2ZVOA

Nemo cozi domain in complex with diubiquitin in c2 space group
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
SMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/signaling protein
molecule keywords UBC protein
total genus 43
structure length 149
sequence length 149
chains with identical sequence G
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvoA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zvoA01
4NAWA 1D3ZA 4M8NA 2G3QB 1WE7A 2DX5B 1T0YA 2KFKB 3A4SC 3NZSA 3V60A 5JH5C 1V80A 3KUZA 1U4AA 2L8JA 3SHQA 3PRMB 2KFKA 1GG3A 4DBGA 4EZJA 1G6JA 1IPGA 3SU8X 3A1QA 3WALA 5CHFA 1WMHB 2AWTA 3AU4A 4B6WA 2BWFA 3U7DA 3TMPB 1Z2MA 2R2QA 4LJPB 5J2RA 2ZPYA 4MSQB 3U8ZA 1SE9A 4IW0A 1WXMA 3A4RA 2KC1A 1GJZA 3IFWB 3V6EB 3AU5A 1WJNA 4F8CB 4JGHB 3ZO5B 5IA7A 2HE7A 2LZ6A 3ZDTA 1C3TA 4EEWA 4B95A 4WWPA 4GMVA 2I1JA 5KHQA 3VTVA 4GIVA 3PVLA 1OEYJ 2ZVNA 4K1RB 2AYOB 2PJHA 4WAAA 2KN5A 4MSMB 2CR5A 4GDKA 4YL8A 4KZCA 1WGHA 3KH0A 5D6JB 2WX1A 1NBFC 4AJYB 1WGYA 3KUDB 4W9GA 3R7RA 1WRDB 2O6VD 3MHSD 4GDKB 2MBQA 3QJZA 4KSKC 4E3CA 2CHWA 2MP2B 4IUMB 2UYZB 3AI5A 1P98A 1A5RA 4PS8A 1WF9A 1WM2A 3MTNB 4NJ7A 4LDTD 3IHPC 3RZWC 3OJ4B 4KV2A 5AZFA 2DAFA 3ZDMC 4BBNC 3JSVB 3QCAA 3B1LX 4X57B 1C1YB 3WAMA 3WAOA 2C5LC 3M63B 3Q3FA 2FCQA 5G2NA 4G11A 3ZVVA 3H1UA 3UF8A 4K7UA 3PRPB 2V4LA 3ZNZB 2D3GA 2M0XA 2REXA 2MSED 4I6LB 4IWOA 2GBJA 3ZLZA 4G3XB 1KOTA 1WR6E 4W9HA 4HJKA 2I1KA 1VD2A 3ZKJC 2ZEQA 2LXAA 3C0RB 2JPHA 4ZRIA 1E8ZA 3X0WA 1Q0WB 1RAXA 5HKHA 4WJNA 4FULA 2FCMA 2N9PC 3HIZA 2KLCA 3QX1A 4MGYE 1X1MA 2N7EA 2L7RA 1YX5B 3A1QB 3DVNV 4IM3A 4ICVA 4DDID 1KJTA 5E6OA 1L2NA 3W1SA 2LJ5A 1UBQA 4TV3A 2BF8B 2G4DB 4GOCA 3V61A 4TQ1A 1M94A 4N9F4 1XT9B 2CU1A 2DENB 3PT2B 3OLMD 5IAAC 4HLEA 1GC7A 4NY0A 5G55A 1R4NI 1WJ4A 3ECIA 3VH4B 1ZKHA 2BYVE 3U30A 2IZVB 1H4RA 2EMSA 2N9XA 3K9OB 3S2AA 4ZRKA 1IYFA 2MBBB 3PV1A 3X23A 3PTFC 4ANVA 2KLGA 3BY4B 4FHJA 2FCNA 4K7WA 2KTFA 2LI5A 4W9CA 4ZYNA 1YIWA 3WA0A 1OGWA 3ZUNA 1ISNA 1CMXB 2DYOA 2J0JA 1JRUA 3QK0A 2RD0A 5LXHA 2LGYA 3W1YA 1WGDA 4W9IA 2AL3A 2KO3A 4DHJB 2BPSA 5CHVC 3B0AA 1KM7A 2L3ZA 4CHKA 2NCNA 3H7PA 1RFAA 2GBNA 4NNJB 3RULA 1Y8RC 3ONSA 5TR5A 3VTWA 1K8RB 2OJRA 3L08A 3PGEA 4IM2A 3EC8A 4AJWA 1V9JA 3VUYA 4W9JA 4A20A 2JF5A 2JRIB 3H7PB 1LFDA 1YQBA 4EKUA 2IY1B 3N3KB 4HWIB 3HM3A 1UELA 4K81A 1J19A 1XQQA 2YVCA 2KD0A 2K6DB 4IG7B 5CTRC 2LRWA 2KXJA 2LVPA 2IY0B 4RMAA 2KHWB 2LVQA 3A9JB 4K7SA 1BT0A 2KK8A 4PYUA 1ZGUB 4BKTA 2BWES 1E8XA 2MWSB 3L17A 3M62B 5DCNA 4EZKA 2M4NA 4WJPA 3KW5B 2LASA 1NI2A 1MG8A 3ZNID 3ZRFA 3HM6X 3ALBA 2G4SA 3JVZX 1ZW7A 2KVRA 1WXSA 3M95A 4OVUA 5CHWA 1EF1A 3ZTCA 1GC6A 3KVFB 2D07B 2FCSA 3UGBB 4ZRJA 2FIDA 2K8HA 2ZZPB 3T9LA 3CF6E 1WMHA 4GSWA 2DHZA 3IBEA 5E6PA 4BKSD 2C7HA 2PE6B 2J0MA 3PSEB 2D2QA 2KOXA 2HTHA 3OAWA 4TQ0A 4MJSB 3SD5A 4KSLC 1LM8B 2MRPA 2UWQA 1I42A 2C7NB 5FR6A 2KWUB 2N7DA 3UIPB 2ZNVB 4GU2A 3NZUA 4PS7A 2WX0A 4ANUA 2A4ZA 4FBJB 4MJSA 2KMAA 1P1AA 2KWCA 4MGZE 4HK2A 1TTNA 2RSUA 4KIKA 1WFYA 2DAJA 2IO3B 3DBLI 3L16A 3NHEB 2GOWA 3V62A 2NBVB 5DPSA 2KJ6A 4DK5A 4EUTA 4KDLB 2PEAA 1YD8U 2L0TA 2Y5BB 2B3AA 5KHOA 3QAQA 5DPRA 2MLBA 2YLMA 3TJPA 4HDOA 4WQOB 3KYCD 3NOBA 2CHXA 4FHKA 4HPLB 3A33B 4I6PA 2BYEA 5D7GA 1YJ1A 2MBOA 4FJYA 5BO4B 3R7QA 3DVNU 2BKRB 1WX9A 1VCBA 1P9DU 2KNBA 2JRHA 3NS8A 2N9EB 3DCGA 4AWJA 1E8WA 4ICUA 3WIMA 4PYZA 2L0FA 3GOEA 4MH0E 2KANA 2NPTA 2FIFA 1WX7A 1WM3A 4FJVB 3T8MA 1H8CA 2XEWA 4A3PA 2KJHB 1RLFA 2KDBA 1TGZB 3EECA 3VUXA 4HVBA 2KFJA 4WWNA 1I35A 3JYUA 2PE9A 1S3SG 2K6QA 4FJZA 4ASWC 3DVGY 3A9JA 1WX8A 4WJQA 2OOBB 5E6NA 1V5OA 2BGFA 2FAZA 1WR1A 2LRUA 3VQIA 4JQWC 1E7VA 2BYFA 3LDZE 2MQJA 3H6NA 2GMIC 4JIOU 4XZ4A 1P3QU 2K25A 4DHJD 2LXCA 3EFUA 3DPDA 2MX2A 4KVGB 3I3TB 1J8CA 4MEMA 2ZVOA 3B08A 3MJWA 1V81A 2C9WB 2RR9A 3RUIB 1V86A 5JHAA 1OQYA 2NS5A 5DPWA 2PPHA 4TKNA 2MBEA 5LLIA 2K1FA 2DZIA 3APDA 5AZGA 5AEKB 3N30A 5JZEB 4MGIE 4LJOB 3CMMB 1RRBA 1Q5WB 2J0KA 2RPQA 2ZJDA 3Q3JA 4MM3A 4WJOA 5C23A 5AZHA 2JXXA 1LXDA 3UINB 4HDQA 4NQLB 4FLHA 3HK0A 1GNUA 3PHWB 3PS6A 3DQVA 4PS3A 4DWFA 2KMCA 5C1ZA 3IVFA 4B9KA 3UIOB 3KYDD 2WYQA 3ZW3A 4NPNA 1NDDA 3WANA 3ML8A 2DYBA 1E8YA 3QARA 4BOSC 2M8SA 5JHBA 4DHZB 1WXVA 5L95C 1WZ3A 2KQSA 3CSFA 2LWPA 1UH6A 3PZDA 2CS4A 2KTRA 3DBSA 2XK5B 2NBWB 2RGFA 1TZ1A 2MA9B 3L0WB 2DZJA 4KZ0A 1WYWB 2KQ7A 1YX6B 3JW0X 4M8MA 2KTRB 5CX3A 3R3MA 2JT4B 3W1SC 4BFRA 3NY5A 4TUUA 2O6VA 4FADA 2JVCA 2GBRA 1E5WA 1UZXB 3QIJA 4JLCA 4BOZB 2WWZA 4FA6A 4W9FA 3UQAA 4FN2A 2K8CA 1TBEA 4W9KA 3ZRCA 2M17A 2KZRA 2KDIA 4HXDA 2KC2A 2AL6A 4II3B 1OEYA 2ZCBA 4URKA 1Q1OA 3N32A 4II2B 2KWVB 4DDGD 4F1SA 1WJ6A 1R4MI 3HHMA 1HE8A 1QZEA 3VAWA 4GB9A 1WIAA 1V49A 4HCNB 4G50A 1LQBA 2CHZA 4NJ6A 2AEHA 3M3JA 4RM8A 5D94A 2FNJB 4MDKE 2NR2A 3TIXA 3L13A 4EOYA 4IC7B 4IM0A 4A3OA 1XD3B 1EUVB 1F9JA 2ASQA 4BVUC 4GDLB 1PQSA 2D10A 4E71A 4ANXA 2HJ8A 3LJ3A 5DPTA 2Z0DB 2L05A 4G0NB 4OVVA 3V6CB 1WGGA 4EZLA 3QHTA 4GDLA 2NVUI 1S1QB 2GBMA 2JZZA 2Z59B 4ANWA 3ML9A 1WXAA 3A9KB 3EHVA 1WH3A 4KIKB 2IO2B 1WY8A 4RM9A 4KDIC 2KKCA 3QC8B 3AXCA 3ZIMA 2K8BA 1WI0A 2DZKA 5LXIB 4NAWB 1V2YA 3UQBA 1WJUA 3QWZB 3VXWA 2MBHA 3DVGX 4CYEA 2IBIB 2IO1B 2EKEC 2N1WA 2VRRB 2LGXA 3RD2A 1P0RA 2V3SA 2JUOA 3TBLD 2ZNVC 4E74A 4IWPA 1V6EA 3WAPA 3O65B 2C60A 2LD9A 1J0GA 4F7ZA 3RZFA 3L54A 3P2BA 4EFOA 4DHZE 4NQKE 5GMVA 4AP4C 1AARA 1Z5SB 4AOFA 3VH3B 4DXAB 2L00B 4XX5A 4W9EA 2LVOA 2O2VA 2KDFB 2R2OA 2DYMA 2XK5A 3K9PB 4MELA 3ZNGC 2NPTB 2J7QB 2G45B 1GUAB 3TCAA 2XBBC 1EO6A 4IWQA 3DDCB 2WDTB 3PRZA 4HPMB 3RT3B 2KJRA 3ZNHB 4BKGA 5L83A 2O2VB 3PPAA 2BKFA 1SGHA 2JWZA 2L76A 2N4FA 3APCA 3RCZA 2O6VB 3APFA 3BINA 3ZTDA 2FUHB 3DOWA 4J6IA 1WZ0A 3ENEA 4AUQC 4GXBA 2V1YA 2IYDB 3SDLC 3DBRI 3IG3A 5D2MB 1UGMA 2QHOA 1UD7A 5EDSA 5J18A 3VUWA 4CO7A 2JY6A 2K39A 4ZDVA 2KDEB 4LDTB 4P7IA 2MCNB 1L7YA 4WWOA 3L10B 3OJ3A 3PREA 4M0WB 2MP2A 2HD5B 3QA8A 3AULA 1UBIA 2N1VA 2IO0B 4I6NB 1SIFA 4W9LA 3VHTC 1E90A 3PLVA 2A5UA 3VTUA 3CSTA 2D11A 3H9DA 3R66C 3KUCB 3VVWB 4LCDE 2ZPNA 4GN1A 3RYTA 1OTRB 1WGRA 3VDZA 3JSVA 2M1MA 3PLUA 2NBUA 1E7UA 2JZ3B 4BKSA 4HCPB 4JL9A 1KLVA 1WE6A 3TL5A 2LUEA 3H7SA 4XC2A 2KX0A 2C7MB 3VFKA 2KX3A 2Z0EB 2ZCCA 3D32A 2CKHB 3QQ8B 4GGQA 2LGDA 2EMTA 2MW5A 4MGKE 2W9NA 1EF5A 4W9DA 3A9KA 2GBKA 1V5TA 3PHXB 3GZNI 4BBNF 1IP9A 3DBHI 1FXTB 5J17A 2DZMA
chains in the Genus database with same CATH superfamily
