB 1EF5A 1WE7A 4RM8A 3ZW3A 1YQBA 2L0TA 3EC8A 4HCPB 1NDDA 4GDLB 4JQWC 3UIOB 1E8WA 3WA0A 1E8XA 3OJ4B 2D07B 2XBBC 3RCZA 2Z0EB 5BO4B 1K8RB 3KUCB 1WMHB 4FA6A 3A9KB 2CHWA 1WGYA 3KVFB 1J19A 2MCNB 3ALBA 2KOXA 4LCDE 4X57B 3DBHI 3HIZA 4A3PA 4MJSA 1Z2MA 3CF6E 1YIWA 2DX5B 4NJ7A 1WMHA 4AJYB 3JSVA 2LXAA 3SU8X 1WM3A 1WM2A 2GBKA 3T9LA 3UQBA 3QIJA 3QA8A 3UQAA 2A5UA 2KQ7A 2M0XA 1WJ4A 2CR5A 3PHWB 4EFOA 2DZMA 2PE9A 2DENB 1S3SG 4FLHA 2K8CA 3VTWA 4ANUA 1PQSA 1WXSA 1R4MI 2AL3A 1V5OA 2LRUA 2OJRA 2RR9A 3M62B 1E7UA 2IO2B 2KJRA 4KV2A 1J8CA 4W9KA 3L17A 2ZVNA 4EZLA 2JUOA 3PLUA 5DPTA 5JHAA 2I1KA 1WR1A 2C9WB 2KZRA 1I42A 2KVRA 4I6PA 4GXBA 3ECIA 4NY0A 4B6WA 2K39A 4HPLB 4WJNA 5FR6A 1UGMA 3A4SC 4HK2A 4CYEA 4ICUA 5KHQA 3DPDA 3H9DA 3NY5A 4NAWA 1WJNA 4GMVA 1E8ZA 2C7HA 2DAFA 4ZRKA 4FULA 2O6VB 2FIFA 3JVZX 3M3JA 4MSQB 4MGZE 3B08A 3VQIA 4NNJB 2J0JA 3KUDB 1P0RA 1WRDB 1XT9B 2OOBB 2NCNA 2K6QA 1KLVA 2PE6B 4JGHB 2KD0A 2G45B 2KLGA 2ZEQA 4GSWA 2MP2A 4FN2A 4DDID 4CO7A 1C3TA 3JSVB 3PVLA 2NBVB 2LVPA 3HK0A 3K9PB 3L54A 3PGEA 3OLMD 4PS7A 4NQKE 3IHPC 1H4RA 2IY0B 2KWCA 2EKEC 3Q3JA 4A3OA 2RSUA 4WJQA 2NVUI 4EUTA 1UD7A 2N9XA 2N1VA 2V3SA 2GMIC 1TTNA 4MDKE 2NPTA 3X0WA 2LXCA 4LJPB 5D6JB 3ML8A 2O2VB 2G4SA 4W9CA 2MX2A 1WIAA 2DYBA 4KVGB 4DHJB 2WWZA 3VTVA 3MHSD 3DBLI 3VUYA 3DVGY 3NOBA 4IWOA 2L0FA 3V61A 2MW5A 2L00B 2IYDB 2HJ8A 3W1SC 1TBEA 2CU1A 1VD2A 3KW5B 5TR5A 3RZWC 5CHWA 4IG7B 3WAMA 5AZFA 4G0NB 1P3QU 4I6NB 2KHWB 2UWQA 4KSLC 4WWOA 2J7QB 3R3MA 5CTRC 2KX3A 2LI5A 2BYFA 3RYTA 2ZNVB 2HD5B 3U30A 3PREA 1AARA 1JRUA 1S1QB 4B9KA 3WANA 3P2BA 1WZ3A 1TGZB 2NR2A 2IO3B 4FHKA 3L0WB 4FADA 2K8HA 5L95C 1SIFA 4E74A 2WYQA 2EMTA 3ZRFA 4F8CB 2JZ3B 2MP2B 2J0KA 4II3B 3U8ZA 2EMSA 2D10A 2XK5B 2MBHA 3A33B 3QHTA 4WWNA 2RD0A 1R4NI 3DVGX 1Q5WB 2JF5A 4ZRIA 2D11A 2O6VA 1WYWB 3R7RA 2LZ6A 2L7RA 2KFKA 2GBNA 2BYEA 1HE8A 2Z59B 1LQBA 5JHBA 4IM0A 3D32A 1SE9A 2M1MA 3KUZA 4MH0E 3QX1A 3TBLD 2LJ5A 2MQJA 3DBSA 3QARA 2ZNVC 3NS8A 4URKA 4KZ0A 1TZ1A 1YX5B 1M94A 3HM3A 3N32A 3PRZA 3SHQA 4K1RB 2A4ZA 4LDTD 3ZNGC 2WDTB 4WAAA 4F7ZA 3LDZE 4EEWA 2MBQA 3ZNID 2KKCA 4GB9A 4WQOB 2KTRB 1WJ6A 3PPAA 2DYMA 2XEWA 3B0AA 2KMCA 2PEAA 3VFKA 3ZO5B 2JWZA 3VUXA 2JPHA 1E90A 3TIXA 5DCNA 1L7YA 1ISNA 1A5RA 1EUVB 2AYOB 3IFWB 1LXDA 1IYFA 3KYDD 2FCQA 3W1YA 4K7UA 2NPTB 4AJWA 2KNBA 3APCA 2IO0B 4MGIE 4HJKA 2KO3A 1P1AA 2FAZA 5C23A 1XD3B 2V4LA 3LJ3A 3Q3FA 4GDKA 1V9JA 2PPHA 4P7IA 4PYZA 3ML9A 3WAPA 5HKHA 4I6LB 1Q0WB 3VAWA 1VCBA 2C7MB 2CKHB 2JXXA 4PYUA 3VTUA 2KK8A 2KWVB 5CHVC 4MGKE 3U7DA 1QZEA 2HTHA 4FJYA 2MBEA 3EECA 5KHOA 2N9PC 3TL5A 4FJZA 3DVNU 2KDEB 3QCAA 4ANWA 2KMAA 4NJ6A 4W9HA 5EDSA 3RT3B 4ASWC 4M0WB 4A20A 2N1WA 2KN5A 4G11A 4BVUC 4JIOU 3ENEA 4W9DA 3SD5A 3HM6X 3ZDTA 1YX6B 3AXCA 4MM3A 1V86A 3N3KB 2NS5A 3VHTC 2C7NB 1J0GA 3V6EB 4HVBA 3VDZA 4G3XB 1WI0A 4LJOB 5D94A 2JZZA 4W9IA 2BWES 3W1SA 2KANA 4AUQC 2AWTA 2BYVE 3PRPB 2K6DB 4E71A 3V60A 4DBGA 1WGGA 2KDFB 3MTNB 4K7SA 2IBIB 3RD2A 3H7PA 2ZPNA 1YJ1A 1ZW7A 3A9JA 4IC7B 3ZKJC 4BBNC 3IVFA 4BOSC 4K7WA 3V62A 5AEKB 2MWSB 4YL8A 4B95A 1V2YA 3QAQA 3EHVA 4XX5A 2ZVOA 4W9EA 3M63B 2KFKB 2VRRB 2J0MA 4IM2A 2G3QB 1GNUA 4KIKB 3ZUNA 4TKNA 3X23A 2GBMA 1NBFC 1WXMA 3H1UA 5GMVA 3BINA 4DWFA 2GBJA 3ZTDA 1SGHA 1WJUA 3QQ8B 5AZGA 4DDGD 3QC8B 3AU5A 3OJ3A 2ZJDA 4TQ1A 2R2OA 2M8SA 4E3CA 5E6OA 2GBRA 2L8JA 4MJSB 3A1QB 4NAWB 1OEYA 2XK5A 5E6PA 1P9DU 2LGDA 2LUEA 4OVVA 4BKTA 4EKUA 3A9KA 3O65B 4ANVA 3DOWA 2D3GA 4IW0A 4RMAA 3ZTCA 2MBBB 1V6EA 1WXAA 3ZVVA 2Z0DB 2N9EB 3K9OB 4M8MA 3PRMB 4GDLA 4ANXA 4DHJD 1WGDA 3DDCB 5CX3A 1RRBA 2BF8B 2UYZB 3AU4A 3DCGA 4HWIB 5IA7A 4GN1A 4J6IA 1UELA 1RFAA 5J2RA 2L05A 4FHJA 5J18A 3UINB 2YLMA 3ZRCA 2N7EA 4TQ0A 1BT0A 2B3AA 2KWUB 2FCSA 1GC6A 3T8MA 2DZIA 2D2QA 4N9F4 2C60A 1LFDA 2REXA 4GU2A 5LXIB 2LGYA 2KLCA 2LASA 2QHOA 1GUAB 1WGRA 4M8NA 3UIPB 4BFRA 4EZJA 2Y5BB 3VXWA 4G50A 3PV1A 4HPMB 4BKSA 2O2VA 3AULA 2L3ZA 1E5WA 4GGQA 3PZDA 3QK0A 3TCAA 4AP4C 2R2QA 3A1QA 4GDKB 2ZCBA 3IG3A 1KM7A 1WX7A 2BGFA 2MLBA 2O6VD 3L13A 4NPNA 1IPGA 1MG8A 1D3ZA 3N30A 2JRIB 2KC1A 2NBUA 1F9JA 2WX1A 3PLVA 3QWZB 1ZKHA 4HXDA 2CHZA 5G55A 3EFUA 1EO6A 4PS8A 1WZ0A 1G6JA 2KJHB 2ZPYA 1P98A 2ZCCA 4PS3A 2I1JA 3DVNV 4K81A 2KFJA 1WX8A 1I35A 1V49A 5D2MB 3ZLZA 2KTRA 3ZIMA 4W9FA 3APFA 5DPWA 4KSKC 3R7QA 1T0YA 1OEYJ 1X1MA 1YD8U 3JW0X 1WE6A 2NBWB 3WIMA 2DYOA 4IWPA 5DPSA 3H7SA 5E6NA 2JVCA 2BKRB 4WWPA 4DHZE 1WF9A
chains in the Genus database with same CATH superfamily
1I7HA 2RDBC 2KDBA 4MELA 3L16A 1L6UA 2Y5CA 3S2AA 3Q8EA 4ZRPA 3NVVA 3ZXVA 4ZRQA 2L32A 2LJIA 1VZ6A 2JYEA 2PTLA 3AE2B 3HVZA 3NVZA 2AQ2B 5JZEB 3RULA 3DBRI 3NHEB 2PKOA 4JLCA 1OFFA 3P4RB 4C00A 4MEMA 1H8CA 2AEHA 1HTOA 3GE3C 4HLEA 1L2NA 2FNJB 2DZJA 4YWGG 3RUIB 4IWQA 3UGBB 3VH3B 1P7FA 1TZOA 1R4NB 5CHFA 4TV3A 1GG3A 1SJHD 1Z5SB 3MHZA 1HTQA 1CMXB 4HCNB 2MRPA 2FCNA 5BMGA 2WS3B 3Q3NC 1QQRA 2HTME 4DHZB 1FFVA 4FBJB 1OGWA 3GZNI 4BZAA 4OHJA 5AZHA 3L4PA 1KLUD 1YN4A 3PZ8A 3ABVB 2JRHA 2FUHB 2LVQA 3AECB 4L1BA 4BOZB 1D5MC 4B0EA 2IY1B 3BY4B 3RI7C 1RAXA 2QMTA 3HRDD 1XLPA 3IT4B 1J7CA 2HE7A 1UNSA 1GJZA 3TJPA 3N9YC 1U4AA 4BKSD 3Q8FA 5D7GA 3APDA 1LGRA 2BPSA 4LDTB 5D3IB 3I63C 3A4RA 1SE3A 3ZDMC 1Q1OA 3KWVA 4XC2A 1PUTA 1RLFA 1N61A 2W9NA 4CHKA 2IGDA 2AL6A 3SDLC 2BB6A 4HCPB 1NDDA 3WA0A 3T3NA 2D07B 3RCZA 4P1BC 3KUCB 5AUKA 1ZE3D 1E0ZA 3A9KB 3KVFB 1WGYA 1Z2MA 2WP9B 3CF6E 1WMHA 3JSVA 1WGKA 4ZOHC 1WM2A 3UQBA 2A5UA 4RGMA 2CR5A 1S3SG 5IO9A 4LTUA 1V8CA 3OWEB 1IBXB 2OJRA 1MHHE 3U4EG 2M0AA 1FNUA 4EZLA 3P4PB 3PLUA 5JHAA 4BAXA 2I1KA 1WR1A 2KZRA 1I42A 4I6PA 1WYGA 2V3NA 4B6WA 1VRAB 4CYEA 1TKYA 1FEHA 2PMVA 1E8ZA 3RNAC 3JVZX 3M3JA 5BYQA 4MGZE 2WXQA 4NNJB 1P0RA 2NCNA 2LUMA 2PE6B 2KLGA 5AUIA 4FN2A 4DDID 2NBVB 3K9PB 3HK0A 3PGEA 3P1MA 4PS7A 2N9KA 5EE9A 1K53A 1H4RA 2IY0B 2PIAA 4US8A 4EUTA 4MH8A 1IGCA 1T0SC 2LXCA 5D6JB 1C4PA 4W9CA 3BZDB 3V61A 2MW5A 2CU1A 1ZDXA 2J53A 3RZWC 2UWQA 1MI0A 2CU3A 2J7QB 2GB1A 2KX3A 2BYFA 1M4VA 1FMAD 1S1QB 2JSVX 3N1ZC 4F8CB 2EMTA 1YMHE 2J0KA 2JZPA 4OZAA 2JF5A 2LZ6A 2GBNA 2Z59B 1F2RI 3T3OA 1PGAA 4IM0A 4MH0E 3QX1A 2LJ5A 3CIRB 3FILB 1F52A 4URKA 3BVMA 1FNWA 2E3TA 3PRZA 3BK2A 1N5WA 4P6VF 3SHQA 2A4ZA 2DLBA 4F7ZA 2KKCA 4XWTA 2KTRB 1WJ6A 1VR9A 2DYMA 3VFKA 3B0AA 1WXQA 3VUXA 3TIXA 1ZOYB 1L7YA 2ZW1A 4MM3B 1FRRA 2KYWA 3AEEB 2K0PA 1KH0A 1CQVA 3APCA 3FC4A 4HJKA 4WWMA 1P1AA 2V4LA 3WAPA 1V9JA 2PPHA 2IJ0A 5CHVC 1XLNA 1QZEA 1SXTA 2LGIA 1ZXIA 2N9PC 4ANWA 2I38A 1L6VA 4NJ6A 4AQ7A 4M0WB 1FIQA 2N1WA 2OEDA 4JIOU 2K5PA 1I4HA 3AEFB 1V86A 1JRPA 3V6EB 2OJWA 5FKAC 3V60A 4D2KA 4DBGA 1XXGA 3MTNB 1L4ZB 2IBIB 2WXHA 1ZW7A 3A9JA 4BOSC 3ZKJC 3ZJTA 1D5ZC 2ONQA 2Y3AA 4XX5A 2J4XA 1JALA 2KFKB 2G3QB 3X23A 3GZNB 1TS4A 3HUIA 1DOXA 1SGHA 1KFYB 1JROA 4DDGD 2ZJDA 4TQ1A 4HKZE 2R2OA 4YTMB 2L8JA 3A1QB 4NAWB 1OEYA 1PDXA 1SE4A 4BKTA 3A9KA 4S0RA 4ANVA 4RMAA 3ZVVA 4M8MA 3K9OB 4GDLA 3AEBB 2UYZB 1V97A 4GN1A 5J2RA 1T0QC 5J18A 1CK1A 1GC6A 3T8MA 4N9F4 1QILA 2C60A 4GU2A 2KLCA 1IUEA 5EE1A 4M8NA 3FAHA 4EZJA 2Y5BB 2YEPB 4G50A 4BKSA 2O2VA 3QK0A 5BMIA 3VR9B 