1D3ZA 4M8NA 1TS3A 2G3QB 2DLBA 3V60A 3AEAB 1IBXA 4PT5A 2KFKA 4XE0A 4GLSC 3SU8X 2AWTA 2XN9C 3Q8CA 2V3NA 2BWFA 3U7DA 2R2QA 3MP9A 2KC1A 1CZPA 3AU5A 4F8CB 4JGHB 5BYRA 2HE7A 1C3TA 4B95A 4WWPA 2PMVA 1WXQA 3PVLA 3GE3C 2KDMA 4LNFA 4KGTA 4YL8A 1NBFC 1T3QA 3P4PB 4YXDB 3R7RA 1WRDB 3MHSD 4GDKB 5C3JB 4N59A 2MP2B 1WF9A 2PKOA 3IHPC 2BS4B 1PYWD 2DAFA 3ZDMC 3B1LX 1T0SC 1C1YB 3NG0A 2C5LC 2FCQA 3ZVVA 3UF8A 3PRPB 2E3TA 1P7FA 2REXA 3HVZA 1SE3A 4IWOA 1KTKA 3ZLZA 3U7ZA 1J7AA 2MJDA 3ZQ4A 3C0RB 4YT0B 2JPHA 3AE6B 2IJ0A 3RMKC 3LXFA 1Q0WB 1Q10A 3U2SC 2KLCA 2EELA 3DVNV 4IM3A 1I4QA 4GOCA 1AYFA 3IT6B 4TQ1A 1M94A 3NS1A 1XT9B 3TEXA 1F2RC 4QAYA 4HLEA 4HPPA 5G55A 2JQRB 1WJ4A 3U30A 2IZVB 3Q8BA 5H8YE 2I2YA 4A8XC 3PTFC 2J4XA 2X8XX 4S0RA 2KTFA 4ZYNA 4TSSA 4XDDA 1V8CA 3E56A 2LGYA 1FIQA 2AL3A 3IAS1 1R7SA 2BPSA 2NCNA 3C8YA 3VTWA 3L08A 4ZHOA 4AJWA 3VUYA 2JYTA 4W9JA 1YQBA 4EKUA 2IY1B 4K81A 4DQOC 1XQQA 2HJ1A 2LVPA 2IY0B 1BT0A 4LNNA 5T8IA 2WXFA 1N60A 1YNTE 2M4NA 3HRDD 3ZRFA 1GPXA 2G4SA 4E71A 1ZW7A 2KVRA 4A9AA 4ACFA 1XCTL 4ZHPA 2FCSA 4ZRJA 2K8HA 3CF6E 1WMHA 4BKSD 2C7HA 3PSEB 1ET6A 1MHHE 4P1CC 2HTHA 4ARIA 1MFWA 1I42A 2XNAC 2ZNVB 4GU2A 4PS7A 4FBJB 1MPEA 2KMAA 1P1AA 4HK2A 2RSUA 2IO3B 3AEDB 1EU4A 1PGBA 5DPSA 4DK5A 4EUTA 2PEAA 2Y5BB 2B3AA 1L0XB 2MLBA 3KYCD 3NOBA 4FHKA 3AM9A 2K3UA 1TY0A 2MBOA 3R7QA 1VLBA 1WX9A 1VCBA 1YMHE 2GI9A 1C78A 1MJDA 2TSSA 5IKCM 4AWJA 1ENFA 2L83A 2KYWA 2BS3B 4MACA 3BVGA 4YSYB 1T5XD 4RCOA 2XEWA 1XLPA 2BS2B 3Q6BA 2DBYA 1C76A 2Z8LA 2DWQA 4WWNA 2PE9A 1I4XA 3DVGY 2OOBB 5E6NA 1V5OA 2BGFA 4MT5A 1F2RI 3VQIA 3TEWA 3ZYYX 1E7VA 2GMIC 4JIOU 1P3QU 3W9CB 2LXCA 3EFUA 3DWMA 2ZVOA 3B08A 2BB6A 4A55A 2B76B 5DPWA 3GZNB 5BMHA 2MBEA 2V9HA 3APDA 4C56C 5AEKB 5JZEB 2WXPA 5GMVA 1RRBA 2J0KA 1MI0A 4JE3B 3AEGB 5AZHA 4FLHA 3HK0A 3PHWB 4PS3A 4DWFA 2KMCA 5C1ZA 4B9KA 3UIOB 3I57A 5BYSA 4L23A 3ZW3A 5AUKA 1D5MC 3NVWA 1VJKA 2DYBA 3ML8A 3QARA 4P6VF 5FKAC 2LWPA 4C80A 3PZDA 2CS4A 2KTRA 2XK5B 2NBWB 1TZ1A 4KZ0A 3W1SC 3NY5A 4A90A 1Y56A 2JVCA 1F0ZA 1UZXB 4BOZB 4FA6A 3UQAA 1OQQA 5AUIA 1SIJA 2KDIA 3Q8FA 4HKQA 2AL6A 3DHHC 4II3B 2ZCBA 1YJJA 1Q1OA 1HXYD 1L6VA 4ARCA 1I4PA 1HE8A 2OHFA 3MC8A 1TIFA 3OG5A 3U4EG 1KH0A 4N6EB 5D94A 3TIXA 2NR2A 4IM0A 4A3OA 2WU2B 1EUVB 4GDLB 1PQSA 2V0GA 4XYCA 4ANXA 3LJ3A 5DPTA 2Z0DB 3AEFB 4RNAA 1S1QB 3V05A 1WXAA 1ZPSA 4C00A 1MG4A 2KKCA 2K8BA 2VH1A 1D5XC 4NAWB 3N1XC 3DVGX 4CYEA 2Y3AA 2IBIB 3GE8C 1EWCA 1K51A 2JYEA 1N5XA 2JU6X 5HFYA 3I63C 4AP4C 2L00B 4W9EA 2O2VA 2XK5A 4MELA 3ZNGC 2NPTB 3TCAA 2JZPA 3PRZA 5L83A 2KJRA 4BKGA 3PPAA 2BKFA 2WXGA 3Q3NC 3APFA 3BINA 3ZTDA 2FUHB 4B0EA 4J6IA 1JQ4A 2QJLA 5D2MB 2IGHA 1AW7A 1HA5A 2QHOA 1UD7A 5EDSA 4CO7A 2I38A 5IOIA 1HEZE 2KDEB 1L7YA 1NEKB 1EWYC 2HD5B 2QCZA 3QA8A 1FCLA 1ZXHA 2BQQA 1SIFA 2INDC 1J7BA 3CSTA 3H9DA 3VVWB 1I4RA 1OTRB 3JSVA 4MM3B 2NBUA 3EA6A 1NI3A 2JZ3B 2PLPA 2QSDA 1PGXA 2LUEA 2KX0A 2INCC 2Z0EB 2J53A 2Y5PA 3GZNI 5J17A 2CJNA 5D3IB 2INNE 4NAWA 3AE5B 1WE7A 2DX5B 2KFKB 3NZSA 1V80A 2OEDA 4DBGA 4P16A 3AU4A 1UWXA 2YEPB 4B0MA 2J52A 4IW0A 3IFWB 3V6EB 1WJNA 3ZO5B 2W3SA 4WAFA 3BK1A 4JX1C 2I1JA 2JX5A 3VTVA 4GIVA 1DOIA 1JMLA 2PJHA 4MSMB 1FFUA 4GDKA 4KZCA 3KH0A 1AWDA 2SEBD 4W9GA 2O6VD 2MBQA 3C19A 3U52E 1PDXA 4IUMB 3BWUD 2KT7A 4C7YA 4AS1A 1A5RA 1BXTA 3MTNB 4LDTD 2G1EA 3OJ4B 4BBNC 3JSVB 1I4HA 2KVZA 3WAOA 4C7ZA 3Q3FA 5G2NA 3H1UA 3FAHA 2V4LA 3ZNZB 4KGRA 2M0XA 3TSSA 4YTMB 3VRBB 4G3XB 1WR6E 1UUPA 1E10A 4W9HA 4HJKA 1VD2A 2ZEQA 1UWMA 1HTQA 3I5JC 1YJIA 1F77A 4WJNA 1UGJA 4ITKA 5E6OA 4RGTA 4N9F4 2DENB 3HVDA 3OLMD 1GC7A 2N9KA 1ZXIA 3GS2A 1R4NI 1LO5D 4M0WA 3FKYA 5EE9A 2ACZB 3S2AA 2MBBB 3PV1A 4ANVA 1JWBD 3BY4B 2L1AA 2FCNA 4K7WA 1YQ4B 3EFCA 3P4RB 5C2TB 1CMXB 1OQRA 4D2KA 4KKIA 3QK0A 5D3DA 1R4MB 3ETRA 1JROA 1WGDA 4W9IA 4DHJB 3CWIA 3B0AA 4CHKA 4LLGM 2GBNA 3RULA 1TZOA 2LUMA 3HUIA 4IM2A 3EC8A 2JF5A 3H7PB 1ZE3D 1ZDVA 3HM3A 1UELA 3RNEC 3KWVA 1VRAB 2KXJA 2KHWB 4K7SA 1DYQA 3IXSA 2BWES 2WDVB 3BYYB 3M62B 4EZKA 1IBXB 2V3PA 3P4SB 1QT9A 3ALBA 3JVZX 1CQVA 3M95A 3ZTCA 4OVZA 3KVFB 3NVVA 5HHDG 2FIDA 2ZZPB 4CQNA 4GSWA 5E6PA 3IBEA 3I9V1 2PE6B 2J0MA 4WQMA 3OAWA 4RGNA 1LM8B 3EUB2 2WX0A 4ANUA 2L52A 3T3NA 1TTNA 1WFYA 2DAJA 1P7EA 3L16A 3NHEB 3V62A 2KQ4X 2LFIA 1YD8U 2LGIA 2KWDA 3QAQA 2YLMA 1UF0A 2CHXA 4HPLB 5D7GA 1YJ1A 1KF6B 4FJYA 3BYTB 3DVNU 2BKRB 4YWGG 2KNBA 1KLUD 3FC4A 2PW9A 1XLNA 4ICUA 2L0FA 3GOEA 2KANA 1WX7A 3T8MA 3FILA 3DHGC 1RLFA 3VUXA 1HQRD 1L5PA 1S3SG 4ASWC 1QQRA 4WJQA 1N61A 2FAZA 1ESFA 2MQJA 1TKEA 2MX2A 3I3TB 1J8CA 3MJWA 1FM0D 3RUIB 2AQ3B 1F1HA 1QOBA 1C9FA 1OQYA 2NS5A 2PPHA 4TKNA 5LLIA 2K1FA 2DZIA 2INPE 5AZGA 2RDBC 1XXGA 1TT5B 4RF1A 4MGIE 1RYJA 3WANA 1JALA 5C23A 2RPQA 1YN3A 2GRIA 3UINB 1LXDA 4HDQA 1FNUA 1L0VB 3PS6A 2WYQA 2GLSA 4NPNA 2CJOA 4BOSC 1XO3A 2KQSA 1CJEA 1XF5L 4MH8A 3TUOA 2RGFA 2M19A 2KQ7A 1YX6B 3DBLB 3Q8AA 3R3MA 2AQ1B 2JT4B 4TUUA 2O6VA 1E5WA 4JLCA 3QIJA 3ZRCA 2M17A 1R4NB 1JW9D 1QOFA 2KC2A 4XDCA 1FNVA 4URKA 2R61A 1RM6C 2WGSA 1FRRA 1FEHA 2W55A 3N20C 3FILB 1D4BA 1R4MI 3HHMA 2D3CA 4GB9A 1V49A 4HCNB 4G50A 2CHZA 1HZ6A 4MDKE 3L13A 4IC7B 2ASQA 2D10A 2W82A 4IDIA 1SE4A 1WGGA 2NVUI 1WYGA 3ML9A 3EHVA 3A9KB 3WCQA 1WH3A 4KIKB 4RM9A 3ZIMA 1VDVA 2DZKA 5LXIB 1V2YA 2QDFA 3VXWA 2IO1B 2EKEC 1P0RA 2JUOA 2ZNVC 4DXGA 1YOVB 1TYGB 3WAPA 2C60A 4F7ZA 3IT4B 3L54A 3P2BA 4NQKE 3CIRB 2R2OA 2DYMA 3B2GA 1JRPA 2WXRA 4HPMB 2BVCA 4HRSA 1SXTA 2L76A 1IUEA 2Q5WD 2O6VB 3AH7A 2N0SB 3SDLC 5G5HA 2H89B 5J18A 4ZDVA 4P7IA 3URYA 4FXCA 3OJ3A 5G5GA 3PREA 1D5ZC 1UBIA 2N1VA 2X38A 1EU3A 4I6NB 1T0QC 4W9LA 3VHTC 3VTUA 2D11A 3R66C 3E9SA 4LTUA 3ZXVA 4HCPB 1NYQA 2LHEA 3H7SA 1C4CA 4YSZB 2KX3A 1C4PA 2ZCCA 3QQ8B 1AN8A 2EMTA 1STEA 1V1OA 2AX5A 4OZAA 1EF5A 4WIPA 3ZXRA 1ZOYB 2MH7A 2QIEB 1KFYB 1T0YA 3A4SC 5JH5C 1HTOA 2L8JA 3DBRB 1G6JA 4AQ7A 1DOYA 3A1QA 1WMHB 4RGOS 4YSXB 3TMPB 1Z2MA 5J2RA 2ZPYA 1SE9A 1WXMA 1TJEA 5IA7A 4HEA1 5EE0A 1N5WA 2IGDA 4EEWA 5KHQA 2JXTA 2PIAA 3R2IA 4WAAA 3BK2A 2CR5A 1FXAA 1D6EC 5IP4D 1SF0A 2WX1A 4AJYB 3SEBA 3QJZA 4KSKC 2WXKA 3MC0B 5EE3A 3P42A 2WDRB 2UYZB 3AI5A 5E6JA 1KRHA 3RZWC 2PVGC 5BMIA 1L6UA 1ACCA 1ZP0B 4X57B 3ZJUA 1FMAD 2CU3A 2MJEA 4G11A 4K7UA 2PVOD 1LGRA 4ZRPA 2ICIA 4I6LB 2WXOA 2GBJA 1HZ5A 1KOTA 3KQ4A 3PO0A 1E8ZA 1BUIC 1RAXA 1E9MA 2N9PC 2D3AA 3HIZA 1FFVA 3QX1A 2LJIA 4MGYE 