2AQ3B 1MG8A 3PLVA 2WXMA 4HXDA 3MC8A 3O13A 3RNCC 4A9AA 2KJHB 4PS3A 3DVNV 3ZIMA 1E10A 4J3OD 4KSKC 1OEYJ 3C8YA 4YSYB 3JW0X 2DYOA 4YSXB 1MG4A 2BKRB 4WWPA 1AYFA 1C79A 5L83A 4HDQA 2N0SB 1UUPA 2LWPA 2MSED 1RFKA 5C2TB 3VR8B 3LB8C 2V3PA 4NQLB 3ZNZB 4EOYA 1RWSA 4NZLB 1MHXA 3IBEA 1UBIA 1ZXHA 3I57A 1ZGUB 4WURA 2QDFA 2W3RA 3PT2B 4JL9A 4KKJA 3ONSA 5GXGB 3OAWA 2W54A 1C4CA 1V5TA 4HPPA 2KDIA 1HZ6A 4EZKA 5IAAC 2LVOA 3C0RB 4PT5A 4CQNA 4RM9A 4BBNF 1DYQA 4GOCA 2DWQA 1PGXA 3PHXB 4ZYNA 4K3BA 4TUUA 3V6CB 4C7YA 2C5LC 3H6NA 4MACA 1BXTA 1DOYA 2RGFA 3U7ZA 1C1YB 5C1ZA 1TT5B 3AE6B 2KDMA 2X38A 1EF1A 3WAOA 2KXJA 3ZXRA 3BWUD 4XZ4A 4OVUA 1KJTA 2FCMA 3DWGC 3Q69A 4LNFA 2DAJA 2MJ3A 1ROEA 1YQ3B 1YNTE 2MHJA 2JY6A 4IUMB 2JX5A 3NZUA 1IP9A 3AI5A 4FJVB 4GIVA 3QJZA 2K8BA 2W55A 3VH4B 3AE7B 3PTFC 2INDC 3ZNHB 4AOFA 1WFYA 3R2TA 1WWTA 4M02A 5DPRA 2BW2A 3WALA 3WCQA 5BYSA 3CSTA 1J7BA 2LD9A 2ZZPB 2L76A 4KZCA 2RPQA 1EF5A 4RM8A 2LHDA 1YQBA 2CJOA 2L0TA 3EC8A 3U52E 1E8WA 1E8XA 3OJ4B 1F77A 3ALBA 1HQRD 4LCDE 4MJSA 2J52A 3RNBC 1WM3A 2GBKA 3T9LA 2MH7A 1QOGA 2M0XA 4EFOA 2DZMA 2PE9A 2TSSA 1F2RC 1WXSA 4ZYSA 1J8CA 1E7UA 4KV2A 2JUOA 1ACCA 2NMQA 2K39A 4HPLB 2INPE 1TS2A 2VH2A 1D6EC 4NAWA 2JWUA 1EU4A 3NY5A 3Q6BA 1WJNA 2C7HA 2O6VB 1HXYD 4MSQB 3B08A 1KLVA 2CJNA 2G45B 3Q14C 3JSVB 3PVLA 3Q8CA 3AE5B 1E9MA 3W9CB 2BS2B 3IHPC 2KWCA 3Q3MC 2LFIA 2N9XA 1TTNA 4MDKE 2VH1A 2PW9A 4RNAA 2G4SA 2MX2A 2DYBA 4DHJB 2WWZA 1YQ4B 5C3JB 3DBLI 3LYYA 2IYDB 3N20C 1UGJA 1VD2A 5TR5A 1FO4A 5AZFA 4G0NB 4ACFA 1P3QU 4I6NB 4R3DA 2VZKD 2LI5A 4DXFA 1EWCA 2ZNVB 2D3AA 1JRUA 2EELA 3P2BA 3PZ7A 1TGZB 2NR2A 1HEZE 3L0WB 4FADA 1I4RA 5L95C 3N1XC 3ZRFA 2HDEA 1L4DB 4II3B 2BS4B 1QF6A 3U8ZA 1C4AA 3A33B 2MBHA 3QHTA 4WWNA 1R4NI 1TYGB 3NZ3A 1D5XC 2L7RA 4KX6B 1SIJA 2KFKA 1HE8A 3DBLB 2RPVA 5JHBA 3MC9A 1SE9A 2M1MA 4N6EB 3DBSA 2N9LA 2ZNVC 3AM9A 1YX5B 4O1NA 1XF5L 2UU7A 4K1RB 3UI3A 1BUIC 2IGGA 2WXGA 5FK9C 3LDZE 1YJJA 2RDGA 4A90A 3ZNID 4WQOB 3AE1B 2XEWA 4WAFA 1CZPA 1E90A 1A5RA 2N7JA 1LXDA 5T8IA 3TUOA 2ON8A 5HHDG 2NPTB 2KNBA 2KN4A 2KQ4X 2IO0B 3NUHB 2FAZA 5C23A 4PYZA 3LJ3A 3VTUA 2IPKD 4GDKA 1FD6A 4I6LB 1Q0WB 4DQOC 2C7MB 1D4BA 4MGKE 1FCCC 1NYQA 2XN9C 2MBEA 3TL5A 3AE4B 2KDEB 1QOAA 3QCAA 2KMAA 3AH7A 2W3SA 4A20A 4XDDA 2KN5A 4BVUC 4ARCA 1YX6B 4RGNA 4REZA 2FBWB 1WI0A 5D94A 4W9IA 2BWES 2AWTA 2BYVE 2WXPA 1JWBD 3TEWA 2KDFB 3IXSA 1AN8A 2MWSB 4B95A 3QAQA 3M63B 1KLGD 4TKNA 2GBMA 5GMVA 1FM0D 1T5XD 3QQ8B 2D3BA 3BVZA 2QSDA 4EE2A 1TJEA 4E3CA 4JPSA 2GBRA 1UWXA 1P9DU 4EKUA 3O65B 3DOWA 4IW0A 3PRMB 4DHJD 3DDCB 2BF8B 3AU4A 3UINB 2YLMA 1YOVB 3ZRCA 4TQ0A 1BT0A 2FCSA 1LO5D 4LNNA 2LASA 2QHOA 1CJEA 1GUAB 1PGBA 3FKYA 4BFRA 2WDVB 3VXWA 4Q2JA 2BBCA 3TCAA 4GDKB 2KAJA 3RNEC 3IG3A 1KM7A 2BQQA 3L13A 2WXIA 1FFUA 4YTPB 2K9XA 3QWZB 2CHZA 2ZW0A 1EO6A 3EGRA 1G6JA 2Y5PA 2KFJA 1WX8A 3CWIA 1I4XA 2RMMA 1KF6B 4M01A 1WE6A 2NBWB 1E6EB 3H7SA 5E6NA 2JVCA 4DK5A 2MA9B 1QLBB 1SF0A 2BVCA 2G4DB 3Q8BA 5EE0A 4AS1A 2GI9A 2KX0A 1WR6E 3L08A 5EE3A 3GE8C 4HROA 1FPYA 1XCTL 4KDIC 3RN9C 1IBXA 2VZKB 3JYUA 1WY8A 1J7AA 4HDOA 3BYYB 1GB1A 4HJGE 3IT6B 1UBQA 1WGHA 2K1FA 3NS1A 2LRWA 1NEKB 1L0XB 3ZJVA 3HHMA 4RF1A 4KGRA 4W9LA 3NRZA 2WXJA 1FXTB 2BKFA 3M95A 1TS3A 3SR6A 2V1YA 4A55A 3BIID 4ARIA 3KYCD 5H8YE 3MC0B 1KOTA 1E7VA 1WXVA 2IZVB 2MEKA 2PLPA 3NVWA 1JW9D 5H92C 5JH5C 5I4DA 3VVWB 4ICVA 4II2B 2H89B 2LGXA 5LXHA 3R2IA 1WSPA 4ZRJA 1TS5A 2WXFA 4KIKA 3NJTA 2KC2A 2FIDA 2WX0A 2ASQA 3A9JB 4OVZA 3H7PB 4WJPA 3R66C 1UZXB 1NVID 1WH3A 1STEA 3P4SB 2L83A 2WQYB 3PSEB 3PS6A 2NTTA 2YVCA 4B0MA 3RZFA 1Y8RC 3DWMA 1TY0A 4ITKA 3RFZB 1V1PA 4JE3B 1WE7A 3ZW3A 4GDLB 4JQWC 5HFYA 2XBBC 3AB5A 1ZDVA 3R8BA 1XLOA 3EUB2 3ZQ4A 1J19A 2MCNB 4X57B 3DBHI 3HIZA 4NJ7A 4AJYB 1FXAA 1JCKB 3SU8X 2LXAA 2E6XA 3QIJA 3QA8A 3UQAA 2KQ7A 1TY2A 1WJ4A 3PHWB 4ANUA 2AL3A 2RR9A 3M62B 2IO2B 4W9KA 3L17A 4H2AA 2KT7A 5DPTA 4NY0A 3TEZA 4WJNA 5FR6A 1UGMA 4N59A 5KHQA 1Q10A 2IGHA 4XE0A 3H9DA 4RGTA 4HEA1 4GMVA 4ZRKA 5G5GA 3KLSX 3VQIA 2PVOD 3KUDB 1N63A 3DBRB 1NI3A 2K6QA 2QJLA 3EFCA 4JGHB 4GSWA 2ZEQA 1FXIA 1C3TA 4WQMA 5D3DA 3L54A 4NQKE 3ZYYX 4A3OA 3Q3JA 1R4MB 2RSUA 1A70A 2KMMA 2NVUI 2V3SA 5IN7A 3X0WA 1WIAA 3VTVA 1SSNA 3VUYA 3DVGY 4IWOA 2L0FA 2L00B 2MJEA 3W1SC 2RDHA 3KW5B 5CHWA 4IG7B 3E9SA 2SAKA 2WLBA 2QIEB 1NENB 3R3MA 5CTRC 3RYTA 3AV8A 1ZUD2 3U30A 3PREA 1FNVA 3HVDA 2IO3B 1L0YB 3B2GA 4E74A 2WYQA 2GRIA 2D3CA 3KWLA 3BVGA 4US9A 1K50A 2J42A 1TKEA 1Q5WB 2D11A 3R7RA 1LQBA 3P63A 5HI1A 3D32A 3KUZA 4LNOA 1MVKA 3QARA 3NS8A 4KZ0A 3HM3A 4S17A 3W5UB 4WAAA 2WXLA 4IKGA 4GB9A 3PPAA 2PEAA 3ZO5B 1OQRA 3MJ5A 3TEXA 1JMLA 2JPHA 5DCNA 2AYOB 2Q5WD 2GLSA 2JXTA 3IAS1 1NYRA 4A6QA 5JXVA 4C80A 1C77A 1JWUD 2INCC 3AE8B 1F1HA 1HA5A 3DHGC 2KO3A 3Q3FA 4P7IA 3VAWA 2WXRA 1AW7A 3RPFC 4PYUA 3AMZA 1V1PB 4FJYA 2V0GA 5KHOA 5HG2A 2NTSA 4W9HA 2JQRB 3RT3B 4G11A 3OG5A 3AXCA 1J0GA 3N3KB 3VHTC 4HVBA 4YXDB 4LJOB 3DHHC 3W1SA 4AUQC 3PRPB 4E71A 1ET9A 2FUG1 1WGGA 4K7SA 3RD2A 3H7PA 2ZPNA 1YJ1A 4IC7B 3V62A 5AEKB 1F0ZA 4YL8A 1V2YA 2ZVOA 2VRRB 2J0MA 4KIKB 4LK0M 3ZUNA 1QOFA 1NBFC 2ACZB 1WXMA 3H1UA 3AEAB 1WJUA 5AZGA 2M19A 3AU5A 3OJ3A 2M8SA 4RF0A 2XK5A 2LUEA 4OVVA 1L0VB 2D3GA 1V1OA 3ZTCA 2MBBB 3EA6A 3B9JA 1RRBA 5IA7A 4HWIB 3IAM1 2LMCA 4J6IA 2L05A 4FHJA 2R61A 2B3AA 1ENFA 4ZHOA 2HJ1A 1JWSD 1LFDA 5LXIB 4M0WA 4IOIE 2LGYA 1WGRA 4USAA 3UIPB 3J9CA 3AEGB 1UWMA 1XCQL 2XNAC 3PV1A 1E5WA 4QAYA 3PZDA 2QC8A 3A1QA 1QOBA 1L5PA 2ZCBA 1WX7A 2BGFA 1ET6A 2MLBA 2O6VD 4NPNA 1IPGA 3RNFC 1D3ZA 1IGDA 1ZPSA 5IP4D 1SEBD 2NBUA 3MFGA 3EFUA 2ZPYA 2ZCCA 4DXGA 2I1JA 1RM6C 2LEKA 4JWUC 1V49A 3ZLZA 2KTRA 4W9FA 3APFA 1T0YA 1YD8U 2AX5A 1YN5A 4IWPA 4OZCA 1AWDA 1WF9A 1BMLC 3VRBB 2M17A 2KWDA 3B1LX 2M4NA 2WGSA 3L10B 2SEBD 2K25A 2DHZA 5LLIA 2WDQB 3P42A 1V81A 2L52A 3GB1A 3ZGZA 3I3TB 4ZDVA 1I4GA 4IM3A 3NVYA 4LNKA 3TMPB 2CHXA 3UF8A 2WU5B 4K3CA 4A8XC 3SFEB 2LHEA 2N4FA 2BYTA 2GOWA 1LM8B 2X8XX 2N7DA 1VZ7A 1N62A 2JU6X 2IO1B 4KDLB 2IDYA 1GC7A 2WXKA 4F1SA 1UH6A 1NI2A 1TIFA 4RCOA 2MBOA 1B9RA 2DNFA 4XYCA 2KJ6A 3CSFA 2INNE 3LXFA 3W2DA 4HKQA 4MGYE 3Q2AC 3TEYA 2JT4B 5G2NA 1YJIA 3V05A 2CS4A 5J17A 1WRIA 3FILA 1MPEA 1GB4A 4W9GA 4BKGA 4N58A 3NZSA 2BWFA 3VUWA 3KH0A 1Y56A 2H88B 2KVZA 2PJHA 1V80A 1OQYA 1VLBA 3CMMB 3MJWA 2G9HD 1WX9A 3GS2A 2KQSA 4XWWA 3AE9B 4AWJA 3ETRA 1T3QA 5BYRA 2WDRB 1OTRB 4MSMB 3KQ4A 4WJOA 2KTFA 2DZKA 3GOEA 3BK1A 5MPOA 1XQQA 4W9JA 3DQVA 4XGAB 1QKZA 4XDCA 1E8YA 4DXAB 2PVGC 4OW0A 4L2YA 4C4VB 1GPXA 2FE8A 1GOZA 3UIOB 2Z0EB 5BO4B 3AN1A 1K8RB 1WMHB 1JQ4A 4FA6A 2CHWA 4OZBA 1EU3A 2QEJC 2KOXA 1QT9A 4A3PA 4UDUC 2K22A 1YIWA 2DX5B 1PFDA 1JWAD 4LNIA 3AE3B 2DENB 1OQQA 4FLHA 4KGTA 2K8CA 3VTWA 3Q8AA 1PQSA 1R4MI 1V5OA 1I4PA 2LRUA 2KJRA 2ZVNA 4PK1A 2WXOA 2C9WB 1I4QA 1MJDA 4NAMA 2KVRA 2QCZA 4GXBA 3ECIA 1DGJA 1RYJA 1VZ8A 3A4SC 4HK2A 4ICUA 2YEPF 3DPDA 2DAFA 4FULA 2Z8LA 2FIFA 4YT0B 1K51A 2J0JA 4C7ZA 3BYTB 1WRDB 1XT9B 2OOBB 2BB5A 2BTEA 2KD0A 2MP2A 2W82A 4CO7A 4P1CC 2LVPA 3OLMD 1TKGA 2EKEC 4M00A 4WJQA 1UD7A 2N1VA 2GMIC 1P7EA 2QILA 3Q3OC 