2N7EA 1EM7A 2VZKB 1YX5B 3A1QB 2IDYA 4ICVA 1TKYA 3W1SA 2LJ5A 4TV3A 2PTLA 2CU1A 2WXMA 3RN9C 2WHIA 4NY0A 3ECIA 3VH4B 1ZKHA 2BYVE 1XLQA 2N9XA 3P1MA 3PZ7A 2KLGA 4FHJA 1FXIA 1A70A 3ZUNA 2LI5A 2IPKD 1YIWA 3WA0A 1ISNA 1JRUA 5LXHA 1WRIA 4LNKA 2KO3A 5CHVC 1KM7A 2L3ZA 2SAKA 4HROA 3H7PA 1Y8RC 5TR5A 1K8RB 1V1PB 4WH4A 2JRIB 4IOIE 3N3KB 5CTRC 4IG7B 4RMAA 2LVQA 3A9JB 1C77A 1QOGA 4PYUA 4BKTA 1T6BX 2MWSB 3KW5B 1NI2A 3HM6X 1TS5A 2JSVX 2V4IB 1J7CA 1GC6A 1V97A 3BVZA 2D07B 2M0AA 2BB5A 1XEEA 1GB4A 3T9LA 2QILA 2D2QA 2KOXA 4US9A 3GB1A 1TY2A 3SD5A 4KSLC 4TQ0A 1WGKA 2C7NB 1QOAA 5EE1A 4MJSA 1NENB 2KWCA 2RPVA 2NBVB 2KJ6A 4KDLB 4C4VB 4OHJA 2KACA 3B9JA 1N6ZA 4I6PA 2BYEA 2D5GA 2LMCA 4JPSA 4RGMA 1XLOA 2JRHA 2N9EB 3DCGA 3WIMA 4PYZA 4MH0E 2NPTA 3Q2AC 4FJVB 1H8CA 3OWEB 3SFDB 2KJHB 2KDBA 2WXHA 3EECA 3RNBC 4HVBA 4P1BC 1I35A 5IO9A 4FJZA 3A9JA 1WX8A 3DWGC 1WR1A 1XCQL 4JWUC 4JQWC 2LGSA 2BYFA 4YTPB 1C79A 4M00A 2K25A 4DHJD 1JWMD 2ZW0A 4MEMA 4US8A 2C9WB 2H88B 2W54A 2RR9A 1SBBB 5JHAA 1FRDA 4KGSA 1NYRA 3N30A 3NRZA 4LJOB 3CMMB 4WJOA 2ZJDA 4MM3A 1TKGA 2RDHA 3BVMA 1GNUA 3DQVA 3VR9B 3O13A 3KYDD 2FUG1 4C4VA 2JWUA 3RI7C 1DOXA 1TS2A 5JHBA 4DHZB 1WXVA 5L95C 4L2YA 1WZ3A 3BIID 4OZBA 3DBSA 3L0WB 3AN1A 1WYWB 3JW0X 4M8MA 2LEKA 2WXJA 3Q3MC 1E0ZA 2E6XA 1M4VA 1SJED 2MEKA 3AEEB 3R8BA 2WWZA 4W9FA 4FN2A 2K8CA 1TBEA 4W9KA 5I4DA 4HXDA 1OEYA 4II2B 5BMGA 1C4AA 2LHDA 4USAA 4F1SA 1WJ6A 3UI3A 2FNJB 3AE4B 2ONQA 4BVUC 2L05A 3V6CB 4LK0M 3QHTA 4GDLA 4H2AA 2GBMA 2Z59B 4ANWA 5JXVA 1WY8A 3AXCA 1WI0A 3UQBA 1WJUA 3VR8B 3QWZB 1JWUD 2MBHA 3RNAC 2VRRB 3Q14C 2V3SA 4E74A 2D3BA 4IWPA 1V6EA 3W5VB 2LD9A 3MHZA 1J0GA 1FNWA 4ZYSA 4EFOA 4DHZE 1F52A 4DXAB 3NVYA 4XX5A 1CK1A 2KDFB 2NTSA 3K9PB 2J7QB 1GUAB 2XBBC 1EO6A 3DDCB 2OJWA 4RH6A 2JWZA 3GP7A 4L1BA 4AUQC 1BMLC 1JWAD 2IYDB 3DBRI 3IG3A 2WDQB 1UGMA 3VUWA 5BYQA 2JY6A 4Q2JA 3NVZA 2KMMA 2HDEA 2MP2A 3DHIC 1QKZA 4REZA 3PLVA 2A5UA 5HI1A 2ZPNA 3B2FA 2WXLA 1WGRA 3AV8A 2BW2A 1K53A 3PLUA 1L4DB 1E7UA 4BKSA 4O1NA 1SE2A 1IGDA 3D32A 4GGQA 4UDUC 4MGKE 4RFBA 4W9DA 1UNSA 2GBKA 1V5TA 2MJ3A 3A9KA 1FXTB 2WS3B 5TSSA 2VZKD 1N62A 3AECB 3KUZA 1U4AA 1DGJA 2RMMA 3RNGC 3SHQA 3PRMB 1GG3A 1E7PB 2N7JA 3AE3B 4KX6B 4EZJA 3R2TA 1IPGA 3WALA 5CHFA 4B6WA 4LJPB 3ZJTA 4MSQB 2N9LA 3U8ZA 4M01A 2WP9B 3A4RA 1GJZA 2HTME 2J42A 2YEPF 1GB1A 5IN7A 4R3DA 1ZUD2 2LZ6A 3ZDTA 4GMVA 1ET9A 1OEYJ 3P63A 2ZVNA 3T3OA 1ZDXA 4K1RB 2K9XA 2AYOB 3KWLA 2KN5A 2M56B 2RDGA 1WGHA 3LYYA 5D6JB 1WGYA 2QC8A 2BBCA 1JWSD 3KUDB 4ZOHC 3W2DA 2L32A 1K50A 3RPFC 4E3CA 4XWWA 2CHWA 4NJCA 1P98A 2IGGA 1GOZA 1WM2A 4PS8A 1MHXA 4NJ7A 4KV2A 5AZFA 3QCAA 3MC9A 3WAMA 3AMZA 3M63B 4ZRQA 2D3GA 3J9CA 2MSED 3NUHB 4NZLB 2ZW1A 2I1KA 3ZKJC 2LXAA 3AE9B 1K52A 4ZRIA 3X0WA 4XGAB 1L4ZB 3AE7B 5HKHA 4FULA 2FCMA 3SR6A 1X1MA 2L7RA 3AE1B 3RNCC 4DDID 1KJTA 1L2NA 1UBQA 2BF8B 2G4DB 3V61A 1VZ8A 3PT2B 5IAAC 5H92C 1H4RA 2EMSA 3K9OB 1IYFA 4ZRKA 3X23A 5HG2A 3L4PA 1RFKA 4W9CA 3LB8C 1B1ZA 1OGWA 3AE8B 1QILA 2DYOA 2J0JA 2RD0A 1YN4A 4A6QA 2WQYB 3W1YA 3DBHB 4S17A 1JCKB 1QLBB 4N58A 1RFAA 4NNJB 3N1YC 3ONSA 3AE2B 2OJRA 3PGEA 1V9JA 2KN4A 2WXNA 2WNMA 4LNOA 4A20A 1LFDA 4HWIB 1J19A 2YVCA 4RF0A 2KD0A 2K6DB 2LRWA 3EGRA 2KK8A 1E6EB 1ZGUB 3L17A 1E8XA 5DCNA 2K22A 4WJPA 2LASA 1MG8A 3ZNID 4OVUA 5CHWA 1WXSA 1EF1A 1FD6A 3IAM1 3UGBB 3ABVB 1FPYA 2DHZA 4NAMA 4OZCA 1B9RA 4MJSB 2MRPA 2UWQA 5FR6A 2KWUB 2N7DA 2WLBA 3UIPB 3NZUA 1QF6A 1I7HA 2A4ZA 3AEBB 4MGZE 4KIKA 3DBLI 2ON8A 2GOWA 2L0TA 5KHOA 5DPRA 3TJPA 4HDOA 4WQOB 2DNFA 3TEZA 3A33B 3MFGA 4DXFA 1VZ7A 3PZ8A 5BO4B 1P9DU 2BT6A 3NS8A 3Q8EA 3N9YC 1E8WA 2FIFA 1WM3A 3V3XA 3ZJVA 4WWMA 4A3PA 4EE2A 1TGZB 2KFJA 3JYUA 2K6QA 1YQ3B 2K5PA 1VZ6A 2LRUA 3LDZE 5FK9C 1VR9A 3H6NA 2BYTA 4XZ4A 3NZ3A 2WU5B 4K3CA 3DPDA 4KVGB 2FE8A 1V81A 1V86A 3VRAB 5GXGB 4IKGA 4PK1A 3AB5A 1WWTA 3Q3JA 1Q5WB 3RFZB 1N63A 2JXXA 4NQLB 3ZGZA 1NVID 1WSPA 1SB3C 3IVFA 5FR3A 1NDDA 1E8YA 2M8SA 3CSFA 1UH6A 4LNIA 2MA9B 2MHJA 2DZJA 3P4QB 2KTRB 5CX3A 4BFRA 4FADA 2GBRA 1PUTA 3H8HA 1ROEA 2NTTA 4OW0A 2WXQA 1FO4A 2KZRA 4XWTA 3SFEB 3N32A 2KWVB 1PFDA 4DDGD 1YN5A 4J3OD 4YTNB 1QZEA 3VAWA 5MPOA 1WIAA 1LQBA 4NJ6A 2AEHA 2WXIA 3M3JA 4RM8A 2QMTA 4EOYA 3W5UB 1XD3B 2GB1A 2QEJC 1F9JA 1RWSA 1SSNA 2HJ8A 4TMAB 4G0NB 4OVVA 1SJHD 4EZLA 2JZZA 5LNK1 1SEBD 2IO2B 1TS4A 4KDIC 3QC8B 2W3RA 1GAQB 2UU7A 2N1WA 2LGXA 3RD2A 3NJTA 3TBLD 2NMQA 4M02A 3O65B 2FBWB 3RZFA 3RNFC 1AARA 1Z5SB 4AOFA 3VH3B 2LVOA 4BAXA 3TEYA 4K3BA 2Y5CA 2G45B 4IWQA 3RT3B 2WDTB 3ZNHB 1MVKA 2O2VB 1I4GA 1SGHA 3APCA 1FCCC 2N4FA 3RCZA 4HKZE 2EKIA 3MJ5A 4HJGE 3N1ZC 3DOWA 1WZ0A 3BZDB 3ENEA 4GXBA 1OFFA 2V1YA 4KKJA 2K39A 4LDTB 2MCNB 4WWOA 3L10B 4M0WB 2G9HD 3AULA 2BTEA 2KAJA 2IO0B 4WURA 1E90A 4BZAA 1L0YB 3KUCB 4LCDE 4GN1A 3RYTA 3VDZA 2M1MA 2AQ2B 2VH2A 1IGCA 4JL9A 1KLVA 1WE6A 3TL5A 4XC2A 2C7MB 3VFKA 3Q69A 2K0PA 4JWSC 1KLGD 3Q3OC 2CKHB 1T0RC 2LGDA 1V1PA 2MW5A 2W9NA 3PHXB 3KLSX 4BBNF 1IP9A 3DBHI 2DZMA 1PGAA
chains in the Genus database with same CATH topology
4NAWA 1D3ZA 4M8NA 2G3QB 1WE7A 2DX5B 1T0YA 2KFKB 3A4SC 3NZSA 3V60A 5JH5C 1V80A 3KUZA 1U4AA 2L8JA 3SHQA 3PRMB 2KFKA 1GG3A 4DBGA 4EZJA 1G6JA 1IPGA 3SU8X 3A1QA 3WALA 5CHFA 1WMHB 2AWTA 3AU4A 4B6WA 2BWFA 3U7DA 3TMPB 1Z2MA 2R2QA 4LJPB 5J2RA 2ZPYA 4MSQB 3U8ZA 1SE9A 4IW0A 1WXMA 3A4RA 2KC1A 1GJZA 3IFWB 3V6EB 3AU5A 1WJNA 4F8CB 4JGHB 3ZO5B 5IA7A 2HE7A 2LZ6A 3ZDTA 1C3TA 4EEWA 4B95A 4WWPA 4GMVA 2I1JA 5KHQA 3VTVA 4GIVA 3PVLA 1OEYJ 2ZVNA 4K1RB 2AYOB 2PJHA 4WAAA 2KN5A 4MSMB 2CR5A 4GDKA 4YL8A 4KZCA 1WGHA 3KH0A 5D6JB 2WX1A 1NBFC 4AJYB 1WGYA 3KUDB 4W9GA 3R7RA 1WRDB 2O6VD 3MHSD 4GDKB 2MBQA 3QJZA 4KSKC 4E3CA 2CHWA 2MP2B 4IUMB 2UYZB 3AI5A 1P98A 1A5RA 4PS8A 1WF9A 1WM2A 3MTNB 4NJ7A 4LDTD 3IHPC 3RZWC 3OJ4B 4KV2A 5AZFA 2DAFA 3ZDMC 4BBNC 3JSVB 3QCAA 3B1LX 4X57B 1C1YB 3WAMA 3WAOA 2C5LC 3M63B 3Q3FA 2FCQA 5G2NA 4G11A 3ZVVA 3H1UA 3UF8A 4K7UA 3PRPB 2V4LA 3ZNZB 2D3GA 2M0XA 2REXA 2MSED 4I6LB 4IWOA 2GBJA 3ZLZA 4G3XB 1KOTA 1WR6E 4W9HA 4HJKA 2I1KA 1VD2A 3ZKJC 2ZEQA 2LXAA 3C0RB 2JPHA 4ZRIA 1E8ZA 3X0WA 1Q0WB 1RAXA 5HKHA 4WJNA 4FULA 2FCMA 2N9PC 3HIZA 2KLCA 3QX1A 4MGYE 1X1MA 2N7EA 2L7RA 1YX5B 3A1QB 3DVNV 4IM3A 4ICVA 4DDID 1KJTA 5E6OA 1L2NA 3W1SA 2LJ5A 1UBQA 4TV3A 2BF8B 2G4DB 4GOCA 3V61A 4TQ1A 1M94A 4N9F4 1XT9B 2CU1A 2DENB 3PT2B 3OLMD 5IAAC 4HLEA 1GC7A 4NY0A 5G55A 