2NPTA 1VJKA 4LJPB 3ML8A 2O2VB 5G5HA 4KVGB 2G1EA 2AQ1B 3MHSD 3NOBA 4NJCA 2HJ8A 5E6JA 3MP9A 3WAMA 3URYA 1B1ZA 1MFWA 2KHWB 4KSLC 3H8HA 4WWOA 4RFBA 4L23A 1C78A 2HD5B 1AARA 1T0RC 4JX1C 4B9KA 3WANA 1WZ3A 4FHKA 1JWMD 2K8HA 1SIFA 1K52A 1R7SA 2JZ3B 2MP2B 4WIPA 5IOIA 1T6BX 2EMSA 2D10A 2XK5B 2RD0A 3DVGX 4ZRIA 2O6VA 1WYWB 2BYEA 3GP7A 3TBLD 3ZJUA 3E56A 2I2YA 2MQJA 4ZHPA 1XO3A 3W5VB 1XLQA 1TZ1A 1M94A 2WU2B 2V4IB 4WH4A 3N32A 4LDTD 3ZNGC 1YN3A 2WDTB 2KACA 4EEWA 2MBQA 3B2FA 2KMCA 2JWZA 2WHIA 3N1YC 1ISNA 5BMHA 1EUVB 4IDIA 3IFWB 4MT5A 1XEEA 1IYFA 3KYDD 2FCQA 4KGSA 3W1YA 2L1AA 4K7UA 4TSSA 4AJWA 2JYTA 1C9FA 4KKIA 4MGIE 1XD3B 4YTNB 5HKHA 3AEDB 3SFDB 3ML9A 3P4QB 1VCBA 2CKHB 4C56C 1UF0A 2JXXA 2KK8A 2KWVB 2LGSA 3U7DA 2HTHA 3EECA 4FJZA 3DVNU 4C4VA 5IKCM 1EM7A 1GAQB 4ASWC 4P16A 1SB3C 5EDSA 3NG0A 1FRDA 1FCLA 2WNMA 3ENEA 4W9DA 3SD5A 3HM6X 3ZDTA 4MM3A 2NS5A 2C7NB 3VDZA 4G3XB 2JZZA 2KANA 2K6DB 2BT6A 2BS3B 4BBNC 1SJED 3IVFA 4K7WA 3EHVA 4W9EA 4IM2A 1GNUA 1ESFA 1SE2A 2ICIA 3BINA 5TSSA 4DWFA 2GBJA 3ZTDA 3QC8B 1N60A 4RH6A 3C19A 5E6OA 2EKIA 4MJSB 2V9HA 5E6PA 2LGDA 3U2SC 1V6EA 3I5JC 1WXAA 2Z0DB 2N9EB 3SEBA 1SBBB 4ANXA 1WGDA 5CX3A 1N6ZA 3DCGA 1KTKA 1RFAA 1UELA 3DBHB 2N7EA 3TSSA 2KWUB 4YSZB 1E7PB 2DZIA 2D2QA 2REXA 3PO0A 3DHIC 1PYWD 1ZP0B 4HPMB 1VDVA 3VRAB 3AULA 2L3ZA 4GGQA 2M56B 4AP4C 2R2QA 4FXCA 1EWYC 2D5GA 1HZ5A 2B76B 4TMAB 5FR3A 3RMKC 3N30A 2MJDA 2JRIB 1C76A 2KC1A 3V3XA 1F9JA 2WX1A 4HRSA 1ZKHA 4GLSC 5G55A 4PS8A 1WZ0A 1P98A 2DBYA 5LNK1 2OHFA 4K81A 1I35A 5D2MB 2WXNA 1DOIA 1KRHA 2K3UA 5DPWA 3RNGC 3R7QA 4LLGM 1X1MA 1N5XA 3WIMA 4RGOS 4JWSC 3I9V1 5DPSA 1TBEA 4DHZE
chains in the Genus database with same CATH topology
2KDBA 4MELA 5L83A 2M17A 4DK5A 4HDQA 3B1LX 2MA9B 2M4NA 3L16A 2G4DB 2LWPA 2MSED 3S2AA 3L10B 2KX0A 1WR6E 2K25A 3L08A 4NQLB 3ZNZB 2DHZA 5LLIA 4EOYA 4KDIC 3IBEA 1V81A 1UBIA 3JYUA 1WY8A 3I3TB 4ZDVA 5JZEB 1ZGUB 4IM3A 4HDOA 3RULA 3TMPB 2CHXA 3UF8A 3PT2B 3DBRI 1UBQA 1WGHA 3NHEB 4JLCA 4JL9A 2K1FA 2N4FA 2LRWA 2GOWA 3ONSA 1LM8B 3OAWA 4MEMA 1V5TA 2AEHA 3HHMA 2N7DA 4HLEA 1H8CA 2KDIA 2IO1B 4EZKA 1L2NA 5IAAC 2LVOA 2FNJB 4KDLB 1GC7A 4W9LA 2DZJA 3C0RB 4F1SA 1UH6A 4RM9A 1FXTB 2BKFA 3RUIB 4BBNF 1NI2A 4IWQA 3M95A 3UGBB 3VH3B 4GOCA 2MBOA 2V1YA 3KYCD 2KJ6A 5CHFA 3CSFA 4TV3A 1GG3A 1Z5SB 1KOTA 1E7VA 3PHXB 4ZYNA 1CMXB 4HCNB 2MRPA 4TUUA 1WXVA 2FCNA 3V6CB 2IZVB 4MGYE 2C5LC 3H6NA 2JT4B 4DHZB 5JH5C 2RGFA 4FBJB 5G2NA 1OGWA 3GZNI 3VVWB 1C1YB 2CS4A 5J17A 4ICVA 5C1ZA 5AZHA 3WAOA 1EF1A 2KXJA 4W9GA 4BKGA 4XZ4A 4OVUA 1KJTA 3NZSA 2BWFA 3VUWA 4II2B 3KH0A 2FCMA 2LGXA 2JRHA 2PJHA 5LXHA 4ZRJA 2DAJA 1V80A 1OQYA 2FUHB 4KIKA 2KC2A 3CMMB 2LVQA 3MJWA 2FIDA 2WX0A 4BOZB 2ASQA 2IY1B 2JY6A 1WX9A 3BY4B 2KQSA 3A9JB 3NZUA 4IUMB 4AWJA 1IP9A 3H7PB 3AI5A 4FJVB 1RAXA 4GIVA 3QJZA 4WJPA 2K8BA 3VH4B 3R66C 2HE7A 1GJZA 1OTRB 4MSMB 3TJPA 3PTFC 3ZNHB 4AOFA 1U4AA 4BKSD 1UZXB 1WFYA 4WJOA 2KTFA 2DZKA 5D7GA 1WH3A 3APDA 3GOEA 5DPRA 2BPSA 4LDTB 3WALA 1XQQA 3PSEB 4W9JA 3PS6A 3A4RA 3ZDMC 1Q1OA 2YVCA 3DQVA 4XC2A 3RZFA 1Y8RC 1RLFA 3CSTA 2W9NA 4CHKA 2AL6A 2LD9A 2ZZPB 1E8YA 2L76A 3SDLC 4KZCA 2RPQA 4DXAB 1EF5A 1WE7A 4RM8A 3ZW3A 1YQBA 2L0TA 3EC8A 4HCPB 1NDDA 4GDLB 4JQWC 3UIOB 1E8WA 3WA0A 1E8XA 3OJ4B 2D07B 2XBBC 3RCZA 2Z0EB 5BO4B 1K8RB 3KUCB 1WMHB 4FA6A 3A9KB 2CHWA 1WGYA 3KVFB 1J19A 2MCNB 3ALBA 2KOXA 4LCDE 4X57B 3DBHI 3HIZA 4A3PA 4MJSA 1Z2MA 3CF6E 1YIWA 2DX5B 4NJ7A 1WMHA 4AJYB 3JSVA 2LXAA 3SU8X 1WM3A 1WM2A 2GBKA 3T9LA 3UQBA 3QIJA 3QA8A 3UQAA 2A5UA 2KQ7A 2M0XA 1WJ4A 2CR5A 3PHWB 4EFOA 2DZMA 2PE9A 2DENB 1S3SG 4FLHA 2K8CA 3VTWA 4ANUA 1PQSA 1WXSA 1R4MI 2AL3A 1V5OA 2LRUA 2OJRA 2RR9A 3M62B 1E7UA 2IO2B 2KJRA 4KV2A 1J8CA 4W9KA 3L17A 2ZVNA 4EZLA 2JUOA 3PLUA 5DPTA 5JHAA 2I1KA 1WR1A 2C9WB 2KZRA 1I42A 2KVRA 4I6PA 4GXBA 3ECIA 4NY0A 4B6WA 2K39A 4HPLB 4WJNA 5FR6A 1UGMA 3A4SC 4HK2A 4CYEA 4ICUA 5KHQA 3DPDA 3H9DA 3NY5A 4NAWA 1WJNA 4GMVA 1E8ZA 2C7HA 2DAFA 4ZRKA 4FULA 2O6VB 2FIFA 3JVZX 3M3JA 4MSQB 4MGZE 3B08A 3VQIA 4NNJB 2J0JA 3KUDB 1P0RA 1WRDB 1XT9B 2OOBB 2NCNA 2K6QA 1KLVA 2PE6B 4JGHB 2KD0A 2G45B 2KLGA 2ZEQA 4GSWA 2MP2A 4FN2A 4DDID 4CO7A 1C3TA 3JSVB 3PVLA 2NBVB 2LVPA 3HK0A 3K9PB 3L54A 3PGEA 3OLMD 4PS7A 4NQKE 3IHPC 1H4RA 2IY0B 2KWCA 2EKEC 3Q3JA 4A3OA 2RSUA 4WJQA 2NVUI 4EUTA 1UD7A 2N9XA 2N1VA 2V3SA 2GMIC 1TTNA 4MDKE 2NPTA 3X0WA 2LXCA 4LJPB 5D6JB 3ML8A 2O2VB 2G4SA 4W9CA 2MX2A 1WIAA 2DYBA 4KVGB 4DHJB 2WWZA 3VTVA 3MHSD 3DBLI 3VUYA 3DVGY 3NOBA 4IWOA 2L0FA 3V61A 2MW5A 2L00B 2IYDB 2HJ8A 3W1SC 1TBEA 2CU1A 1VD2A 3KW5B 5TR5A 3RZWC 5CHWA 4IG7B 3WAMA 5AZFA 4G0NB 1P3QU 4I6NB 2KHWB 2UWQA 4KSLC 4WWOA 2J7QB 3R3MA 5CTRC 2KX3A 2LI5A 2BYFA 3RYTA 2ZNVB 2HD5B 3U30A 3PREA 1AARA 1JRUA 1S1QB 4B9KA 3WANA 3P2BA 1WZ3A 1TGZB 2NR2A 2IO3B 4FHKA 3L0WB 4FADA 2K8HA 5L95C 1SIFA 4E74A 2WYQA 2EMTA 3ZRFA 4F8CB 2JZ3B 2MP2B 2J0KA 4II3B 3U8ZA 2EMSA 2D10A 2XK5B 2MBHA 3A33B 3QHTA 4WWNA 2RD0A 1R4NI 3DVGX 1Q5WB 2JF5A 4ZRIA 2D11A 2O6VA 1WYWB 3R7RA 2LZ6A 2L7RA 2KFKA 2GBNA 2BYEA 1HE8A 2Z59B 1LQBA 5JHBA 4IM0A 3D32A 1SE9A 2M1MA 3KUZA 4MH0E 3QX1A 3TBLD 2LJ5A 2MQJA 3DBSA 3QARA 2ZNVC 3NS8A 4URKA 4KZ0A 1TZ1A 1YX5B 1M94A 3HM3A 3N32A 3PRZA 3SHQA 4K1RB 2A4ZA 4LDTD 3ZNGC 2WDTB 4WAAA 4F7ZA 3LDZE 4EEWA 2MBQA 3ZNID 2KKCA 4GB9A 4WQOB 2KTRB 1WJ6A 3PPAA 2DYMA 2XEWA 3B0AA 2KMCA 2PEAA 3VFKA 3ZO5B 2JWZA 3VUXA 2JPHA 1E90A 3TIXA 5DCNA 1L7YA 1ISNA 1A5RA 1EUVB 2AYOB 3IFWB 1LXDA 1IYFA 3KYDD 2FCQA 3W1YA 4K7UA 2NPTB 4AJWA 2KNBA 3APCA 2IO0B 4MGIE 4HJKA 2KO3A 1P1AA 2FAZA 5C23A 1XD3B 2V4LA 3LJ3A 3Q3FA 4GDKA 1V9JA 2PPHA 4P7IA 4PYZA 3ML9A 3WAPA 5HKHA 4I6LB 1Q0WB 3VAWA 1VCBA 2C7MB 2CKHB 2JXXA 4PYUA 3VTUA 2KK8A 2KWVB 5CHVC 4MGKE 3U7DA 1QZEA 2HTHA 4FJYA 2MBEA 3EECA 5KHOA 2N9PC 3TL5A 4FJZA 3DVNU 2KDEB 3QCAA 4ANWA 2KMAA 4NJ6A 4W9HA 5EDSA 3RT3B 4ASWC 4M0WB 4A20A 2N1WA 2KN5A 4G11A 4BVUC 4JIOU 3ENEA 4W9DA 3SD5A 3HM6X 3ZDTA 1YX6B 3AXCA 4MM3A 1V86A 3N3KB 2NS5A 3VHTC 2C7NB 1J0GA 3V6EB 4HVBA 3VDZA 4G3XB 1WI0A 4LJOB 5D94A 2JZZA 4W9IA 2BWES 3W1SA 2KANA 4AUQC 2AWTA 2BYVE 3PRPB 2K6DB 4E71A 3V60A 4DBGA 1WGGA 2KDFB 3MTNB 4K7SA 2IBIB 3RD2A 3H7PA 2ZPNA 1YJ1A 1ZW7A 3A9JA 4IC7B 3ZKJC 4BBNC 3IVFA 4BOSC 4K7WA 3V62A 5AEKB 2MWSB 4YL8A 4B95A 1V2YA 3QAQA 3EHVA 4XX5A 2ZVOA 4W9EA 3M63B 2KFKB 2VRRB 2J0MA 4IM2A 2G3QB 1GNUA 4KIKB 3ZUNA 4TKNA 3X23A 2GBMA 1NBFC 1WXMA 3H1UA 5GMVA 3BINA 4DWFA 2GBJA 3ZTDA 1SGHA 1WJUA 3QQ8B 5AZGA 4DDGD 3QC8B 3AU5A 3OJ3A 2ZJDA 4TQ1A 2R2OA 2M8SA 4E3CA 5E6OA 2GBRA 2L8JA 4MJSB 3A1QB 4NAWB 1OEYA 2XK5A 5E6PA 1P9DU 2LGDA 2LUEA 4OVVA 4BKTA 4EKUA 3A9KA 3O65B 4ANVA 3DOWA 2D3GA 4IW0A 4RMAA 3ZTCA 2MBBB 1V6EA 1WXAA 3ZVVA 2Z0DB 2N9EB 3K9OB 4M8MA 3PRMB 4GDLA 4ANXA 4DHJD 1WGDA 3DDCB 5CX3A 1RRBA 2BF8B 2UYZB 3AU4A 3DCGA 4HWIB 5IA7A 4GN1A 4J6IA 1UELA 1RFAA 5J2RA 2L05A 4FHJA 5J18A 3UINB 2YLMA 3ZRCA 2N7EA 4TQ0A 1BT0A 2B3AA 2KWUB 2FCSA 1GC6A 3T8MA 2DZIA 2D2QA 4N9F4 2C60A 1LFDA 2REXA 4GU2A 5LXIB 2LGYA 2KLCA 2LASA 2QHOA 1GUAB 1WGRA 4M8NA 3UIPB 4BFRA 4EZJA 2Y5BB 3VXWA 4G50A 3PV1A 4HPMB 4BKSA 2O2VA 3AULA 2L3ZA 1E5WA 4GGQA 3PZDA 3QK0A 3TCAA 4AP4C 2R2QA 3A1QA 4GDKB 2ZCBA 3IG3A 1KM7A 1WX7A 2BGFA 2MLBA 2O6VD 3L13A 4NPNA 1IPGA 1MG8A 1D3ZA 3N30A 2JRIB 2KC1A 2NBUA 1F9JA 2WX1A 3PLVA 3QWZB 1ZKHA 4HXDA 2CHZA 5G55A 3EFUA 1EO6A 4PS8A 1WZ0A 1G6JA 2KJHB 2ZPYA 1P98A 2ZCCA 4PS3A 2I1JA 3DVNV 4K81A 2KFJA 1WX8A 1I35A 1V49A 5D2MB 3ZLZA 2KTRA 3ZIMA 4W9FA 3APFA 5DPWA 4KSKC 3R7QA 1T0YA 1OEYJ 1X1MA 1YD8U 3JW0X 1WE6A 2NBWB 3WIMA 2DYOA 4IWPA 5DPSA 3H7SA 5E6NA 2JVCA 2BKRB 4WWPA 4DHZE 1WF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDB A;  4MEL A;  5L83 A;  2M17 A;  4DK5 A;  4HDQ A;  3B1L X;  2MA9 B;  2M4N A;  3L16 A;  2G4D B;  2LWP A;  2MSE D;  3S2A A;  3L10 B;  2KX0 A;  1WR6 E;  2K25 A;  3L08 A;  4NQL B;  3ZNZ B;  2DHZ A;  5LLI A;  4EOY A;  4KDI C;  3IBE A;  1V81 A;  1UBI A;  3JYU A;  1WY8 A;  3I3T B;  4ZDV A;  5JZE B;  1ZGU B;  4IM3 A;  4HDO A;  3RUL A;  3TMP B;  2CHX A;  3UF8 A;  3PT2 B;  3DBR I;  1UBQ A;  1WGH A;  3NHE B;  4JLC A;  4JL9 A;  2K1F A;  2N4F A;  2LRW A;  2GOW A;  3ONS A;  1LM8 B;  3OAW A;  4MEM A;  1V5T A;  2AEH A;  3HHM A;  2N7D A;  4HLE A;  1H8C A;  2KDI A;  2IO1 B;  4EZK A;  1L2N A;  5IAA C;  2LVO A;  2FNJ B;  4KDL B;  1GC7 A;  4W9L A;  2DZJ A;  3C0R B;  4F1S A;  1UH6 A;  4RM9 A;  1FXT B;  2BKF A;  3RUI B;  4BBN F;  1NI2 A;  4IWQ A;  3M95 A;  3UGB B;  3VH3 B;  4GOC A;  2MBO A;  2V1Y A;  3KYC D;  2KJ6 A;  5CHF A;  3CSF A;  4TV3 A;  1GG3 A;  1Z5S B;  1KOT A;  1E7V A;  3PHX B;  4ZYN A;  1CMX B;  4HCN B;  2MRP A;  4TUU A;  1WXV A;  2FCN A;  3V6C B;  2IZV B;  4MGY E;  2C5L C;  3H6N A;  2JT4 B;  4DHZ B;  5JH5 C;  2RGF A;  4FBJ B;  5G2N A;  1OGW A;  3GZN I;  3VVW B;  1C1Y B;  2CS4 A;  5J17 A;  4ICV A;  5C1Z A;  5AZH A;  3WAO A;  1EF1 A;  2KXJ A;  4W9G A;  4BKG A;  4XZ4 A;  4OVU A;  1KJT A;  3NZS A;  2BWF A;  3VUW A;  4II2 B;  3KH0 A;  2FCM A;  2LGX A;  2JRH A;  2PJH A;  5LXH A;  4ZRJ A;  2DAJ A;  1V80 A;  1OQY A;  2FUH B;  4KIK A;  2KC2 A;  3CMM B;  2LVQ A;  3MJW A;  2FID A;  2WX0 A;  4BOZ B;  2ASQ A;  2IY1 B;  2JY6 A;  1WX9 A;  3BY4 B;  2KQS A;  3A9J B;  3NZU A;  4IUM B;  4AWJ A;  1IP9 A;  3H7P B;  3AI5 A;  4FJV B;  1RAX A;  4GIV A;  3QJZ A;  4WJP A;  2K8B A;  3VH4 B;  3R66 C;  2HE7 A;  1GJZ A;  1OTR B;  4MSM B;  3TJP A;  3PTF C;  3ZNH B;  4AOF A;  1U4A A;  4BKS D;  1UZX B;  1WFY A;  4WJO A;  2KTF A;  2DZK A;  5D7G A;  1WH3 A;  3APD A;  3GOE A;  5DPR A;  2BPS A;  4LDT B;  3WAL A;  1XQQ A;  3PSE B;  4W9J A;  3PS6 A;  3A4R A;  3ZDM C;  1Q1O A;  2YVC A;  3DQV A;  4XC2 A;  3RZF A;  1Y8R C;  1RLF A;  3CST A;  2W9N A;  4CHK A;  2AL6 A;  2LD9 A;  2ZZP B;  1E8Y A;  2L76 A;  3SDL C;  4KZC A;  2RPQ A;  4DXA B;  1EF5 A;  1WE7 A;  4RM8 A;  3ZW3 A;  1YQB A;  2L0T A;  3EC8 A;  4HCP B;  1NDD A;  4GDL B;  4JQW C;  3UIO B;  1E8W A;  3WA0 A;  1E8X A;  3OJ4 B;  2D07 B;  2XBB C;  3RCZ A;  2Z0E B;  5BO4 B;  1K8R B;  3KUC B;  1WMH B;  4FA6 A;  3A9K B;  2CHW A;  1WGY A;  3KVF B;  1J19 A;  2MCN B;  3ALB A;  2KOX A;  4LCD E;  4X57 B;  3DBH I;  3HIZ A;  4A3P A;  4MJS A;  1Z2M A;  3CF6 E;  1YIW A;  2DX5 B;  4NJ7 A;  1WMH A;  4AJY B;  3JSV A;  2LXA A;  3SU8 X;  1WM3 A;  1WM2 A;  2GBK A;  3T9L A;  3UQB A;  3QIJ A;  3QA8 A;  3UQA A;  2A5U A;  2KQ7 A;  2M0X A;  1WJ4 A;  2CR5 A;  3PHW B;  4EFO A;  2DZM A;  2PE9 A;  2DEN B;  1S3S G;  4FLH A;  2K8C A;  3VTW A;  4ANU A;  1PQS A;  1WXS A;  1R4M I;  2AL3 A;  1V5O A;  2LRU A;  2OJR A;  2RR9 A;  3M62 B;  1E7U A;  2IO2 B;  2KJR A;  4KV2 A;  1J8C A;  4W9K A;  3L17 A;  2ZVN A;  4EZL A;  2JUO A;  3PLU A;  5DPT A;  5JHA A;  2I1K A;  1WR1 A;  2C9W B;  2KZR A;  1I42 A;  2KVR A;  4I6P A;  4GXB A;  3ECI A;  4NY0 A;  4B6W A;  2K39 A;  4HPL B;  4WJN A;  5FR6 A;  1UGM A;  3A4S C;  4HK2 A;  4CYE A;  4ICU A;  5KHQ A;  3DPD A;  3H9D A;  3NY5 A;  4NAW A;  1WJN A;  4GMV A;  1E8Z A;  2C7H A;  2DAF A;  4ZRK A;  4FUL A;  2O6V B;  2FIF A;  3JVZ X;  3M3J A;  4MSQ B;  4MGZ E;  3B08 A;  3VQI A;  4NNJ B;  2J0J A;  3KUD B;  1P0R A;  1WRD B;  1XT9 B;  2OOB B;  2NCN A;  2K6Q A;  1KLV A;  2PE6 B;  4JGH B;  2KD0 A;  2G45 B;  2KLG A;  2ZEQ A;  4GSW A;  2MP2 A;  4FN2 A;  4DDI D;  4CO7 A;  1C3T A;  3JSV B;  3PVL A;  2NBV B;  2LVP A;  3HK0 A;  3K9P B;  3L54 A;  3PGE A;  3OLM D;  4PS7 A;  4NQK E;  3IHP C;  1H4R A;  2IY0 B;  2KWC A;  2EKE C;  3Q3J A;  4A3O A;  2RSU A;  4WJQ A;  2NVU I;  4EUT A;  1UD7 A;  2N9X A;  2N1V A;  2V3S A;  2GMI C;  1TTN A;  4MDK E;  2NPT A;  3X0W A;  2LXC A;  4LJP B;  5D6J B;  3ML8 A;  2O2V B;  2G4S A;  4W9C A;  2MX2 A;  1WIA A;  2DYB A;  4KVG B;  4DHJ B;  2WWZ A;  3VTV A;  3MHS D;  3DBL I;  3VUY A;  3DVG Y;  3NOB A;  4IWO A;  2L0F A;  3V61 A;  2MW5 A;  2L00 B;  2IYD B;  2HJ8 A;  3W1S C;  1TBE A;  2CU1 A;  1VD2 A;  3KW5 B;  5TR5 A;  3RZW C;  5CHW A;  4IG7 B;  3WAM A;  5AZF A;  4G0N B;  1P3Q U;  4I6N B;  2KHW B;  2UWQ A;  4KSL C;  4WWO A;  2J7Q B;  3R3M A;  5CTR C;  2KX3 A;  2LI5 A;  2BYF A;  3RYT A;  2ZNV B;  2HD5 B;  3U30 A;  3PRE A;  1AAR A;  1JRU A;  1S1Q B;  4B9K A;  3WAN A;  3P2B A;  1WZ3 A;  1TGZ B;  2NR2 A;  2IO3 B;  4FHK A;  3L0W B;  4FAD A;  2K8H A;  5L95 C;  1SIF A;  4E74 A;  2WYQ A;  2EMT A;  3ZRF A;  4F8C B;  2JZ3 B;  2MP2 B;  2J0K A;  4II3 B;  3U8Z A;  2EMS A;  2D10 A;  2XK5 B;  2MBH A;  3A33 B;  3QHT A;  4WWN A;  2RD0 A;  1R4N I;  3DVG X;  1Q5W B;  2JF5 A;  4ZRI A;  2D11 A;  2O6V A;  1WYW B;  3R7R A;  2LZ6 A;  2L7R A;  2KFK A;  2GBN A;  2BYE A;  1HE8 A;  2Z59 B;  1LQB A;  5JHB A;  4IM0 A;  3D32 A;  1SE9 A;  2M1M A;  3KUZ A;  4MH0 E;  3QX1 A;  3TBL D;  2LJ5 A;  2MQJ A;  3DBS A;  3QAR A;  2ZNV C;  3NS8 A;  4URK A;  4KZ0 A;  1TZ1 A;  1YX5 B;  1M94 A;  3HM3 A;  3N32 A;  3PRZ A;  3SHQ A;  4K1R B;  2A4Z A;  4LDT D;  3ZNG C;  2WDT B;  4WAA A;  4F7Z A;  3LDZ E;  4EEW A;  2MBQ A;  3ZNI D;  2KKC A;  4GB9 A;  4WQO B;  2KTR B;  1WJ6 A;  3PPA A;  2DYM A;  2XEW A;  3B0A A;  2KMC A;  2PEA A;  3VFK A;  3ZO5 B;  2JWZ A;  3VUX A;  2JPH A;  1E90 A;  3TIX A;  5DCN A;  1L7Y A;  1ISN A;  1A5R A;  1EUV B;  2AYO B;  3IFW B;  1LXD A;  1IYF A;  3KYD D;  2FCQ A;  3W1Y A;  4K7U A;  2NPT B;  4AJW A;  2KNB A;  3APC A;  2IO0 B;  4MGI E;  4HJK A;  2KO3 A;  1P1A A;  2FAZ A;  5C23 A;  1XD3 B;  2V4L A;  3LJ3 A;  3Q3F A;  4GDK A;  1V9J A;  2PPH A;  4P7I A;  4PYZ A;  3ML9 A;  3WAP A;  5HKH A;  4I6L B;  1Q0W B;  3VAW A;  1VCB A;  2C7M B;  2CKH B;  2JXX A;  4PYU A;  3VTU A;  2KK8 A;  2KWV B;  5CHV C;  4MGK E;  3U7D A;  1QZE A;  2HTH A;  4FJY A;  2MBE A;  3EEC A;  5KHO A;  2N9P C;  3TL5 A;  4FJZ A;  3DVN U;  2KDE B;  3QCA A;  4ANW A;  2KMA A;  4NJ6 A;  4W9H A;  5EDS A;  3RT3 B;  4ASW C;  4M0W B;  4A20 A;  2N1W A;  2KN5 A;  4G11 A;  4BVU C;  4JIO U;  3ENE A;  4W9D A;  3SD5 A;  3HM6 X;  3ZDT A;  1YX6 B;  3AXC A;  4MM3 A;  1V86 A;  3N3K B;  2NS5 A;  3VHT C;  2C7N B;  1J0G A;  3V6E B;  4HVB A;  3VDZ A;  4G3X B;  1WI0 A;  4LJO B;  5D94 A;  2JZZ A;  4W9I A;  2BWE