1R4NI 1WJ4A 3ECIA 3VH4B 1ZKHA 2BYVE 3U30A 2IZVB 1H4RA 2EMSA 2N9XA 3K9OB 3S2AA 4ZRKA 1IYFA 2MBBB 3PV1A 3X23A 3PTFC 4ANVA 2KLGA 3BY4B 4FHJA 2FCNA 4K7WA 2KTFA 2LI5A 4W9CA 4ZYNA 1YIWA 3WA0A 1OGWA 3ZUNA 1ISNA 1CMXB 2DYOA 2J0JA 1JRUA 3QK0A 2RD0A 5LXHA 2LGYA 3W1YA 1WGDA 4W9IA 2AL3A 2KO3A 4DHJB 2BPSA 5CHVC 3B0AA 1KM7A 2L3ZA 4CHKA 2NCNA 3H7PA 1RFAA 2GBNA 4NNJB 3RULA 1Y8RC 3ONSA 5TR5A 3VTWA 1K8RB 2OJRA 3L08A 3PGEA 4IM2A 3EC8A 4AJWA 1V9JA 3VUYA 4W9JA 4A20A 2JF5A 2JRIB 3H7PB 1LFDA 1YQBA 4EKUA 2IY1B 3N3KB 4HWIB 3HM3A 1UELA 4K81A 1J19A 1XQQA 2YVCA 2KD0A 2K6DB 4IG7B 5CTRC 2LRWA 2KXJA 2LVPA 2IY0B 4RMAA 2KHWB 2LVQA 3A9JB 4K7SA 1BT0A 2KK8A 4PYUA 1ZGUB 4BKTA 2BWES 1E8XA 2MWSB 3L17A 3M62B 5DCNA 4EZKA 2M4NA 4WJPA 3KW5B 2LASA 1NI2A 1MG8A 3ZNID 3ZRFA 3HM6X 3ALBA 2G4SA 3JVZX 1ZW7A 2KVRA 1WXSA 3M95A 4OVUA 5CHWA 1EF1A 3ZTCA 1GC6A 3KVFB 2D07B 2FCSA 3UGBB 4ZRJA 2FIDA 2K8HA 2ZZPB 3T9LA 3CF6E 1WMHA 4GSWA 2DHZA 3IBEA 5E6PA 4BKSD 2C7HA 2PE6B 2J0MA 3PSEB 2D2QA 2KOXA 2HTHA 3OAWA 4TQ0A 4MJSB 3SD5A 4KSLC 1LM8B 2MRPA 2UWQA 1I42A 2C7NB 5FR6A 2KWUB 2N7DA 3UIPB 2ZNVB 4GU2A 3NZUA 4PS7A 2WX0A 4ANUA 2A4ZA 4FBJB 4MJSA 2KMAA 1P1AA 2KWCA 4MGZE 4HK2A 1TTNA 2RSUA 4KIKA 1WFYA 2DAJA 2IO3B 3DBLI 3L16A 3NHEB 2GOWA 3V62A 2NBVB 5DPSA 2KJ6A 4DK5A 4EUTA 4KDLB 2PEAA 1YD8U 2L0TA 2Y5BB 2B3AA 5KHOA 3QAQA 5DPRA 2MLBA 2YLMA 3TJPA 4HDOA 4WQOB 3KYCD 3NOBA 2CHXA 4FHKA 4HPLB 3A33B 4I6PA 2BYEA 5D7GA 1YJ1A 2MBOA 4FJYA 5BO4B 3R7QA 3DVNU 2BKRB 1WX9A 1VCBA 1P9DU 2KNBA 2JRHA 3NS8A 2N9EB 3DCGA 4AWJA 1E8WA 4ICUA 3WIMA 4PYZA 2L0FA 3GOEA 4MH0E 2KANA 2NPTA 2FIFA 1WX7A 1WM3A 4FJVB 3T8MA 1H8CA 2XEWA 4A3PA 2KJHB 1RLFA 2KDBA 1TGZB 3EECA 3VUXA 4HVBA 2KFJA 4WWNA 1I35A 3JYUA 2PE9A 1S3SG 2K6QA 4FJZA 4ASWC 3DVGY 3A9JA 1WX8A 4WJQA 2OOBB 5E6NA 1V5OA 2BGFA 2FAZA 1WR1A 2LRUA 3VQIA 4JQWC 1E7VA 2BYFA 3LDZE 2MQJA 3H6NA 2GMIC 4JIOU 4XZ4A 1P3QU 2K25A 4DHJD 2LXCA 3EFUA 3DPDA 2MX2A 4KVGB 3I3TB 1J8CA 4MEMA 2ZVOA 3B08A 3MJWA 1V81A 2C9WB 2RR9A 3RUIB 1V86A 5JHAA 1OQYA 2NS5A 5DPWA 2PPHA 4TKNA 2MBEA 5LLIA 2K1FA 2DZIA 3APDA 5AZGA 5AEKB 3N30A 5JZEB 4MGIE 4LJOB 3CMMB 1RRBA 1Q5WB 2J0KA 2RPQA 2ZJDA 3Q3JA 4MM3A 4WJOA 5C23A 5AZHA 2JXXA 1LXDA 3UINB 4HDQA 4NQLB 4FLHA 3HK0A 1GNUA 3PHWB 3PS6A 3DQVA 4PS3A 4DWFA 2KMCA 5C1ZA 3IVFA 4B9KA 3UIOB 3KYDD 2WYQA 3ZW3A 4NPNA 1NDDA 3WANA 3ML8A 2DYBA 1E8YA 3QARA 4BOSC 2M8SA 5JHBA 4DHZB 1WXVA 5L95C 1WZ3A 2KQSA 3CSFA 2LWPA 1UH6A 3PZDA 2CS4A 2KTRA 3DBSA 2XK5B 2NBWB 2RGFA 1TZ1A 2MA9B 3L0WB 2DZJA 4KZ0A 1WYWB 2KQ7A 1YX6B 3JW0X 4M8MA 2KTRB 5CX3A 3R3MA 2JT4B 3W1SC 4BFRA 3NY5A 4TUUA 2O6VA 4FADA 2JVCA 2GBRA 1E5WA 1UZXB 3QIJA 4JLCA 4BOZB 2WWZA 4FA6A 4W9FA 3UQAA 4FN2A 2K8CA 1TBEA 4W9KA 3ZRCA 2M17A 2KZRA 2KDIA 4HXDA 2KC2A 2AL6A 4II3B 1OEYA 2ZCBA 4URKA 1Q1OA 3N32A 4II2B 2KWVB 4DDGD 4F1SA 1WJ6A 1R4MI 3HHMA 1HE8A 1QZEA 3VAWA 4GB9A 1WIAA 1V49A 4HCNB 4G50A 1LQBA 2CHZA 4NJ6A 2AEHA 3M3JA 4RM8A 5D94A 2FNJB 4MDKE 2NR2A 3TIXA 3L13A 4EOYA 4IC7B 4IM0A 4A3OA 1XD3B 1EUVB 1F9JA 2ASQA 4BVUC 4GDLB 1PQSA 2D10A 4E71A 4ANXA 2HJ8A 3LJ3A 5DPTA 2Z0DB 2L05A 4G0NB 4OVVA 3V6CB 1WGGA 4EZLA 3QHTA 4GDLA 2NVUI 1S1QB 2GBMA 2JZZA 2Z59B 4ANWA 3ML9A 1WXAA 3A9KB 3EHVA 1WH3A 4KIKB 2IO2B 1WY8A 4RM9A 4KDIC 2KKCA 3QC8B 3AXCA 3ZIMA 2K8BA 1WI0A 2DZKA 5LXIB 4NAWB 1V2YA 3UQBA 1WJUA 3QWZB 3VXWA 2MBHA 3DVGX 4CYEA 2IBIB 2IO1B 2EKEC 2N1WA 2VRRB 2LGXA 3RD2A 1P0RA 2V3SA 2JUOA 3TBLD 2ZNVC 4E74A 4IWPA 1V6EA 3WAPA 3O65B 2C60A 2LD9A 1J0GA 4F7ZA 3RZFA 3L54A 3P2BA 4EFOA 4DHZE 4NQKE 5GMVA 4AP4C 1AARA 1Z5SB 4AOFA 3VH3B 4DXAB 2L00B 4XX5A 4W9EA 2LVOA 2O2VA 2KDFB 2R2OA 2DYMA 2XK5A 3K9PB 4MELA 3ZNGC 2NPTB 2J7QB 2G45B 1GUAB 3TCAA 2XBBC 1EO6A 4IWQA 3DDCB 2WDTB 3PRZA 4HPMB 3RT3B 2KJRA 3ZNHB 4BKGA 5L83A 2O2VB 3PPAA 2BKFA 1SGHA 2JWZA 2L76A 2N4FA 3APCA 3RCZA 2O6VB 3APFA 3BINA 3ZTDA 2FUHB 3DOWA 4J6IA 1WZ0A 3ENEA 4AUQC 4GXBA 2V1YA 2IYDB 3SDLC 3DBRI 3IG3A 5D2MB 1UGMA 2QHOA 1UD7A 5EDSA 5J18A 3VUWA 4CO7A 2JY6A 2K39A 4ZDVA 2KDEB 4LDTB 4P7IA 2MCNB 1L7YA 4WWOA 3L10B 3OJ3A 3PREA 4M0WB 2MP2A 2HD5B 3QA8A 3AULA 1UBIA 2N1VA 2IO0B 4I6NB 1SIFA 4W9LA 3VHTC 1E90A 3PLVA 2A5UA 3VTUA 3CSTA 2D11A 3H9DA 3R66C 3KUCB 3VVWB 4LCDE 2ZPNA 4GN1A 3RYTA 1OTRB 1WGRA 3VDZA 3JSVA 2M1MA 3PLUA 2NBUA 1E7UA 2JZ3B 4BKSA 4HCPB 4JL9A 1KLVA 1WE6A 3TL5A 2LUEA 3H7SA 4XC2A 2KX0A 2C7MB 3VFKA 2KX3A 2Z0EB 2ZCCA 3D32A 2CKHB 3QQ8B 4GGQA 2LGDA 2EMTA 2MW5A 4MGKE 2W9NA 1EF5A 4W9DA 3A9KA 2GBKA 1V5TA 3PHXB 3GZNI 4BBNF 1IP9A 3DBHI 1FXTB 5J17A 2DZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAW A;  1D3Z A;  4M8N A;  2G3Q B;  1WE7 A;  2DX5 B;  1T0Y A;  2KFK B;  3A4S C;  3NZS A;  3V60 A;  5JH5 C;  1V80 A;  3KUZ A;  1U4A A;  2L8J A;  3SHQ A;  3PRM B;  2KFK A;  1GG3 A;  4DBG A;  4EZJ A;  1G6J A;  1IPG A;  3SU8 X;  3A1Q A;  3WAL A;  5CHF A;  1WMH B;  2AWT A;  3AU4 A;  4B6W A;  2BWF A;  3U7D A;  3TMP B;  1Z2M A;  2R2Q A;  4LJP B;  5J2R A;  2ZPY A;  4MSQ B;  3U8Z A;  1SE9 A;  4IW0 A;  1WXM A;  3A4R A;  2KC1 A;  1GJZ A;  3IFW B;  3V6E B;  3AU5 A;  1WJN A;  4F8C B;  4JGH B;  3ZO5 B;  5IA7 A;  2HE7 A;  2LZ6 A;  3ZDT A;  1C3T A;  4EEW A;  4B95 A;  4WWP A;  4GMV A;  2I1J A;  5KHQ A;  3VTV A;  4GIV A;  3PVL A;  1OEY J;  2ZVN A;  4K1R B;  2AYO B;  2PJH A;  4WAA A;  2KN5 A;  4MSM B;  2CR5 A;  4GDK A;  4YL8 A;  4KZC A;  1WGH A;  3KH0 A;  5D6J B;  2WX1 A;  1NBF C;  4AJY B;  1WGY A;  3KUD B;  4W9G A;  3R7R A;  1WRD B;  2O6V D;  3MHS D;  4GDK B;  2MBQ A;  3QJZ A;  4KSK C;  4E3C A;  2CHW A;  2MP2 B;  4IUM B;  2UYZ B;  3AI5 A;  1P98 A;  1A5R A;  4PS8 A;  1WF9 A;  1WM2 A;  3MTN B;  4NJ7 A;  4LDT D;  3IHP C;  3RZW C;  3OJ4 B;  4KV2 A;  5AZF A;  2DAF A;  3ZDM C;  4BBN C;  3JSV B;  3QCA A;  3B1L X;  4X57 B;  1C1Y B;  3WAM A;  3WAO A;  2C5L C;  3M63 B;  3Q3F A;  2FCQ A;  5G2N A;  4G11 A;  3ZVV A;  3H1U A;  3UF8 A;  4K7U A;  3PRP B;  2V4L A;  3ZNZ B;  2D3G A;  2M0X A;  2REX A;  2MSE D;  4I6L B;  4IWO A;  2GBJ A;  3ZLZ A;  4G3X B;  1KOT A;  1WR6 E;  4W9H A;  4HJK A;  2I1K A;  1VD2 A;  3ZKJ C;  2ZEQ A;  2LXA A;  3C0R B;  2JPH A;  4ZRI A;  1E8Z A;  3X0W A;  1Q0W B;  1RAX A;  5HKH A;  4WJN A;  4FUL A;  2FCM A;  2N9P C;  3HIZ A;  2KLC A;  3QX1 A;  4MGY E;  1X1M A;  2N7E A;  2L7R A;  1YX5 B;  3A1Q B;  3DVN V;  4IM3 A;  4ICV A;  4DDI D;  1KJT A;  