S;  3W1S A;  2KAN A;  4AUQ C;  2AWT A;  2BYV E;  3PRP B;  2K6D B;  4E71 A;  3V60 A;  4DBG A;  1WGG A;  2KDF B;  3MTN B;  4K7S A;  2IBI B;  3RD2 A;  3H7P A;  2ZPN A;  1YJ1 A;  1ZW7 A;  3A9J A;  4IC7 B;  3ZKJ C;  4BBN C;  3IVF A;  4BOS C;  4K7W A;  3V62 A;  5AEK B;  2MWS B;  4YL8 A;  4B95 A;  1V2Y A;  3QAQ A;  3EHV A;  4XX5 A;  2ZVO A;  4W9E A;  3M63 B;  2KFK B;  2VRR B;  2J0M A;  4IM2 A;  2G3Q B;  1GNU A;  4KIK B;  3ZUN A;  4TKN A;  3X23 A;  2GBM A;  1NBF C;  1WXM A;  3H1U A;  5GMV A;  3BIN A;  4DWF A;  2GBJ A;  3ZTD A;  1SGH A;  1WJU A;  3QQ8 B;  5AZG A;  4DDG D;  3QC8 B;  3AU5 A;  3OJ3 A;  2ZJD A;  4TQ1 A;  2R2O A;  2M8S A;  4E3C A;  5E6O A;  2GBR A;  2L8J A;  4MJS B;  3A1Q B;  4NAW B;  1OEY A;  2XK5 A;  5E6P A;  1P9D U;  2LGD A;  2LUE A;  4OVV A;  4BKT A;  4EKU A;  3A9K A;  3O65 B;  4ANV A;  3DOW A;  2D3G A;  4IW0 A;  4RMA A;  3ZTC A;  2MBB B;  1V6E A;  1WXA A;  3ZVV A;  2Z0D B;  2N9E B;  3K9O B;  4M8M A;  3PRM B;  4GDL A;  4ANX A;  4DHJ D;  1WGD A;  3DDC B;  5CX3 A;  1RRB A;  2BF8 B;  2UYZ B;  3AU4 A;  3DCG A;  4HWI B;  5IA7 A;  4GN1 A;  4J6I A;  1UEL A;  1RFA A;  5J2R A;  2L05 A;  4FHJ A;  5J18 A;  3UIN B;  2YLM A;  3ZRC A;  2N7E A;  4TQ0 A;  1BT0 A;  2B3A A;  2KWU B;  2FCS A;  1GC6 A;  3T8M A;  2DZI A;  2D2Q A;  4N9F 4;  2C60 A;  1LFD A;  2REX A;  4GU2 A;  5LXI B;  2LGY A;  2KLC A;  2LAS A;  2QHO A;  1GUA B;  1WGR A;  4M8N A;  3UIP B;  4BFR A;  4EZJ A;  2Y5B B;  3VXW A;  4G50 A;  3PV1 A;  4HPM B;  4BKS A;  2O2V A;  3AUL A;  2L3Z A;  1E5W A;  4GGQ A;  3PZD A;  3QK0 A;  3TCA A;  4AP4 C;  2R2Q A;  3A1Q A;  4GDK B;  2ZCB A;  3IG3 A;  1KM7 A;  1WX7 A;  2BGF A;  2MLB A;  2O6V D;  3L13 A;  4NPN A;  1IPG A;  1MG8 A;  1D3Z A;  3N30 A;  2JRI B;  2KC1 A;  2NBU A;  1F9J A;  2WX1 A;  3PLV A;  3QWZ B;  1ZKH A;  4HXD A;  2CHZ A;  5G55 A;  3EFU A;  1EO6 A;  4PS8 A;  1WZ0 A;  1G6J A;  2KJH B;  2ZPY A;  1P98 A;  2ZCC A;  4PS3 A;  2I1J A;  3DVN V;  4K81 A;  2KFJ A;  1WX8 A;  1I35 A;  1V49 A;  5D2M B;  3ZLZ A;  2KTR A;  3ZIM A;  4W9F A;  3APF A;  5DPW A;  4KSK C;  3R7Q A;  1T0Y A;  1OEY J;  1X1M A;  1YD8 U;  3JW0 X;  1WE6 A;  2NBW B;  3WIM A;  2DYO A;  4IWP A;  5DPS A;  3H7S A;  5E6N A;  2JVC A;  2BKR B;  4WWP A;  4DHZ E;  1WF9 A; 
#chains in the Genus database with same CATH topology
 1I7H A;  2RDB C;  2KDB A;  4MEL A;  3L16 A;  1L6U A;  2Y5C A;  3S2A A;  3Q8E A;  4ZRP A;  3NVV A;  3ZXV A;  4ZRQ A;  2L32 A;  2LJI A;  1VZ6 A;  2JYE A;  2PTL A;  3AE2 B;  3HVZ A;  3NVZ A;  2AQ2 B;  5JZE B;  3RUL A;  3DBR I;  3NHE B;  2PKO A;  4JLC A;  1OFF A;  3P4R B;  4C00 A;  4MEM A;  1H8C A;  2AEH A;  1HTO A;  3GE3 C;  4HLE A;  1L2N A;  2FNJ B;  2DZJ A;  4YWG G;  3RUI B;  4IWQ A;  3UGB B;  3VH3 B;  1P7F A;  1TZO A;  1R4N B;  5CHF A;  4TV3 A;  1GG3 A;  1SJH D;  1Z5S B;  3MHZ A;  1HTQ A;  1CMX B;  4HCN B;  2MRP A;  2FCN A;  5BMG A;  2WS3 B;  3Q3N C;  1QQR A;  2HTM E;  4DHZ B;  1FFV A;  4FBJ B;  1OGW A;  3GZN I;  4BZA A;  4OHJ A;  5AZH A;  3L4P A;  1KLU D;  1YN4 A;  3PZ8 A;  3ABV B;  2JRH A;  2FUH B;  2LVQ A;  3AEC B;  4L1B A;  4BOZ B;  1D5M C;  4B0E A;  2IY1 B;  3BY4 B;  3RI7 C;  1RAX A;  2QMT A;  3HRD D;  1XLP A;  3IT4 B;  1J7C A;  2HE7 A;  1UNS A;  1GJZ A;  3TJP A;  3N9Y C;  1U4A A;  4BKS D;  3Q8F A;  5D7G A;  3APD A;  1LGR A;  2BPS A;  4LDT B;  5D3I B;  3I63 C;  3A4R A;  1SE3 A;  3ZDM C;  1Q1O A;  3KWV A;  4XC2 A;  1PUT A;  1RLF A;  1N61 A;  2W9N A;  4CHK A;  2IGD A;  2AL6 A;  3SDL C;  2BB6 A;  4HCP B;  1NDD A;  3WA0 A;  3T3N A;  2D07 B;  3RCZ A;  4P1B C;  3KUC B;  5AUK A;  1ZE3 D;  1E0Z A;  3A9K B;  3KVF B;  1WGY A;  1Z2M A;  2WP9 B;  3CF6 E;  1WMH A;  3JSV A;  1WGK A;  4ZOH C;  1WM2 A;  3UQB A;  2A5U A;  4RGM A;  2CR5 A;  1S3S G;  5IO9 A;  4LTU A;  1V8C A;  3OWE B;  1IBX B;  2OJR A;  1MHH E;  3U4E G;  2M0A A;  1FNU A;  4EZL A;  3P4P B;  3PLU A;  5JHA A;  4BAX A;  2I1K A;  1WR1 A;  2KZR A;  1I42 A;  4I6P A;  1WYG A;  2V3N A;  4B6W A;  1VRA B;  4CYE A;  1TKY A;  1FEH A;  2PMV A;  1E8Z A;  3RNA C;  3JVZ X;  3M3J A;  5BYQ A;  4MGZ E;  2WXQ A;  4NNJ B;  1P0R A;  2NCN A;  2LUM A;  2PE6 B;  2KLG A;  5AUI A;  4FN2 A;  4DDI D;  2NBV B;  3K9P B;  3HK0 A;  3PGE A;  3P1M A;  4PS7 A;  2N9K A;  5EE9 A;  1K53 A;  1H4R A;  2IY0 B;  2PIA A;  4US8 A;  4EUT A;  4MH8 A;  1IGC A;  1T0S C;  2LXC A;  5D6J B;  1C4P A;  4W9C A;  3BZD B;  3V61 A;  2MW5 A;  2CU1 A;  1ZDX A;  2J53 A;  3RZW C;  2UWQ A;  1MI0 A;  2CU3 A;  2J7Q B;  2GB1 A;  2KX3 A;  2BYF A;  1M4V A;  1FMA D;  1S1Q B;  2JSV X;  3N1Z C;  4F8C B;  2EMT A;  1YMH E;  2J0K A;  2JZP A;  4OZA A;  2JF5 A;  2LZ6 A;  2GBN A;  2Z59 B;  1F2R I;  3T3O A;  1PGA A;  4IM0 A;  4MH0 E;  3QX1 A;  2LJ5 A;  3CIR B;  3FIL B;  1F52 A;  4URK A;  3BVM A;  1FNW A;  2E3T A;  3PRZ A;  3BK2 A;  1N5W A;  4P6V F;  3SHQ A;  2A4Z A;  2DLB A;  4F7Z A;  2KKC A;  4XWT A;  2KTR B;  1WJ6 A;  1VR9 A;  2DYM A;  3VFK A;  3B0A A;  1WXQ A;  3VUX A;  3TIX A;  1ZOY B;  1L7Y A;  2ZW1 A;  4MM3 B;  1FRR A;  2KYW A;  3AEE B;  2K0P A;  1KH0 A;  1CQV A;  3APC A;  3FC4 A;  4HJK A;  4WWM A;  1P1A A;  2V4L A;  3WAP A;  1V9J A;  2PPH A;  2IJ0 A;  5CHV C;  1XLN A;  1QZE A;  1SXT A;  2LGI A;  1ZXI A;  2N9P C;  4ANW A;  2I38 A;  1L6V A;  4NJ6 A;  4AQ7 A;  4M0W B;  1FIQ A;  2N1W A;  2OED A;  4JIO U;  2K5P A;  1I4H A;  3AEF B;  1V86 A;  1JRP A;  3V6E B;  2OJW A;  5FKA C;  3V60 A;  4D2K A;  4DBG A;  1XXG A;  3MTN B;  1L4Z B;  2IBI B;  2WXH A;  1ZW7 A;  3A9J A;  4BOS C;  3ZKJ C;  3ZJT A;  1D5Z C;  2ONQ A;  2Y3A A;  4XX5 A;  2J4X A;  1JAL A;  2KFK B;  2G3Q B;  3X23 A;  3GZN B;  1TS4 A;  3HUI A;  1DOX A;  1SGH A;  1KFY B;  1JRO A;  4DDG D;  2ZJD A;  4TQ1 A;  4HKZ E;  2R2O A;  4YTM B;  2L8J A;  3A1Q B;  4NAW B;  1OEY A;  1PDX A;  1SE4 A;  4BKT A;  3A9K A;  4S0R A;  4ANV A;  4RMA A;  3ZVV A;  4M8M A;  3K9O B;  4GDL A;  3AEB B;  2UYZ B;  1V97 A;  4GN1 A;  5J2R A;  1T0Q C;  5J18 A;  1CK1 A;  1GC6 A;  3T8M A;  4N9F 4;  1QIL A;  2C60 A;  4GU2 A;  2KLC A;  1IUE A;  5EE1 A;  4M8N A;  3FAH A;  4EZJ A;  2Y5B B;  2YEP B;  4G50 A;  4BKS A;  2O2V A;  3QK0 A;  5BMI A;  3VR9 B;  2AQ3 B;  1MG8 A;  3PLV A;  2WXM A;  4HXD A;  3MC8 A;  3O13 A;  3RNC C;  4A9A A;  2KJH B;  4PS3 A;  3DVN V;  3ZIM A;  1E10 A;  4J3O D;  4KSK C;  1OEY J;  3C8Y A;  4YSY B;  3JW0 X;  2DYO A;  4YSX B;  1MG4 A;  2BKR B;  4WWP A;  1AYF A;  1C79 A;  5L83 A;  4HDQ A;  2N0S B;  1UUP A;  2LWP A;  2MSE D;  1RFK A;  5C2T B;  3VR8 B;  3LB8 C;  2V3P A;  4NQL B;  3ZNZ B;  4EOY A;  1RWS A;  4NZL B;  1MHX A;  3IBE A;  1UBI A;  1ZXH A;  3I57 A;  1ZGU B;  4WUR A;  2QDF A;  2W3R A;  3PT2 B;  4JL9 A;  4KKJ A;  3ONS A;  5GXG B;  3OAW A;  2W54 A;  1C4C A;  1V5T A;  4HPP A;  2KDI A;  1HZ6 A;  4EZK A;  5IAA C;  2LVO A;  3C0R B;  4PT5 A;  4CQN A;  4RM9 A;  4BBN F;  1DYQ A;  4GOC A;  2DWQ A;  1PGX A;  3PHX B;  4ZYN A;  4K3B A;  4TUU A;  3V6C B;  4C7Y A;  2C5L C;  3H6N A;  4MAC A;  1BXT A;  1DOY A;  2RGF A;  3U7Z A;  1C1Y B;  5C1Z A;  1TT5 B;  3AE6 B;  2KDM A;  2X38 A;  1EF1 A;  3WAO A;  2KXJ A;  3ZXR A;  3BWU D;  4XZ4 A;  4OVU A;  1KJT A;  2FCM A;  3DWG C;  3Q69 A;  4LNF A;  2DAJ A;  2MJ3 A;  1ROE A;  1YQ3 B;  1YNT E;  2MHJ A;  2JY6 A;  4IUM B;  2JX5 A;  3NZU A;  1IP9 A;  3AI5 A;  4FJV B;  4GIV A;  3QJZ A;  2K8B A;  2W55 A;  3VH4 B;  3AE7 B;  3PTF C;  2IND C;  3ZNH B;  4AOF A;  1WFY A;  3R2T A;  1WWT A;  4M02 A;  5DPR A;  2BW2 A;  3WAL A;  3WCQ A;  5BYS A;  3CST A;  1J7B A;  2LD9 A;  2ZZP B;  2L76 A;  4KZC A;  2RPQ A;  1EF5 A;  4RM8 A;  2LHD A;  1YQB A;  2CJO A;  2L0T A;  3EC8 A;  3U52 E;  1E8W A;  1E8X A;  3OJ4 B;  1F77 A;  3ALB A;  1HQR D;  4LCD E;  4MJS A;  2J52 A;  3RNB C;  1WM3 A;  2GBK A;  3T9L A;  2MH7 A;  1QOG A;  2M0X A;  4EFO A;  2DZM A;  2PE9 A;  2TSS A;  1F2R C;  1WXS A;  4ZYS A;  1J8C A;  1E7U A;  4KV2 A;  2JUO A;  1ACC A;  2NMQ A;  2K39 A;  4HPL B;  2INP E;  1TS2 A;  2VH2 A;  1D6E C;  4NAW A;  2JWU A;  1EU4 A;  3NY5 A;  3Q6B A;  1WJN A;  2C7H A;  2O6V B;  1HXY D;  4MSQ B;  3B08 A;  1KLV A;  2CJN A;  2G45 B;  3Q14 C;  3JSV B;  3PVL A;  3Q8C A;  3AE5 B;  1E9M A;  3W9C B;  2BS2 B;  3IHP C;  2KWC A;  3Q3M C;  2LFI A;  2N9X A;  1TTN A;  4MDK E;  2VH1 A;  2PW9 A;  4RNA A;  2G4S A;  2MX2 A;  2DYB A;  4DHJ B;  2WWZ A;  1YQ4 B;  5C3J B;  3DBL I;  3LYY A;  2IYD B;  3N20 C;  1UGJ A;  1VD2 A;  5TR5 A;  1FO4 A;  5AZF A;  4G0N B;  4ACF A;  1P3Q U;  4I6N B;  4R3D A;  2VZK D;  2LI5 A;  4DXF A;  1EWC A;  2ZNV B;  2D3A A;  1JRU A;  2EEL A;  3P2B A;  3PZ7 A;  1TGZ B;  2NR2 A;  1HEZ E;  3L0W B;  4FAD A;  1I4R A;  5L95 C;  3N1X C;  3ZRF A;  2HDE A;  1L4D B;  4II3 B;  2BS4 B;  1QF6 A;  3U8Z A;  1C4A A;  3A33 B;  2MBH A;  3QHT A;  4WWN A;  1R4N I;  1TYG B;  3NZ3 A;  1D5X C;  2L7R A;  4KX6 B;  1SIJ A;  2KFK A;  1HE8 A;  3DBL B;  2RPV A;  5JHB A;  3MC9 A;  1SE9 A;  2M1M A;  4N6E B;  3DBS A;  2N9L A;  2ZNV C;  3AM9 A;  1YX5 B;  4O1N A;  1XF5 L;  2UU7 A;  4K1R B;  3UI3 A;  1BUI C;  2IGG A;  2WXG A;  5FK9 C;  3LDZ E;  1YJJ A;  2RDG A;  4A90 A;  3ZNI D;  4WQO B;  3AE1 B;  2XEW A;  4WAF A;  1CZP A;  1E90 A;  1A5R A;  2N7J A;  1LXD A;  5T8I A;  3TUO A;  2ON8 A;  5HHD G;  2NPT B;  2KNB A;  2KN4 A;  2KQ4 X;  2IO0 B;  3NUH B;  2FAZ A;  5C23 A;  4PYZ A;  3LJ3 A;  3VTU A;  2IPK D;  4GDK A;  1FD6 A;  4I6L B;  1Q0W B;  4DQO C;  2C7M B;  1D4B A;  4MGK E;  1FCC C;  1NYQ A;  2XN9 C;  2MBE A;  3TL5 A;  3AE4 B;  2KDE B;  1QOA A;  3QCA A;  2KMA A;  3AH7 A;  2W3S A;  4A20 A;  4XDD A;  2KN5 A;  4BVU C;  4ARC A;  1YX6 B;  4RGN A;  4REZ A;  2FBW B;  1WI0 A;  5D94 A;  4W9I A;  2BWE S;  2AWT A;  2BYV E;  2WXP A;  1JWB D;  3TEW A;  2KDF B;  3IXS A;  1AN8 A;  2MWS B;  4B95 A;  3QAQ A;  3M63 B;  1KLG D;  4TKN A;  2GBM A;  5GMV A;  1FM0 D;  1T5X D;  3QQ8 B;  2D3B A;  3BVZ A;  2QSD A;  4EE2 A;  1TJE A;  4E3C A;  4JPS A;  2GBR A;  1UWX A;  1P9D U;  4EKU A;  3O65 B;  3DOW A;  4IW0 A;  3PRM B;  4DHJ D;  3DDC B;  2BF8 B;  3AU4 A;  3UIN B;  2YLM A;  1YOV B;  3ZRC A;  4TQ0 A;  1BT0 A;  2FCS A;  1LO5 D;  4LNN A;  2LAS A;  2QHO A;  1CJE A;  1GUA B;  1PGB A;  3FKY A;  4BFR A;  2WDV B;  3VXW A;  4Q2J A;  2BBC A;  3TCA A;  4GDK B;  2KAJ A;  3RNE C;  3IG3 A;  1KM7 A;  2BQQ A;  3L13 A;  2WXI A;  1FFU A;  4YTP B;  2K9X A;  3QWZ B;  2CHZ A;  2ZW0 A;  1EO6 A;  3EGR A;  1G6J A;  2Y5P A;  2KFJ A;  1WX8 A;  3CWI A;  1I4X A;  2RMM A;  1KF6 B;  4M01 A;  1WE6 A;  2NBW B;  1E6E B;  3H7S A;  5E6N A;  2JVC A;  4DK5 A;  2MA9 B;  1QLB B;  1SF0 A;  2BVC A;  2G4D B;  3Q8B A;  5EE0 A;  4AS1 A;  2GI9 A;  2KX0 A;  1WR6 E;  3L08 A;  5EE3 A;  3GE8 C;  4HRO A;  1FPY A;  1XCT L;  4KDI C;  3RN9 C;  1IBX A;  2VZK B;  3JYU A;  1WY8 A;  1J7A A;  4HDO A;  3BYY B;  1GB1 A;  4HJG E;  3IT6 B;  1UBQ A;  1WGH A;  2K1F A;  3NS1 A;  2LRW A;  1NEK B;  1L0X B;  3ZJV A;  3HHM A;  4RF1 A;  4KGR A;  4W9L A;  3NRZ A;  2WXJ A;  1FXT B;  2BKF A;  3M95 A;  1TS3 A;  3SR6 A;  2V1Y A;  4A55 A;  3BII D;  4ARI A;  3KYC D;  5H8Y E;  3MC0 B;  1KOT A;  1E7V A;  1WXV A;  2IZV B;  2MEK A;  2PLP A;  3NVW A;  1JW9 D;  5H92 C;  5JH5 C;  5I4D A;  3VVW B;  4ICV A;  4II2 B;  2H89 B;  2LGX A;  5LXH A;  3R2I A;  1WSP A;  4ZRJ A;  1TS5 A;  2WXF A;  4KIK A;  3NJT A;  2KC2 A;  2FID A;  2WX0 A;  2ASQ A;  3A9J B;  4OVZ A;  3H7P B;  4WJP A;  3R66 C;  1UZX B;  1NVI D;  1WH3 A;  1STE A;  3P4S B;  2L83 A;  2WQY B;  3PSE B;  3PS6 A;  2NTT A;  2YVC A;  4B0M A;  3RZF A;  1Y8R C;  3DWM A;  1TY0 A;  4ITK A;  3RFZ B;  1V1P A;  4JE3 B;  1WE7 A;  3ZW3 A;  4GDL B;  4JQW C;  5HFY A;  2XBB C;  3AB5 A;  1ZDV A;  3R8B A;  1XLO A;  3EUB 2;  3ZQ4 A;  1J19 A;  2MCN B;  4X57 B;  3DBH I;  3HIZ A;  4NJ7 A;  4AJY B;  1FXA A;  1JCK B;  3SU8 X;  2LXA A;  2E6X A;  3QIJ A;  3QA8 A;  3UQA A;  2KQ7 A;  1TY2 A;  1WJ4 A;  3PHW B;  4ANU A;  2AL3 A;  2RR9 A;  3M62 B;  2IO2 B;  4W9K A;  3L17 A;  4H2A A;  2KT7 A;  5DPT A;  4NY0 A;  3TEZ A;  4WJN A;  5FR6 A;  1UGM A;  4N59 A;  5KHQ A;  1Q10 A;  2IGH A;  4XE0 A;  3H9D A;  4RGT A;  4HEA 1;  4GMV A;  4ZRK A;  5G5G A;  3KLS X;  3VQI A;  2PVO D;  3KUD B;  1N63 A;  3DBR B;  1NI3 A;  2K6Q A;  2QJL A;  3EFC A;  4JGH B;  4GSW A;  2ZEQ A;  1FXI A;  1C3T A;  4WQM A;  5D3D A;  3L54 A;  4NQK E;  3ZYY X;  4A3O A;  3Q3J A;  1R4M B;  2RSU A;  1A70 A;  2KMM A;  2NVU I;  2V3S A;  5IN7 A;  3X0W A;  1WIA A;  3VTV A;  1SSN A;  3VUY A;  3DVG Y;  4IWO A;  2L0F A;  2L00 B;  2MJE A;  3W1S C;  2RDH A;  3KW5 B;  5CHW A;  4IG7 B;  3E9S A;  2SAK A;  2WLB A;  2QIE B;  1NEN B;  3R3M A;  5CTR C;  3RYT A;  3AV8 A;  1ZUD 2;  3U30 A;  3PRE A;  1FNV A;  3HVD A;  2IO3 B;  1L0Y B;  3B2G A;  4E74 A;  2WYQ A;  2GRI A;  2D3C A;  3KWL A;  3BVG A;  4US9 A;  1K50 A;  2J42 A;  1TKE A;  1Q5W B;  2D11 A;  3R7R A;  1LQB A;  3P63 A;  5HI1 A;  3D32 A;  3KUZ A;  4LNO A;  1MVK A;  3QAR A;  3NS8 A;  4KZ0 A;  3HM3 A;  4S17 A;  3W5U B;  4WAA A;  2WXL A;  4IKG A;  4GB9 A;  3PPA A;  2PEA A;  3ZO5 B;  1OQR A;  3MJ5 A;  3TEX A;  1JML A;  2JPH A;  5DCN A;  2AYO B;  2Q5W D;  2GLS A;  2JXT A;  3IAS 1;  1NYR A;  4A6Q A;  5JXV A;  4C80 A;  1C77 A;  1JWU D;  2INC C;  3AE8 B;  1F1H A;  1HA5 A;  3DHG C;  2KO3 A;  3Q3F A;  4P7I A;  3VAW A;  2WXR A;  1AW7 A;  3RPF C;  4PYU A;  3AMZ A;  1V1P B;  4FJY A;  2V0G A;  5KHO A;  5HG2 A;  2NTS A;  4W9H A;  2JQR B;  3RT3 B;  4G11 A;  3OG5 A;  3AXC A;  1J0G A;  3N3K B;  3VHT C;  4HVB A;  4YXD B;  4LJO B;  3DHH C;  3W1S A;  4AUQ C;  3PRP B;  4E71 A;  1ET9 A;  2FUG 1;  1WGG A;  4K7S A;  3RD2 A;  3H7P A;  2ZPN A;  1YJ1 A;  4IC7 B;  3V62 A;  5AEK B;  1F0Z A;  4YL8 A;  1V2Y A;  2ZVO A;  2VRR B;  2J0M A;  4KIK B;  4LK0 M;  3ZUN A;  1QOF A;  1NBF C;  2ACZ B;  1WXM A;  3H1U A;  3AEA B;  1WJU A;  5AZG A;  2M19 A;  3AU5 A;  3OJ3 A;  2M8S A;  4RF0 A;  2XK5 A;  2LUE A;  4OVV A;  1L0V B;  2D3G A;  1V1O A;  3ZTC A;  2MBB B;  3EA6 A;  3B9J A;  1RRB A;  5IA7 A;  