5E6O A;  1L2N A;  3W1S A;  2LJ5 A;  1UBQ A;  4TV3 A;  2BF8 B;  2G4D B;  4GOC A;  3V61 A;  4TQ1 A;  1M94 A;  4N9F 4;  1XT9 B;  2CU1 A;  2DEN B;  3PT2 B;  3OLM D;  5IAA C;  4HLE A;  1GC7 A;  4NY0 A;  5G55 A;  1R4N I;  1WJ4 A;  3ECI A;  3VH4 B;  1ZKH A;  2BYV E;  3U30 A;  2IZV B;  1H4R A;  2EMS A;  2N9X A;  3K9O B;  3S2A A;  4ZRK A;  1IYF A;  2MBB B;  3PV1 A;  3X23 A;  3PTF C;  4ANV A;  2KLG A;  3BY4 B;  4FHJ A;  2FCN A;  4K7W A;  2KTF A;  2LI5 A;  4W9C A;  4ZYN A;  1YIW A;  3WA0 A;  1OGW A;  3ZUN A;  1ISN A;  1CMX B;  2DYO A;  2J0J A;  1JRU A;  3QK0 A;  2RD0 A;  5LXH A;  2LGY A;  3W1Y A;  1WGD A;  4W9I A;  2AL3 A;  2KO3 A;  4DHJ B;  2BPS A;  5CHV C;  3B0A A;  1KM7 A;  2L3Z A;  4CHK A;  2NCN A;  3H7P A;  1RFA A;  2GBN A;  4NNJ B;  3RUL A;  1Y8R C;  3ONS A;  5TR5 A;  3VTW A;  1K8R B;  2OJR A;  3L08 A;  3PGE A;  4IM2 A;  3EC8 A;  4AJW A;  1V9J A;  3VUY A;  4W9J A;  4A20 A;  2JF5 A;  2JRI B;  3H7P B;  1LFD A;  1YQB A;  4EKU A;  2IY1 B;  3N3K B;  4HWI B;  3HM3 A;  1UEL A;  4K81 A;  1J19 A;  1XQQ A;  2YVC A;  2KD0 A;  2K6D B;  4IG7 B;  5CTR C;  2LRW A;  2KXJ A;  2LVP A;  2IY0 B;  4RMA A;  2KHW B;  2LVQ A;  3A9J B;  4K7S A;  1BT0 A;  2KK8 A;  4PYU A;  1ZGU B;  4BKT A;  2BWE S;  1E8X A;  2MWS B;  3L17 A;  3M62 B;  5DCN A;  4EZK A;  2M4N A;  4WJP A;  3KW5 B;  2LAS A;  1NI2 A;  1MG8 A;  3ZNI D;  3ZRF A;  3HM6 X;  3ALB A;  2G4S A;  3JVZ X;  1ZW7 A;  2KVR A;  1WXS A;  3M95 A;  4OVU A;  5CHW A;  1EF1 A;  3ZTC A;  1GC6 A;  3KVF B;  2D07 B;  2FCS A;  3UGB B;  4ZRJ A;  2FID A;  2K8H A;  2ZZP B;  3T9L A;  3CF6 E;  1WMH A;  4GSW A;  2DHZ A;  3IBE A;  5E6P A;  4BKS D;  2C7H A;  2PE6 B;  2J0M A;  3PSE B;  2D2Q A;  2KOX A;  2HTH A;  3OAW A;  4TQ0 A;  4MJS B;  3SD5 A;  4KSL C;  1LM8 B;  2MRP A;  2UWQ A;  1I42 A;  2C7N B;  5FR6 A;  2KWU B;  2N7D A;  3UIP B;  2ZNV B;  4GU2 A;  3NZU A;  4PS7 A;  2WX0 A;  4ANU A;  2A4Z A;  4FBJ B;  4MJS A;  2KMA A;  1P1A A;  2KWC A;  4MGZ E;  4HK2 A;  1TTN A;  2RSU A;  4KIK A;  1WFY A;  2DAJ A;  2IO3 B;  3DBL I;  3L16 A;  3NHE B;  2GOW A;  3V62 A;  2NBV B;  5DPS A;  2KJ6 A;  4DK5 A;  4EUT A;  4KDL B;  2PEA A;  1YD8 U;  2L0T A;  2Y5B B;  2B3A A;  5KHO A;  3QAQ A;  5DPR A;  2MLB A;  2YLM A;  3TJP A;  4HDO A;  4WQO B;  3KYC D;  3NOB A;  2CHX A;  4FHK A;  4HPL B;  3A33 B;  4I6P A;  2BYE A;  5D7G A;  1YJ1 A;  2MBO A;  4FJY A;  5BO4 B;  3R7Q A;  3DVN U;  2BKR B;  1WX9 A;  1VCB A;  1P9D U;  2KNB A;  2JRH A;  3NS8 A;  2N9E B;  3DCG A;  4AWJ A;  1E8W A;  4ICU A;  3WIM A;  4PYZ A;  2L0F A;  3GOE A;  4MH0 E;  2KAN A;  2NPT A;  2FIF A;  1WX7 A;  1WM3 A;  4FJV B;  3T8M A;  1H8C A;  2XEW A;  4A3P A;  2KJH B;  1RLF A;  2KDB A;  1TGZ B;  3EEC A;  3VUX A;  4HVB A;  2KFJ A;  4WWN A;  1I35 A;  3JYU A;  2PE9 A;  1S3S G;  2K6Q A;  4FJZ A;  4ASW C;  3DVG Y;  3A9J A;  1WX8 A;  4WJQ A;  2OOB B;  5E6N A;  1V5O A;  2BGF A;  2FAZ A;  1WR1 A;  2LRU A;  3VQI A;  4JQW C;  1E7V A;  2BYF A;  3LDZ E;  2MQJ A;  3H6N A;  2GMI C;  4JIO U;  4XZ4 A;  1P3Q U;  2K25 A;  4DHJ D;  2LXC A;  3EFU A;  3DPD A;  2MX2 A;  4KVG B;  3I3T B;  1J8C A;  4MEM A;  2ZVO A;  3B08 A;  3MJW A;  1V81 A;  2C9W B;  2RR9 A;  3RUI B;  1V86 A;  5JHA A;  1OQY A;  2NS5 A;  5DPW A;  2PPH A;  4TKN A;  2MBE A;  5LLI A;  2K1F A;  2DZI A;  3APD A;  5AZG A;  5AEK B;  3N30 A;  5JZE B;  4MGI E;  4LJO B;  3CMM B;  1RRB A;  1Q5W B;  2J0K A;  2RPQ A;  2ZJD A;  3Q3J A;  4MM3 A;  4WJO A;  5C23 A;  5AZH A;  2JXX A;  1LXD A;  3UIN B;  4HDQ A;  4NQL B;  4FLH A;  3HK0 A;  1GNU A;  3PHW B;  3PS6 A;  3DQV A;  4PS3 A;  4DWF A;  2KMC A;  5C1Z A;  3IVF A;  4B9K A;  3UIO B;  3KYD D;  2WYQ A;  3ZW3 A;  4NPN A;  1NDD A;  3WAN A;  3ML8 A;  2DYB A;  1E8Y A;  3QAR A;  4BOS C;  2M8S A;  5JHB A;  4DHZ B;  1WXV A;  5L95 C;  1WZ3 A;  2KQS A;  3CSF A;  2LWP A;  1UH6 A;  3PZD A;  2CS4 A;  2KTR A;  3DBS A;  2XK5 B;  2NBW B;  2RGF A;  1TZ1 A;  2MA9 B;  3L0W B;  2DZJ A;  4KZ0 A;  1WYW B;  2KQ7 A;  1YX6 B;  3JW0 X;  4M8M A;  2KTR B;  5CX3 A;  3R3M A;  2JT4 B;  3W1S C;  4BFR A;  3NY5 A;  4TUU A;  2O6V A;  4FAD A;  2JVC A;  2GBR A;  1E5W A;  1UZX B;  3QIJ A;  4JLC A;  4BOZ B;  2WWZ A;  4FA6 A;  4W9F A;  3UQA A;  4FN2 A;  2K8C A;  1TBE A;  4W9K A;  3ZRC A;  2M17 A;  2KZR A;  2KDI A;  4HXD A;  2KC2 A;  2AL6 A;  4II3 B;  1OEY A;  2ZCB A;  4URK A;  1Q1O A;  3N32 A;  4II2 B;  2KWV B;  4DDG D;  4F1S A;  1WJ6 A;  1R4M I;  3HHM A;  1HE8 A;  1QZE A;  3VAW A;  4GB9 A;  1WIA A;  1V49 A;  4HCN B;  4G50 A;  1LQB A;  2CHZ A;  4NJ6 A;  2AEH A;  3M3J A;  4RM8 A;  5D94 A;  2FNJ B;  4MDK E;  2NR2 A;  3TIX A;  3L13 A;  4EOY A;  4IC7 B;  4IM0 A;  4A3O A;  1XD3 B;  1EUV B;  1F9J A;  2ASQ A;  4BVU C;  4GDL B;  1PQS A;  2D10 A;  4E71 A;  4ANX A;  2HJ8 A;  3LJ3 A;  5DPT A;  2Z0D B;  2L05 A;  4G0N B;  4OVV A;  3V6C B;  1WGG A;  4EZL A;  3QHT A;  4GDL A;  2NVU I;  1S1Q B;  2GBM A;  2JZZ A;  2Z59 B;  4ANW A;  3ML9 A;  1WXA A;  3A9K B;  3EHV A;  1WH3 A;  4KIK B;  2IO2 B;  1WY8 A;  4RM9 A;  4KDI C;  2KKC A;  3QC8 B;  3AXC A;  3ZIM A;  2K8B A;  1WI0 A;  2DZK A;  5LXI B;  4NAW B;  1V2Y A;  3UQB A;  1WJU A;  3QWZ B;  3VXW A;  2MBH A;  3DVG X;  4CYE A;  2IBI B;  2IO1 B;  2EKE C;  2N1W A;  2VRR B;  2LGX A;  3RD2 A;  1P0R A;  2V3S A;  2JUO A;  3TBL D;  2ZNV C;  4E74 A;  4IWP A;  1V6E A;  3WAP A;  3O65 B;  2C60 A;  2LD9 A;  1J0G A;  4F7Z A;  3RZF A;  3L54 A;  3P2B A;  4EFO A;  4DHZ E;  4NQK E;  5GMV A;  4AP4 C;  1AAR A;  1Z5S B;  4AOF A;  3VH3 B;  4DXA B;  2L00 B;  4XX5 A;  4W9E A;  2LVO A;  2O2V A;  2KDF B;  2R2O A;  2DYM A;  2XK5 A;  3K9P B;  4MEL A;  3ZNG C;  2NPT B;  2J7Q B;  2G45 B;  1GUA B;  3TCA A;  2XBB C;  1EO6 A;  4IWQ A;  3DDC B;  2WDT B;  3PRZ A;  4HPM B;  3RT3 B;  2KJR A;  3ZNH B;  4BKG A;  5L83 A;  2O2V B;  3PPA A;  2BKF A;  1SGH A;  2JWZ A;  2L76 A;  2N4F A;  3APC A;  3RCZ A;  2O6V B;  3APF A;  3BIN A;  3ZTD A;  2FUH B;  3DOW A;  4J6I A;  1WZ0 A;  3ENE A;  4AUQ C;  4GXB A;  2V1Y A;  2IYD B;  3SDL C;  3DBR I;  3IG3 A;  5D2M B;  1UGM A;  2QHO A;  1UD7 A;  5EDS A;  5J18 A;  3VUW A;  4CO7 A;  2JY6 A;  2K39 A;  4ZDV A;  2KDE B;  4LDT B;  4P7I A;  2MCN B;  1L7Y A;  4WWO A;  3L10 B;  3OJ3 A;  3PRE A;  4M0W B;  2MP2 A;  2HD5 B;  3QA8 A;  3AUL A;  1UBI A;  2N1V A;  2IO0 B;  4I6N B;  1SIF A;  4W9L A;  3VHT C;  1E90 A;  3PLV A;  2A5U A;  3VTU A;  3CST A;  2D11 A;  3H9D A;  3R66 C;  3KUC B;  3VVW B;  4LCD E;  2ZPN A;  4GN1 A;  3RYT A;  1OTR B;  1WGR A;  3VDZ A;  3JSV A;  2M1M A;  3PLU A;  2NBU A;  1E7U A;  2JZ3 B;  4BKS A;  4HCP B;  4JL9 A;  1KLV A;  1WE6 A;  3TL5 A;  2LUE A;  3H7S A;  4XC2 A;  2KX0 A;  2C7M B;  3VFK A;  2KX3 A;  2Z0E B;  2ZCC A;  3D32 A;  2CKH B;  3QQ8 B;  4GGQ A;  2LGD A;  2EMT A;  2MW5 A;  4MGK E;  2W9N A;  1EF5 A;  4W9D A;  3A9K A;  2GBK A;  1V5T A;  3PHX B;  3GZN I;  4BBN F;  1IP9 A;  3DBH I;  1FXT B;  5J17 A;  2DZM A; 