4HWI B;  3IAM 1;  2LMC A;  4J6I A;  2L05 A;  4FHJ A;  2R61 A;  2B3A A;  1ENF A;  4ZHO A;  2HJ1 A;  1JWS D;  1LFD A;  5LXI B;  4M0W A;  4IOI E;  2LGY A;  1WGR A;  4USA A;  3UIP B;  3J9C A;  3AEG B;  1UWM A;  1XCQ L;  2XNA C;  3PV1 A;  1E5W A;  4QAY A;  3PZD A;  2QC8 A;  3A1Q A;  1QOB A;  1L5P A;  2ZCB A;  1WX7 A;  2BGF A;  1ET6 A;  2MLB A;  2O6V D;  4NPN A;  1IPG A;  3RNF C;  1D3Z A;  1IGD A;  1ZPS A;  5IP4 D;  1SEB D;  2NBU A;  3MFG A;  3EFU A;  2ZPY A;  2ZCC A;  4DXG A;  2I1J A;  1RM6 C;  2LEK A;  4JWU C;  1V49 A;  3ZLZ A;  2KTR A;  4W9F A;  3APF A;  1T0Y A;  1YD8 U;  2AX5 A;  1YN5 A;  4IWP A;  4OZC A;  1AWD A;  1WF9 A;  1BML C;  3VRB B;  2M17 A;  2KWD A;  3B1L X;  2M4N A;  2WGS A;  3L10 B;  2SEB D;  2K25 A;  2DHZ A;  5LLI A;  2WDQ B;  3P42 A;  1V81 A;  2L52 A;  3GB1 A;  3ZGZ A;  3I3T B;  4ZDV A;  1I4G A;  4IM3 A;  3NVY A;  4LNK A;  3TMP B;  2CHX A;  3UF8 A;  2WU5 B;  4K3C A;  4A8X C;  3SFE B;  2LHE A;  2N4F A;  2BYT A;  2GOW A;  1LM8 B;  2X8X X;  2N7D A;  1VZ7 A;  1N62 A;  2JU6 X;  2IO1 B;  4KDL B;  2IDY A;  1GC7 A;  2WXK A;  4F1S A;  1UH6 A;  1NI2 A;  1TIF A;  4RCO A;  2MBO A;  1B9R A;  2DNF A;  4XYC A;  2KJ6 A;  3CSF A;  2INN E;  3LXF A;  3W2D A;  4HKQ A;  4MGY E;  3Q2A C;  3TEY A;  2JT4 B;  5G2N A;  1YJI A;  3V05 A;  2CS4 A;  5J17 A;  1WRI A;  3FIL A;  1MPE A;  1GB4 A;  4W9G A;  4BKG A;  4N58 A;  3NZS A;  2BWF A;  3VUW A;  3KH0 A;  1Y56 A;  2H88 B;  2KVZ A;  2PJH A;  1V80 A;  1OQY A;  1VLB A;  3CMM B;  3MJW A;  2G9H D;  1WX9 A;  3GS2 A;  2KQS A;  4XWW A;  3AE9 B;  4AWJ A;  3ETR A;  1T3Q A;  5BYR A;  2WDR B;  1OTR B;  4MSM B;  3KQ4 A;  4WJO A;  2KTF A;  2DZK A;  3GOE A;  3BK1 A;  5MPO A;  1XQQ A;  4W9J A;  3DQV A;  4XGA B;  1QKZ A;  4XDC A;  1E8Y A;  4DXA B;  2PVG C;  4OW0 A;  4L2Y A;  4C4V B;  1GPX A;  2FE8 A;  1GOZ A;  3UIO B;  2Z0E B;  5BO4 B;  3AN1 A;  1K8R B;  1WMH B;  1JQ4 A;  4FA6 A;  2CHW A;  4OZB A;  1EU3 A;  2QEJ C;  2KOX A;  1QT9 A;  4A3P A;  4UDU C;  2K22 A;  1YIW A;  2DX5 B;  1PFD A;  1JWA D;  4LNI A;  3AE3 B;  2DEN B;  1OQQ A;  4FLH A;  4KGT A;  2K8C A;  3VTW A;  3Q8A A;  1PQS A;  1R4M I;  1V5O A;  1I4P A;  2LRU A;  2KJR A;  2ZVN A;  4PK1 A;  2WXO A;  2C9W B;  1I4Q A;  1MJD A;  4NAM A;  2KVR A;  2QCZ A;  4GXB A;  3ECI A;  1DGJ A;  1RYJ A;  1VZ8 A;  3A4S C;  4HK2 A;  4ICU A;  2YEP F;  3DPD A;  2DAF A;  4FUL A;  2Z8L A;  2FIF A;  4YT0 B;  1K51 A;  2J0J A;  4C7Z A;  3BYT B;  1WRD B;  1XT9 B;  2OOB B;  2BB5 A;  2BTE A;  2KD0 A;  2MP2 A;  2W82 A;  4CO7 A;  4P1C C;  2LVP A;  3OLM D;  1TKG A;  2EKE C;  4M00 A;  4WJQ A;  1UD7 A;  2N1V A;  2GMI C;  1P7E A;  2QIL A;  3Q3O C;  2NPT A;  1VJK A;  4LJP B;  3ML8 A;  2O2V B;  5G5H A;  4KVG B;  2G1E A;  2AQ1 B;  3MHS D;  3NOB A;  4NJC A;  2HJ8 A;  5E6J A;  3MP9 A;  3WAM A;  3URY A;  1B1Z A;  1MFW A;  2KHW B;  4KSL C;  3H8H A;  4WWO A;  4RFB A;  4L23 A;  1C78 A;  2HD5 B;  1AAR A;  1T0R C;  4JX1 C;  4B9K A;  3WAN A;  1WZ3 A;  4FHK A;  1JWM D;  2K8H A;  1SIF A;  1K52 A;  1R7S A;  2JZ3 B;  2MP2 B;  4WIP A;  5IOI A;  1T6B X;  2EMS A;  2D10 A;  2XK5 B;  2RD0 A;  3DVG X;  4ZRI A;  2O6V A;  1WYW B;  2BYE A;  3GP7 A;  3TBL D;  3ZJU A;  3E56 A;  2I2Y A;  2MQJ A;  4ZHP A;  1XO3 A;  3W5V B;  1XLQ A;  1TZ1 A;  1M94 A;  2WU2 B;  2V4I B;  4WH4 A;  3N32 A;  4LDT D;  3ZNG C;  1YN3 A;  2WDT B;  2KAC A;  4EEW A;  2MBQ A;  3B2F A;  2KMC A;  2JWZ A;  2WHI A;  3N1Y C;  1ISN A;  5BMH A;  1EUV B;  4IDI A;  3IFW B;  4MT5 A;  1XEE A;  1IYF A;  3KYD D;  2FCQ A;  4KGS A;  3W1Y A;  2L1A A;  4K7U A;  4TSS A;  4AJW A;  2JYT A;  1C9F A;  4KKI A;  4MGI E;  1XD3 B;  4YTN B;  5HKH A;  3AED B;  3SFD B;  3ML9 A;  3P4Q B;  1VCB A;  2CKH B;  4C56 C;  1UF0 A;  2JXX A;  2KK8 A;  2KWV B;  2LGS A;  3U7D A;  2HTH A;  3EEC A;  4FJZ A;  3DVN U;  4C4V A;  5IKC M;  1EM7 A;  1GAQ B;  4ASW C;  4P16 A;  1SB3 C;  5EDS A;  3NG0 A;  1FRD A;  1FCL A;  2WNM A;  3ENE A;  4W9D A;  3SD5 A;  3HM6 X;  3ZDT A;  4MM3 A;  2NS5 A;  2C7N B;  3VDZ A;  4G3X B;  2JZZ A;  2KAN A;  2K6D B;  2BT6 A;  2BS3 B;  4BBN C;  1SJE D;  3IVF A;  4K7W A;  3EHV A;  4W9E A;  4IM2 A;  1GNU A;  1ESF A;  1SE2 A;  2ICI A;  3BIN A;  5TSS A;  4DWF A;  2GBJ A;  3ZTD A;  3QC8 B;  1N60 A;  4RH6 A;  3C19 A;  5E6O A;  2EKI A;  4MJS B;  2V9H A;  5E6P A;  2LGD A;  3U2S C;  1V6E A;  3I5J C;  1WXA A;  2Z0D B;  2N9E B;  3SEB A;  1SBB B;  4ANX A;  1WGD A;  5CX3 A;  1N6Z A;  3DCG A;  1KTK A;  1RFA A;  1UEL A;  3DBH B;  2N7E A;  3TSS A;  2KWU B;  4YSZ B;  1E7P B;  2DZI A;  2D2Q A;  2REX A;  3PO0 A;  3DHI C;  1PYW D;  1ZP0 B;  4HPM B;  1VDV A;  3VRA B;  3AUL A;  2L3Z A;  4GGQ A;  2M56 B;  4AP4 C;  2R2Q A;  4FXC A;  1EWY C;  2D5G A;  1HZ5 A;  2B76 B;  4TMA B;  5FR3 A;  3RMK C;  3N30 A;  2MJD A;  2JRI B;  1C76 A;  2KC1 A;  3V3X A;  1F9J A;  2WX1 A;  4HRS A;  1ZKH A;  4GLS C;  5G55 A;  4PS8 A;  1WZ0 A;  1P98 A;  2DBY A;  5LNK 1;  2OHF A;  4K81 A;  1I35 A;  5D2M B;  2WXN A;  1DOI A;  1KRH A;  2K3U A;  5DPW A;  3RNG C;  3R7Q A;  4LLG M;  1X1M A;  1N5X A;  3WIM A;  4RGO S;  4JWS C;  3I9V 1;  5DPS A;  1TBE A;  4DHZ E; 
#chains in the Genus database with same CATH homology
 2KDB A;  4MEL A;  5L83 A;  2M17 A;  4DK5 A;  4HDQ A;  3B1L X;  2MA9 B;  2M4N A;  3L16 A;  2G4D B;  2LWP A;  2MSE D;  3S2A A;  3L10 B;  2KX0 A;  1WR6 E;  2K25 A;  3L08 A;  4NQL B;  3ZNZ B;  2DHZ A;  5LLI A;  4EOY A;  4KDI C;  3IBE A;  1V81 A;  1UBI A;  3JYU A;  1WY8 A;  3I3T B;  4ZDV A;  5JZE B;  1ZGU B;  4IM3 A;  4HDO A;  3RUL A;  3TMP B;  2CHX A;  3UF8 A;  3PT2 B;  3DBR I;  1UBQ A;  1WGH A;  3NHE B;  4JLC A;  4JL9 A;  2K1F A;  2N4F A;  2LRW A;  2GOW A;  3ONS A;  1LM8 B;  3OAW A;  4MEM A;  1V5T A;  2AEH A;  3HHM A;  2N7D A;  4HLE A;  1H8C A;  2KDI A;  2IO1 B;  4EZK A;  1L2N A;  5IAA C;  2LVO A;  2FNJ B;  4KDL B;  1GC7 A;  4W9L A;  2DZJ A;  3C0R B;  4F1S A;  1UH6 A;  4RM9 A;  1FXT B;  2BKF A;  3RUI B;  4BBN F;  1NI2 A;  4IWQ A;  3M95 A;  3UGB B;  3VH3 B;  4GOC A;  2MBO A;  2V1Y A;  3KYC D;  2KJ6 A;  5CHF A;  3CSF A;  4TV3 A;  1GG3 A;  1Z5S B;  1KOT A;  1E7V A;  3PHX B;  4ZYN A;  1CMX B;  4HCN B;  2MRP A;  4TUU A;  1WXV A;  2FCN A;  3V6C B;  2IZV B;  4MGY E;  2C5L C;  3H6N A;  2JT4 B;  4DHZ B;  5JH5 C;  2RGF A;  4FBJ B;  5G2N A;  1OGW A;  3GZN I;  3VVW B;  1C1Y B;  2CS4 A;  5J17 A;  4ICV A;  5C1Z A;  5AZH A;  3WAO A;  1EF1 A;  2KXJ A;  4W9G A;  4BKG A;  4XZ4 A;  4OVU A;  1KJT A;  3NZS A;  2BWF A;  3VUW A;  4II2 B;  3KH0 A;  2FCM A;  2LGX A;  2JRH A;  2PJH A;  5LXH A;  4ZRJ A;  2DAJ A;  1V80 A;  1OQY A;  2FUH B;  4KIK A;  2KC2 A;  3CMM B;  2LVQ A;  3MJW A;  2FID A;  2WX0 A;  4BOZ B;  2ASQ A;  2IY1 B;  2JY6 A;  1WX9 A;  3BY4 B;  2KQS A;  3A9J B;  3NZU A;  4IUM B;  4AWJ A;  1IP9 A;  3H7P B;  3AI5 A;  4FJV B;  1RAX A;  4GIV A;  3QJZ A;  4WJP A;  2K8B A;  3VH4 B;  3R66 C;  2HE7 A;  1GJZ A;  1OTR B;  4MSM B;  3TJP A;  3PTF C;  3ZNH B;  4AOF A;  1U4A A;  4BKS D;  1UZX B;  1WFY A;  4WJO A;  2KTF A;  2DZK A;  5D7G A;  1WH3 A;  3APD A;  3GOE A;  5DPR A;  2BPS A;  4LDT B;  3WAL A;  1XQQ A;  3PSE B;  4W9J A;  3PS6 A;  3A4R A;  3ZDM C;  1Q1O A;  2YVC A;  3DQV A;  4XC2 A;  3RZF A;  1Y8R C;  1RLF A;  3CST A;  2W9N A;  4CHK A;  2AL6 A;  2LD9 A;  2ZZP B;  1E8Y A;  2L76 A;  3SDL C;  4KZC A;  2RPQ A;  4DXA B;  1EF5 A;  1WE7 A;  4RM8 A;  3ZW3 A;  1YQB A;  2L0T A;  3EC8 A;  4HCP B;  1NDD A;  4GDL B;  4JQW C;  3UIO B;  1E8W A;  3WA0 A;  1E8X A;  3OJ4 B;  2D07 B;  2XBB C;  3RCZ A;  2Z0E B;  5BO4 B;  1K8R B;  3KUC B;  1WMH B;  4FA6 A;  3A9K B;  2CHW A;  1WGY A;  3KVF B;  1J19 A;  2MCN B;  3ALB A;  2KOX A;  4LCD E;  4X57 B;  3DBH I;  3HIZ A;  4A3P A;  4MJS A;  1Z2M A;  3CF6 E;  1YIW A;  2DX5 B;  4NJ7 A;  1WMH A;  4AJY B;  3JSV A;  2LXA A;  3SU8 X;  1WM3 A;  1WM2 A;  2GBK A;  3T9L A;  3UQB A;  3QIJ A;  3QA8 A;  3UQA A;  2A5U A;  2KQ7 A;  2M0X A;  1WJ4 A;  2CR5 A;  3PHW B;  4EFO A;  2DZM A;  2PE9 A;  2DEN B;  1S3S G;  4FLH A;  2K8C A;  3VTW A;  4ANU A;  1PQS A;  1WXS A;  1R4M I;  2AL3 A;  1V5O A;  2LRU A;  2OJR A;  2RR9 A;  3M62 B;  1E7U A;  2IO2 B;  2KJR A;  4KV2 A;  1J8C A;  4W9K A;  3L17 A;  2ZVN A;  4EZL A;  2JUO A;  3PLU A;  5DPT A;  5JHA A;  2I1K A;  1WR1 A;  2C9W B;  2KZR A;  1I42 A;  2KVR A;  4I6P A;  4GXB A;  3ECI A;  4NY0 A;  4B6W A;  2K39 A;  4HPL B;  4WJN A;  5FR6 A;  1UGM A;  3A4S C;  4HK2 A;  4CYE A;  4ICU A;  5KHQ A;  3DPD A;  3H9D A;  3NY5 A;  4NAW A;  1WJN A;  4GMV A;  1E8Z A;  2C7H A;  2DAF A;  4ZRK A;  4FUL A;  2O6V B;  2FIF A;  3JVZ X;  3M3J A;  4MSQ B;  4MGZ E;  3B08 A;  3VQI A;  4NNJ B;  2J0J A;  3KUD B;  1P0R A;  1WRD B;  1XT9 B;  2OOB B;  2NCN A;  2K6Q A;  1KLV A;  2PE6 B;  4JGH B;  2KD0 A;  2G45 B;  2KLG A;  2ZEQ A;  4GSW A;  2MP2 A;  4FN2 A;  4DDI D;  4CO7 A;  1C3T A;  3JSV B;  3PVL A;  2NBV B;  2LVP A;  3HK0 A;  3K9P B;  3L54 A;  3PGE A;  3OLM D;  4PS7 A;  4NQK E;  3IHP C;  1H4R A;  2IY0 B;  2KWC A;  2EKE C;  3Q3J A;  4A3O A;  2RSU A;  4WJQ A;  2NVU I;  4EUT A;  1UD7 A;  2N9X A;  2N1V A;  2V3S A;  2GMI C;  1TTN A;  4MDK E;  2NPT A;  3X0W A;  2LXC A;  4LJP B;  5D6J B;  3ML8 A;  2O2V B;  2G4S A;  4W9C A;  2MX2 A;  1WIA A;  2DYB A;  4KVG B;  4DHJ B;  2WWZ A;  3VTV A;  3MHS D;  3DBL I;  3VUY A;  3DVG Y;  3NOB A;  4IWO A;  2L0F A;  3V61 A;  2MW5 A;  2L00 B;  2IYD B;  2HJ8 A;  3W1S C;  1TBE A;  2CU1 A;  1VD2 A;  3KW5 B;  5TR5 A;  3RZW C;  5CHW A;  4IG7 B;  3WAM A;  5AZF A;  4G0N B;  1P3Q U;  4I6N B;  2KHW B;  2UWQ A;  4KSL C;  4WWO A;  2J7Q B;  3R3M A;  5CTR C;  2KX3 A;  2LI5 A;  2BYF A;  3RYT A;  2ZNV B;  2HD5 B;  3U30 A;  3PRE A;  1AAR A;  1JRU A;  1S1Q B;  4B9K A;  3WAN A;  3P2B A;  1WZ3 A;  1TGZ B;  2NR2 A;  2IO3 B;  4FHK A;  3L0W B;  4FAD A;  2K8H A;  5L95 C;  1SIF A;  4E74 A;  2WYQ A;  2EMT A;  3ZRF A;  4F8C B;  2JZ3 B;  2MP2 B;  2J0K A;  4II3 B;  3U8Z A;  2EMS A;  2D10 A;  2XK5 B;  2MBH A;  3A33 B;  3QHT A;  4WWN A;  2RD0 A;  1R4N I;  3DVG X;  1Q5W B;  2JF5 A;  4ZRI A;  2D11 A;  2O6V A;  1WYW B;  3R7R A;  2LZ6 A;  2L7R A;  2KFK A;  2GBN A;  2BYE A;  1HE8 A;  2Z59 B;  1LQB A;  5JHB A;  4IM0 A;  3D32 A;  1SE9 A;  2M1M A;  3KUZ A;  4MH0 E;  3QX1 A;  3TBL D;  2LJ5 A;  2MQJ A;  3DBS A;  3QAR A;  2ZNV C;  3NS8 A;  4URK A;  4KZ0 A;  1TZ1 A;  1YX5 B;  1M94 A;  3HM3 A;  3N32 A;  3PRZ A;  3SHQ A;  4K1R B;  2A4Z A;  4LDT D;  3ZNG C;  2WDT B;  4WAA A;  4F7Z A;  3LDZ E;  4EEW A;  2MBQ A;  3ZNI D;  2KKC A;  4GB9 A;  4WQO B;  2KTR B;  1WJ6 A;  3PPA A;  2DYM A;  2XEW A;  3B0A A;  2KMC A;  2PEA A;  3VFK A;  3ZO5 B;  2JWZ A;  3VUX A;  2JPH A;  1E90 A;  3TIX A;  5DCN A;  1L7Y A;  1ISN A;  1A5R A;  1EUV B;  2AYO B;  3IFW B;  1LXD A;  1IYF A;  3KYD D;  2FCQ A;  3W1Y A;  4K7U A;  2NPT B;  4AJW A;  2KNB A;  3APC A;  2IO0 B;  4MGI E;  4HJK A;  2KO3 A;  1P1A A;  2FAZ A;  5C23 A;  1XD3 B;  2V4L A;  3LJ3 A;  3Q3F A;  4GDK A;  1V9J A;  2PPH A;  4P7I A;  4PYZ A;  3ML9 A;  3WAP A;  5HKH A;  4I6L B;  1Q0W B;  3VAW A;  1VCB A;  2C7M B;  2CKH B;  2JXX A;  4PYU A;  3VTU A;  2KK8 A;  2KWV B;  5CHV C;  4MGK E;  3U7D A;  1QZE A;  2HTH A;  4FJY A;  2MBE A;  3EEC A;  5KHO A;  2N9P C;  3TL5 A;  4FJZ A;  3DVN U;  2KDE B;  3QCA A;  4ANW A;  2KMA A;  4NJ6 A;  4W9H A;  5EDS A;  3RT3 B;  4ASW C;  4M0W B;  4A20 A;  2N1W A;  2KN5 A;  4G11 A;  4BVU C;  4JIO U;  3ENE A;  4W9D A;  3SD5 A;  3HM6 X;  3ZDT A;  1YX6 B;  3AXC A;  4MM3 A;  1V86 A;  3N3K B;  2NS5 A;  3VHT C;  2C7N B;  1J0G A;  3V6E B;  4HVB A;  3VDZ A;  4G3X B;  1WI0 A;  4LJO B;  5D94 A;  2JZZ A;  4W9I A;  2BWE S;  3W1S A;  2KAN A;  4AUQ C;  2AWT A;  2BYV E;  3PRP B;  2K6D B;  4E71 A;  3V60 A;  4DBG A;  1WGG A;  2KDF B;  3MTN B;  4K7S A;  2IBI B;  3RD2 A;  3H7P A;  2ZPN A;  1YJ1 A;  1ZW7 A;  3A9J A;  4IC7 B;  3ZKJ C;  4BBN C;  3IVF A;  4BOS C;  4K7W A;  3V62 A;  5AEK B;  2MWS B;  4YL8 A;  4B95 A;  1V2Y A;  3QAQ A;  3EHV A;  4XX5 A;  2ZVO A;  4W9E A;  3M63 B;  2KFK B;  2VRR B;  2J0M A;  4IM2 A;  2G3Q B;  1GNU A;  4KIK B;  3ZUN A;  4TKN A;  3X23 A;  2GBM A;  1NBF C;  1WXM A;  3H1U A;  5GMV A;  3BIN A;  4DWF A;  2GBJ A;  3ZTD A;  1SGH A;  1WJU A;  3QQ8 B;  5AZG A;  4DDG D;  3QC8 B;  3AU5 A;  3OJ3 A;  2ZJD A;  4TQ1 A;  2R2O A;  2M8S A;  4E3C A;  5E6O A;  2GBR A;  2L8J A;  4MJS B;  3A1Q B;  4NAW B;  1OEY A;  2XK5 A;  5E6P A;  1P9D U;  2LGD A;  2LUE A;  4OVV A;  4BKT A;  4EKU A;  3A9K A;  3O65 B;  4ANV A;  3DOW A;  2D3G A;  4IW0 A;  4RMA A;  3ZTC A;  2MBB B;  1V6E A;  1WXA A;  3ZVV A;  2Z0D B;  2N9E B;  3K9O B;  4M8M A;  3PRM B;  4GDL A;  4ANX A;  4DHJ D;  1WGD A;  3DDC B;  5CX3 A;  1RRB A;  2BF8 B;  2UYZ B;  3AU4 A;  3DCG A;  4HWI B;  5IA7 A;  4GN1 A;  4J6I A;  1UEL A;  1RFA A;  5J2R A;  2L05 A;  4FHJ A;  5J18 A;  3UIN B;  2YLM A;  3ZRC A;  2N7E A;  4TQ0 A;  1BT0 A;  2B3A A;  2KWU B;  2FCS A;  1GC6 A;  3T8M A;  2DZI A;  2D2Q A;  4N9F 4;  2C60 A;  1LFD A;  2REX A;  4GU2 A;  5LXI B;  2LGY A;  2KLC A;  2LAS A;  2QHO A;  1GUA B;  1WGR A;  4M8N A;  3UIP B;  4BFR A;  4EZJ A;  2Y5B B;  3VXW A;  4G50 A;  3PV1 A;  4HPM B;  4BKS A;  2O2V A;  3AUL A;  2L3Z A;  1E5W A;  4GGQ A;  3PZD A;  3QK0 A;  3TCA A;  4AP4 C;  2R2Q A;  3A1Q A;  4GDK B;  2ZCB A;  3IG3 A;  1KM7 A;  1WX7 A;  2BGF A;  2MLB A;  2O6V D;  3L13 A;  4NPN A;  1IPG A;  1MG8 A;  1D3Z A;  3N30 A;  2JRI B;  2KC1 A;  2NBU A;  1F9J A;  2WX1 A;  3PLV A;  3QWZ B;  1ZKH A;  4HXD A;  2CHZ A;  5G55 A;  3EFU A;  1EO6 A;  4PS8 A;  1WZ0 A;  1G6J A;  2KJH B;  2ZPY A;  1P98 A;  2ZCC A;  4PS3 A;  2I1J A;  3DVN V;  4K81 A;  2KFJ A;  1WX8 A;  1I35 A;  1V49 A;  5D2M B;  3ZLZ A;  2KTR A;  3ZIM A;  4W9F A;  3APF A;  5DPW A;  4KSK C;  3R7Q A;  1T0Y A;  1OEY J;  1X1M A;  1YD8 U;  3JW0 X;  1WE6 A;  2NBW B;  3WIM A;  2DYO A;  4IWP A;  5DPS A;  3H7S A;  5E6N A;  2JVC A;  2BKR B;  4WWP A;  4DHZ E;  1WF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...