#chains in the Genus database with same CATH topology
 1D3Z A;  4M8N A;  1TS3 A;  2G3Q B;  2DLB A;  3V60 A;  3AEA B;  1IBX A;  4PT5 A;  2KFK A;  4XE0 A;  4GLS C;  3SU8 X;  2AWT A;  2XN9 C;  3Q8C A;  2V3N A;  2BWF A;  3U7D A;  2R2Q A;  3MP9 A;  2KC1 A;  1CZP A;  3AU5 A;  4F8C B;  4JGH B;  5BYR A;  2HE7 A;  1C3T A;  4B95 A;  4WWP A;  2PMV A;  1WXQ A;  3PVL A;  3GE3 C;  2KDM A;  4LNF A;  4KGT A;  4YL8 A;  1NBF C;  1T3Q A;  3P4P B;  4YXD B;  3R7R A;  1WRD B;  3MHS D;  4GDK B;  5C3J B;  4N59 A;  2MP2 B;  1WF9 A;  2PKO A;  3IHP C;  2BS4 B;  1PYW D;  2DAF A;  3ZDM C;  3B1L X;  1T0S C;  1C1Y B;  3NG0 A;  2C5L C;  2FCQ A;  3ZVV A;  3UF8 A;  3PRP B;  2E3T A;  1P7F A;  2REX A;  3HVZ A;  1SE3 A;  4IWO A;  1KTK A;  3ZLZ A;  3U7Z A;  1J7A A;  2MJD A;  3ZQ4 A;  3C0R B;  4YT0 B;  2JPH A;  3AE6 B;  2IJ0 A;  3RMK C;  3LXF A;  1Q0W B;  1Q10 A;  3U2S C;  2KLC A;  2EEL A;  3DVN V;  4IM3 A;  1I4Q A;  4GOC A;  1AYF A;  3IT6 B;  4TQ1 A;  1M94 A;  3NS1 A;  1XT9 B;  3TEX A;  1F2R C;  4QAY A;  4HLE A;  4HPP A;  5G55 A;  2JQR B;  1WJ4 A;  3U30 A;  2IZV B;  3Q8B A;  5H8Y E;  2I2Y A;  4A8X C;  3PTF C;  2J4X A;  2X8X X;  4S0R A;  2KTF A;  4ZYN A;  4TSS A;  4XDD A;  1V8C A;  3E56 A;  2LGY A;  1FIQ A;  2AL3 A;  3IAS 1;  1R7S A;  2BPS A;  2NCN A;  3C8Y A;  3VTW A;  3L08 A;  4ZHO A;  4AJW A;  3VUY A;  2JYT A;  4W9J A;  1YQB A;  4EKU A;  2IY1 B;  4K81 A;  4DQO C;  1XQQ A;  2HJ1 A;  2LVP A;  2IY0 B;  1BT0 A;  4LNN A;  5T8I A;  2WXF A;  1N60 A;  1YNT E;  2M4N A;  3HRD D;  3ZRF A;  1GPX A;  2G4S A;  4E71 A;  1ZW7 A;  2KVR A;  4A9A A;  4ACF A;  1XCT L;  4ZHP A;  2FCS A;  4ZRJ A;  2K8H A;  3CF6 E;  1WMH A;  4BKS D;  2C7H A;  3PSE B;  1ET6 A;  1MHH E;  4P1C C;  2HTH A;  4ARI A;  1MFW A;  1I42 A;  2XNA C;  2ZNV B;  4GU2 A;  4PS7 A;  4FBJ B;  1MPE A;  2KMA A;  1P1A A;  4HK2 A;  2RSU A;  2IO3 B;  3AED B;  1EU4 A;  1PGB A;  5DPS A;  4DK5 A;  4EUT A;  2PEA A;  2Y5B B;  2B3A A;  1L0X B;  2MLB A;  3KYC D;  3NOB A;  4FHK A;  3AM9 A;  2K3U A;  1TY0 A;  2MBO A;  3R7Q A;  1VLB A;  1WX9 A;  1VCB A;  1YMH E;  2GI9 A;  1C78 A;  1MJD A;  2TSS A;  5IKC M;  4AWJ A;  1ENF A;  2L83 A;  2KYW A;  2BS3 B;  4MAC A;  3BVG A;  4YSY B;  1T5X D;  4RCO A;  2XEW A;  1XLP A;  2BS2 B;  3Q6B A;  2DBY A;  1C76 A;  2Z8L A;  2DWQ A;  4WWN A;  2PE9 A;  1I4X A;  3DVG Y;  2OOB B;  5E6N A;  1V5O A;  2BGF A;  4MT5 A;  1F2R I;  3VQI A;  3TEW A;  3ZYY X;  1E7V A;  2GMI C;  4JIO U;  1P3Q U;  3W9C B;  2LXC A;  3EFU A;  3DWM A;  2ZVO A;  3B08 A;  2BB6 A;  4A55 A;  2B76 B;  5DPW A;  3GZN B;  5BMH A;  2MBE A;  2V9H A;  3APD A;  4C56 C;  5AEK B;  5JZE B;  2WXP A;  5GMV A;  1RRB A;  2J0K A;  1MI0 A;  4JE3 B;  3AEG B;  5AZH A;  4FLH A;  3HK0 A;  3PHW B;  4PS3 A;  4DWF A;  2KMC A;  5C1Z A;  4B9K A;  3UIO B;  3I57 A;  5BYS A;  4L23 A;  3ZW3 A;  5AUK A;  1D5M C;  3NVW A;  1VJK A;  2DYB A;  3ML8 A;  3QAR A;  4P6V F;  5FKA C;  2LWP A;  4C80 A;  3PZD A;  2CS4 A;  2KTR A;  2XK5 B;  2NBW B;  1TZ1 A;  4KZ0 A;  3W1S C;  3NY5 A;  4A90 A;  1Y56 A;  2JVC A;  1F0Z A;  1UZX B;  4BOZ B;  4FA6 A;  3UQA A;  1OQQ A;  5AUI A;  1SIJ A;  2KDI A;  3Q8F A;  4HKQ A;  2AL6 A;  3DHH C;  4II3 B;  2ZCB A;  1YJJ A;  1Q1O A;  1HXY D;  1L6V A;  4ARC A;  1I4P A;  1HE8 A;  2OHF A;  3MC8 A;  1TIF A;  3OG5 A;  3U4E G;  1KH0 A;  4N6E B;  5D94 A;  3TIX A;  2NR2 A;  4IM0 A;  4A3O A;  2WU2 B;  1EUV B;  4GDL B;  1PQS A;  2V0G A;  4XYC A;  4ANX A;  3LJ3 A;  5DPT A;  2Z0D B;  3AEF B;  4RNA A;  1S1Q B;  3V05 A;  1WXA A;  1ZPS A;  4C00 A;  1MG4 A;  2KKC A;  2K8B A;  2VH1 A;  1D5X C;  4NAW B;  3N1X C;  3DVG X;  4CYE A;  2Y3A A;  2IBI B;  3GE8 C;  1EWC A;  1K51 A;  2JYE A;  1N5X A;  2JU6 X;  5HFY A;  3I63 C;  4AP4 C;  2L00 B;  4W9E A;  2O2V A;  2XK5 A;  4MEL A;  3ZNG C;  2NPT B;  3TCA A;  2JZP A;  3PRZ A;  5L83 A;  2KJR A;  4BKG A;  3PPA A;  2BKF A;  2WXG A;  3Q3N C;  3APF A;  3BIN A;  3ZTD A;  2FUH B;  4B0E A;  4J6I A;  1JQ4 A;  2QJL A;  5D2M B;  2IGH A;  1AW7 A;  1HA5 A;  2QHO A;  1UD7 A;  5EDS A;  4CO7 A;  2I38 A;  5IOI A;  1HEZ E;  2KDE B;  1L7Y A;  1NEK B;  1EWY C;  2HD5 B;  2QCZ A;  3QA8 A;  1FCL A;  1ZXH A;  2BQQ A;  1SIF A;  2IND C;  1J7B A;  3CST A;  3H9D A;  3VVW B;  1I4R A;  1OTR B;  3JSV A;  4MM3 B;  2NBU A;  3EA6 A;  1NI3 A;  2JZ3 B;  2PLP A;  2QSD A;  1PGX A;  2LUE A;  2KX0 A;  2INC C;  2Z0E B;  2J53 A;  2Y5P A;  3GZN I;  5J17 A;  2CJN A;  5D3I B;  2INN E;  4NAW A;  3AE5 B;  1WE7 A;  2DX5 B;  2KFK B;  3NZS A;  1V80 A;  2OED A;  4DBG A;  4P16 A;  3AU4 A;  1UWX A;  2YEP B;  4B0M A;  2J52 A;  4IW0 A;  3IFW B;  3V6E B;  1WJN A;  3ZO5 B;  2W3S A;  4WAF A;  3BK1 A;  4JX1 C;  2I1J A;  2JX5 A;  3VTV A;  4GIV A;  1DOI A;  1JML A;  2PJH A;  4MSM B;  1FFU A;  4GDK A;  4KZC A;  3KH0 A;  1AWD A;  2SEB D;  4W9G A;  2O6V D;  2MBQ A;  3C19 A;  3U52 E;  1PDX A;  4IUM B;  3BWU D;  2KT7 A;  4C7Y A;  4AS1 A;  1A5R A;  1BXT A;  3MTN B;  4LDT D;  2G1E A;  3OJ4 B;  4BBN C;  3JSV B;  1I4H A;  2KVZ A;  3WAO A;  4C7Z A;  3Q3F A;  5G2N A;  3H1U A;  3FAH A;  2V4L A;  3ZNZ B;  4KGR A;  2M0X A;  3TSS A;  4YTM B;  3VRB B;  4G3X B;  1WR6 E;  1UUP A;  1E10 A;  4W9H A;  4HJK A;  1VD2 A;  2ZEQ A;  1UWM A;  1HTQ A;  3I5J C;  1YJI A;  1F77 A;  4WJN A;  1UGJ A;  4ITK A;  5E6O A;  4RGT A;  4N9F 4;  2DEN B;  3HVD A;  3OLM D;  1GC7 A;  2N9K A;  1ZXI A;  3GS2 A;  1R4N I;  1LO5 D;  4M0W A;  3FKY A;  5EE9 A;  2ACZ B;  3S2A A;  2MBB B;  3PV1 A;  4ANV A;  1JWB D;  3BY4 B;  2L1A A;  2FCN A;  4K7W A;  1YQ4 B;  3EFC A;  3P4R B;  5C2T B;  1CMX B;  1OQR A;  4D2K A;  4KKI A;  3QK0 A;  5D3D A;  1R4M B;  3ETR A;  1JRO A;  1WGD A;  4W9I A;  4DHJ B;  3CWI A;  3B0A A;  4CHK A;  4LLG M;  2GBN A;  3RUL A;  1TZO A;  2LUM A;  3HUI A;  4IM2 A;  3EC8 A;  2JF5 A;  3H7P B;  1ZE3 D;  1ZDV A;  3HM3 A;  1UEL A;  3RNE C;  3KWV A;  1VRA B;  2KXJ A;  2KHW B;  4K7S A;  1DYQ A;  3IXS A;  2BWE S;  2WDV B;  3BYY B;  3M62 B;  4EZK A;  1IBX B;  2V3P A;  3P4S B;  1QT9 A;  3ALB A;  3JVZ X;  1CQV A;  3M95 A;  3ZTC A;  4OVZ A;  3KVF B;  3NVV A;  5HHD G;  2FID A;  2ZZP B;  4CQN A;  4GSW A;  5E6P A;  3IBE A;  3I9V 1;  2PE6 B;  2J0M A;  4WQM A;  3OAW A;  4RGN A;  1LM8 B;  3EUB 2;  2WX0 A;  4ANU A;  2L52 A;  3T3N A;  1TTN A;  1WFY A;  2DAJ A;  1P7E A;  3L16 A;  3NHE B;  3V62 A;  2KQ4 X;  2LFI A;  1YD8 U;  2LGI A;  2KWD A;  3QAQ A;  2YLM A;  1UF0 A;  2CHX A;  4HPL B;  5D7G A;  1YJ1 A;  1KF6 B;  4FJY A;  3BYT B;  3DVN U;  2BKR B;  4YWG G;  2KNB A;  1KLU D;  3FC4 A;  2PW9 A;  1XLN A;  4ICU A;  2L0F A;  3GOE A;  2KAN A;  1WX7 A;  3T8M A;  3FIL A;  3DHG C;  1RLF A;  3VUX A;  1HQR D;  1L5P A;  1S3S G;  4ASW C;  1QQR A;  4WJQ A;  1N61 A;  2FAZ A;  1ESF A;  2MQJ A;  1TKE A;  2MX2 A;  3I3T B;  1J8C A;  3MJW A;  1FM0 D;  3RUI B;  2AQ3 B;  1F1H A;  1QOB A;  1C9F A;  1OQY A;  2NS5 A;  2PPH A;  4TKN A;  5LLI A;  2K1F A;  2DZI A;  2INP E;  5AZG A;  2RDB C;  1XXG A;  1TT5 B;  4RF1 A;  4MGI E;  1RYJ A;  3WAN A;  1JAL A;  5C23 A;  2RPQ A;  1YN3 A;  2GRI A;  3UIN B;  1LXD A;  4HDQ A;  1FNU A;  1L0V B;  3PS6 A;  2WYQ A;  2GLS A;  4NPN A;  2CJO A;  4BOS C;  1XO3 A;  2KQS A;  1CJE A;  1XF5 L;  4MH8 A;  3TUO A;  2RGF A;  2M19 A;  2KQ7 A;  1YX6 B;  3DBL B;  3Q8A A;  3R3M A;  2AQ1 B;  2JT4 B;  4TUU A;  2O6V A;  1E5W A;  4JLC A;  3QIJ A;  3ZRC A;  2M17 A;  1R4N B;  1JW9 D;  1QOF A;  2KC2 A;  4XDC A;  1FNV A;  4URK A;  2R61 A;  1RM6 C;  2WGS A;  1FRR A;  1FEH A;  2W55 A;  3N20 C;  3FIL B;  1D4B A;  1R4M I;  3HHM A;  2D3C A;  4GB9 A;  1V49 A;  4HCN B;  4G50 A;  2CHZ A;  1HZ6 A;  4MDK E;  3L13 A;  4IC7 B;  2ASQ A;  2D10 A;  2W82 A;  4IDI A;  1SE4 A;  1WGG A;  2NVU I;  1WYG A;  3ML9 A;  3EHV A;  3A9K B;  3WCQ A;  1WH3 A;  4KIK B;  4RM9 A;  3ZIM A;  1VDV A;  2DZK A;  5LXI B;  1V2Y A;  2QDF A;  3VXW A;  2IO1 B;  2EKE C;  1P0R A;  2JUO A;  2ZNV C;  4DXG A;  1YOV B;  1TYG B;  3WAP A;  2C60 A;  4F7Z A;  3IT4 B;  3L54 A;  3P2B A;  4NQK E;  3CIR B;  2R2O A;  2DYM A;  3B2G A;  1JRP A;  2WXR A;  4HPM B;  2BVC A;  4HRS A;  1SXT A;  2L76 A;  1IUE A;  2Q5W D;  2O6V B;  3AH7 A;  2N0S B;  3SDL C;  5G5H A;  2H89 B;  5J18 A;  4ZDV A;  4P7I A;  3URY A;  4FXC A;  3OJ3 A;  5G5G A;  3PRE A;  1D5Z C;  1UBI A;  2N1V A;  2X38 A;  1EU3 A;  4I6N B;  1T0Q C;  4W9L A;  3VHT C;  3VTU A;  2D11 A;  3R66 C;  3E9S A;  4LTU A;  3ZXV A;  4HCP B;  1NYQ A;  2LHE A;  3H7S A;  1C4C A;  4YSZ B;  2KX3 A;  1C4P A;  2ZCC A;  3QQ8 B;  1AN8 A;  2EMT A;  1STE A;  1V1O A;  2AX5 A;  4OZA A;  1EF5 A;  4WIP A;  3ZXR A;  1ZOY B;  2MH7 A;  2QIE B;  1KFY B;  1T0Y A;  3A4S C;  5JH5 C;  1HTO A;  2L8J A;  3DBR B;  1G6J A;  4AQ7 A;  1DOY A;  3A1Q A;  1WMH B;  4RGO S;  4YSX B;  3TMP B;  1Z2M A;  5J2R A;  2ZPY A;  1SE9 A;  1WXM A;  1TJE A;  5IA7 A;  4HEA 1;  5EE0 A;  1N5W A;  2IGD A;  4EEW A;  5KHQ A;  2JXT A;  2PIA A;  3R2I A;  4WAA A;  3BK2 A;  2CR5 A;  1FXA A;  1D6E C;  5IP4 D;  1SF0 A;  2WX1 A;  4AJY B;  3SEB A;  3QJZ A;  4KSK C;  2WXK A;  3MC0 B;  5EE3 A;  3P42 A;  2WDR B;  2UYZ B;  3AI5 A;  5E6J A;  1KRH A;  3RZW C;  2PVG C;  5BMI A;  1L6U A;  1ACC A;  1ZP0 B;  4X57 B;  3ZJU A;  1FMA D;  2CU3 A;  2MJE A;  4G11 A;  4K7U A;  2PVO D;  1LGR A;  4ZRP A;  2ICI A;  4I6L B;  2WXO A;  2GBJ A;  1HZ5 A;  1KOT A;  3KQ4 A;  3PO0 A;  1E8Z A;  1BUI C;  1RAX A;  1E9M A;  2N9P C;  2D3A A;  3HIZ A;  1FFV A;  3QX1 A;  2LJI A;  4MGY E;  2N7E A;  1EM7 A;  2VZK B;  1YX5 B;  3A1Q B;  2IDY A;  4ICV A;  1TKY A;  3W1S A;  2LJ5 A;  4TV3 A;  2PTL A;  2CU1 A;  2WXM A;  3RN9 C;  2WHI A;  4NY0 A;  3ECI A;  3VH4 B;  1ZKH A;  2BYV E;  1XLQ A;  2N9X A;  3P1M A;  3PZ7 A;  2KLG A;  4FHJ A;  1FXI A;  1A70 A;  3ZUN A;  2LI5 A;  2IPK D;  1YIW A;  3WA0 A;  1ISN A;  1JRU A;  5LXH A;  1WRI A;  4LNK A;  2KO3 A;  5CHV C;  1KM7 A;  2L3Z A;  2SAK A;  4HRO A;  3H7P A;  1Y8R C;  5TR5 A;  1K8R B;  1V1P B;  4WH4 A;  2JRI B;  4IOI E;  3N3K B;  5CTR C;  4IG7 B;  4RMA A;  2LVQ A;  3A9J B;  1C77 A;  1QOG A;  4PYU A;  4BKT A;  1T6B X;  2MWS B;  3KW5 B;  1NI2 A;  3HM6 X;  1TS5 A;  2JSV X;  2V4I B;  1J7C A;  1GC6 A;  1V97 A;  3BVZ A;  2D07 B;  2M0A A;  2BB5 A;  1XEE A;  1GB4 A;  3T9L A;  2QIL A;  2D2Q A;  2KOX A;  4US9 A;  3GB1 A;  1TY2 A;  3SD5 A;  4KSL C;  4TQ0 A;  1WGK A;  2C7N B;  1QOA A;  5EE1 A;  4MJS A;  1NEN B;  2KWC A;  2RPV A;  2NBV B;  2KJ6 A;  4KDL B;  4C4V B;  4OHJ A;  2KAC A;  3B9J A;  1N6Z A;  4I6P A;  2BYE A;  2D5G A;  2LMC A;  4JPS A;  4RGM A;  1XLO A;  2JRH A;  2N9E B;  3DCG A;  3WIM A;  4PYZ A;  4MH0 E;  2NPT A;  3Q2A C;  4FJV B;  1H8C A;  3OWE B;  3SFD B;  2KJH B;  2KDB A;  2WXH A;  3EEC A;  3RNB C;  4HVB A;  4P1B C;  1I35 A;  5IO9 A;  4FJZ A;  3A9J A;  1WX8 A;  3DWG C;  1WR1 A;  1XCQ L;  4JWU C;  4JQW C;  2LGS A;  2BYF A;  4YTP B;  1C79 A;  4M00 A;  2K25 A;  4DHJ D;  1JWM D;  2ZW0 A;  4MEM A;  4US8 A;  2C9W B;  2H88 B;  2W54 A;  2RR9 A;  1SBB B;  5JHA A;  1FRD A;  4KGS A;  1NYR A;  3N30 A;  3NRZ A;  4LJO B;  3CMM B;  4WJO A;  2ZJD A;  4MM3 A;  1TKG A;  2RDH A;  3BVM A;  1GNU A;  3DQV A;  3VR9 B;  3O13 A;  3KYD D;  2FUG 1;  4C4V A;  2JWU A;  3RI7 C;  1DOX A;  1TS2 A;  5JHB A;  4DHZ B;  1WXV A;  5L95 C;  4L2Y A;  1WZ3 A;  3BII D;  4OZB A;  3DBS A;  3L0W B;  3AN1 A;  1WYW B;  3JW0 X;  4M8M A;  2LEK A;  2WXJ A;  3Q3M C;  1E0Z A;  2E6X A;  1M4V A;  1SJE D;  2MEK A;  3AEE B;  3R8B A;  2WWZ A;  4W9F A;  4FN2 A;  2K8C A;  1TBE A;  4W9K A;  5I4D A;  4HXD A;  1OEY A;  4II2 B;  5BMG A;  1C4A A;  2LHD A;  4USA A;  4F1S A;  1WJ6 A;  3UI3 A;  2FNJ B;  3AE4 B;  2ONQ A;  4BVU C;  2L05 A;  3V6C B;  4LK0 M;  3QHT A;  4GDL A;  4H2A A;  2GBM A;  2Z59 B;  4ANW A;  5JXV A;  1WY8 A;  3AXC A;  1WI0 A;  3UQB A;  1WJU A;  3VR8 B;  3QWZ B;  1JWU D;  2MBH A;  3RNA C;  2VRR B;  3Q14 C;  2V3S A;  4E74 A;  2D3B A;  4IWP A;  1V6E A;  3W5V B;  2LD9 A;  3MHZ A;  1J0G A;  1FNW A;  4ZYS A;  4EFO A;  4DHZ E;  1F52 A;  4DXA B;  3NVY A;  4XX5 A;  1CK1 A;  2KDF B;  2NTS A;  3K9P B;  2J7Q B;  1GUA B;  2XBB C;  1EO6 A;  3DDC B;  2OJW A;  4RH6 A;  2JWZ A;  3GP7 A;  4L1B A;  4AUQ C;  1BML C;  1JWA D;  2IYD B;  3DBR I;  3IG3 A;  2WDQ B;  1UGM A;  3VUW A;  5BYQ A;  2JY6 A;  4Q2J A;  3NVZ A;  2KMM A;  2HDE A;  2MP2 A;  3DHI C;  1QKZ A;  4REZ A;  3PLV A;  2A5U A;  5HI1 A;  2ZPN A;  3B2F A;  2WXL A;  1WGR A;  3AV8 A;  2BW2 A;  1K53 A;  3PLU A;  1L4D B;  1E7U A;  4BKS A;  4O1N A;  1SE2 A;  1IGD A;  3D32 A;  4GGQ A;  4UDU C;  4MGK E;  4RFB A;  4W9D A;  1UNS A;  2GBK A;  1V5T A;  2MJ3 A;  3A9K A;  1FXT B;  2WS3 B;  5TSS A;  2VZK D;  1N62 A;  3AEC B;  3KUZ A;  1U4A A;  1DGJ A;  2RMM A;  3RNG C;  3SHQ A;  3PRM B;  1GG3 A;  1E7P B;  2N7J A;  3AE3 B;  4KX6 B;  4EZJ A;  3R2T A;  1IPG A;  3WAL A;  5CHF A;  4B6W A;  4LJP B;  3ZJT A;  4MSQ B;  2N9L A;  3U8Z A;  4M01 A;  2WP9 B;  3A4R A;  1GJZ A;  2HTM E;  2J42 A;  2YEP F;  1GB1 A;  5IN7 A;  4R3D A;  1ZUD 2;  2LZ6 A;  3ZDT A;  4GMV A;  1ET9 A;  1OEY J;  3P63 A;  2ZVN A;  3T3O A;  1ZDX A;  4K1R B;  2K9X A;  2AYO B;  3KWL A;  2KN5 A;  2M56 B;  2RDG A;  1WGH A;  3LYY A;  5D6J B;  1WGY A;  2QC8 A;  2BBC A;  1JWS D;  3KUD B;  4ZOH C;  3W2D A;  2L32 A;  1K50 A;  3RPF C;  4E3C A;  4XWW A;  2CHW A;  4NJC A;  1P98 A;  2IGG A;  1GOZ A;  1WM2 A;  4PS8 A;  1MHX A;  4NJ7 A;  4KV2 A;  5AZF A;  3QCA A;  3MC9 A;  3WAM A;  3AMZ A;  3M63 B;  4ZRQ A;  2D3G A;  3J9C A;  2MSE D;  3NUH B;  4NZL B;  2ZW1 A;  2I1K A;  3ZKJ C;  2LXA A;  3AE9 B;  1K52 A;  4ZRI A;  3X0W A;  4XGA B;  1L4Z B;  3AE7 B;  5HKH A;  4FUL A;  2FCM A;  3SR6 A;  1X1M A;  2L7R A;  3AE1 B;  3RNC C;  4DDI D;  1KJT A;  1L2N A;  1UBQ A;  2BF8 B;  2G4D B;  3V61 A;  1VZ8 A;  3PT2 B;  5IAA C;  5H92 C;  1H4R A;  2EMS A;  3K9O B;  1IYF A;  4ZRK A;  3X23 A;  5HG2 A;  3L4P A;  1RFK A;  4W9C A;  3LB8 C;  1B1Z A;  1OGW A;  3AE8 B;  1QIL A;  2DYO A;  2J0J A;  2RD0 A;  1YN4 A;  4A6Q A;  2WQY B;  3W1Y A;  3DBH B;  4S17 A;  1JCK B;  1QLB B;  4N58 A;  1RFA A;  4NNJ B;  3N1Y C;  3ONS A;  3AE2 B;  2OJR A;  3PGE A;  1V9J A;  2KN4 A;  2WXN A;  2WNM A;  4LNO A;  4A20 A;  1LFD A;  4HWI B;  1J19 A;  2YVC A;  4RF0 A;  2KD0 A;  2K6D B;  2LRW A;  3EGR A;  2KK8 A;  1E6E B;  1ZGU B;  3L17 A;  1E8X A;  5DCN A;  2K22 A;  4WJP A;  2LAS A;  1MG8 A;  3ZNI D;  4OVU A;  5CHW A;  1WXS A;  1EF1 A;  1FD6 A;  3IAM 1;  3UGB B;  3ABV B;  1FPY A;  2DHZ A;  4NAM A;  4OZC A;  1B9R A;  4MJS B;  2MRP A;  2UWQ A;  5FR6 A;  2KWU B;  2N7D A;  2WLB A;  3UIP B;  3NZU A;  1QF6 A;  1I7H A;  2A4Z A;  3AEB B;  4MGZ E;  4KIK A;  3DBL I;  2ON8 A;  2GOW A;  2L0T A;  5KHO A;  5DPR A;  3TJP A;  4HDO A;  4WQO B;  2DNF A;  3TEZ A;  3A33 B;  3MFG A;  4DXF A;  1VZ7 A;  3PZ8 A;  5BO4 B;  1P9D U;  2BT6 A;  3NS8 A;  3Q8E A;  3N9Y C;  1E8W A;  2FIF A;  1WM3 A;  3V3X A;  3ZJV A;  4WWM A;  4A3P A;  4EE2 A;  1TGZ B;  2KFJ A;  3JYU A;  2K6Q A;  1YQ3 B;  2K5P A;  1VZ6 A;  2LRU A;  3LDZ E;  5FK9 C;  1VR9 A;  3H6N A;  2BYT A;  4XZ4 A;  3NZ3 A;  2WU5 B;  4K3C A;  3DPD A;  4KVG B;  2FE8 A;  1V81 A;  1V86 A;  3VRA B;  5GXG B;  4IKG A;  4PK1 A;  3AB5 A;  1WWT A;  3Q3J A;  1Q5W B;  3RFZ B;  1N63 A;  2JXX A;  4NQL B;  3ZGZ A;  1NVI D;  1WSP A;  1SB3 C;  3IVF A;  5FR3 A;  1NDD A;  1E8Y A;  2M8S A;  3CSF A;  1UH6 A;  4LNI A;  2MA9 B;  2MHJ A;  2DZJ A;  3P4Q B;  2KTR B;  5CX3 A;  4BFR A;  4FAD A;  2GBR A;  1PUT A;  3H8H A;  1ROE A;  2NTT A;  4OW0 A;  2WXQ A;  1FO4 A;  2KZR A;  4XWT A;  3SFE B;  3N32 A;  2KWV B;  1PFD A;  4DDG D;  1YN5 A;  4J3O D;  4YTN B;  1QZE A;  3VAW A;  5MPO A;  1WIA A;  1LQB A;  4NJ6 A;  2AEH A;  2WXI A;  3M3J A;  4RM8 A;  2QMT A;  4EOY A;  3W5U B;  1XD3 B;  2GB1 A;  2QEJ C;  1F9J A;  1RWS A;  1SSN A;  2HJ8 A;  4TMA B;  4G0N B;  4OVV A;  1SJH D;  4EZL A;  2JZZ A;  5LNK 1;  1SEB D;  2IO2 B;  1TS4 A;  4KDI C;  3QC8 B;  2W3R A;  1GAQ B;  2UU7 A;  2N1W A;  2LGX A;  3RD2 A;  3NJT A;  3TBL D;  2NMQ A;  4M02 A;  3O65 B;  2FBW B;  3RZF A;  3RNF C;  1AAR A;  1Z5S B;  4AOF A;  3VH3 B;  2LVO A;  4BAX A;  3TEY A;  4K3B A;  2Y5C A;  2G45 B;  4IWQ A;  3RT3 B;  2WDT B;  3ZNH B;  1MVK A;  2O2V B;  1I4G A;  1SGH A;  3APC A;  1FCC C;  2N4F A;  3RCZ A;  4HKZ E;  2EKI A;  3MJ5 A;  4HJG E;  3N1Z C;  3DOW A;  1WZ0 A;  3BZD B;  3ENE A;  4GXB A;  1OFF A;  2V1Y A;  4KKJ A;  2K39 A;  4LDT B;  2MCN B;  4WWO A;  3L10 B;  4M0W B;  2G9H D;  3AUL A;  2BTE A;  2KAJ A;  2IO0 B;  4WUR A;  1E90 A;  4BZA A;  1L0Y B;  3KUC B;  4LCD E;  4GN1 A;  3RYT A;  3VDZ A;  2M1M A;  2AQ2 B;  2VH2 A;  1IGC A;  4JL9 A;  1KLV A;  1WE6 A;  3TL5 A;  4XC2 A;  2C7M B;  3VFK A;  3Q69 A;  2K0P A;  4JWS C;  1KLG D;  3Q3O C;  2CKH B;  1T0R C;  2LGD A;  1V1P A;  2MW5 A;  2W9N A;  3PHX B;  3KLS X;  4BBN F;  1IP9 A;  3DBH I;  2DZM A;  1PGA A; 
#chains in the Genus database with same CATH homology
 4NAW A;  1D3Z A;  4M8N A;  2G3Q B;  1WE7 A;  2DX5 B;  1T0Y A;  2KFK B;  3A4S C;  3NZS A;  3V60 A;  5JH5 C;  1V80 A;  3KUZ A;  1U4A A;  2L8J A;  3SHQ A;  3PRM B;  2KFK A;  1GG3 A;  4DBG A;  4EZJ A;  1G6J A;  1IPG A;  3SU8 X;  3A1Q A;  3WAL A;  5CHF A;  1WMH B;  2AWT A;  3AU4 A;  4B6W A;  2BWF A;  3U7D A;  3TMP B;  1Z2M A;  2R2Q A;  4LJP B;  5J2R A;  2ZPY A;  4MSQ B;  3U8Z A;  1SE9 A;  4IW0 A;  1WXM A;  3A4R A;  2KC1 A;  1GJZ A;  3IFW B;  3V6E B;  3AU5 A;  1WJN A;  4F8C B;  4JGH B;  3ZO5 B;  5IA7 A;  2HE7 A;  2LZ6 A;  3ZDT A;  1C3T A;  4EEW A;  4B95 A;  4WWP A;  4GMV A;  2I1J A;  5KHQ A;  3VTV A;  4GIV A;  3PVL A;  1OEY J;  2ZVN A;  4K1R B;  2AYO B;  2PJH A;  4WAA A;  2KN5 A;  4MSM B;  2CR5 A;  4GDK A;  4YL8 A;  4KZC A;  1WGH A;  3KH0 A;  5D6J B;  2WX1 A;  1NBF C;  4AJY B;  1WGY A;  3KUD B;  4W9G A;  3R7R A;  1WRD B;  2O6V D;  3MHS D;  4GDK B;  2MBQ A;  3QJZ A;  4KSK C;  4E3C A;  2CHW A;  2MP2 B;  4IUM B;  2UYZ B;  3AI5 A;  1P98 A;  1A5R A;  4PS8 A;  1WF9 A;  1WM2 A;  3MTN B;  4NJ7 A;  4LDT D;  3IHP C;  3RZW C;  3OJ4 B;  4KV2 A;  5AZF A;  2DAF A;  3ZDM C;  4BBN C;  3JSV B;  3QCA A;  3B1L X;  4X57 B;  1C1Y B;  3WAM A;  3WAO A;  2C5L C;  3M63 B;  3Q3F A;  2FCQ A;  5G2N A;  4G11 A;  3ZVV A;  3H1U A;  3UF8 A;  4K7U A;  3PRP B;  2V4L A;  3ZNZ B;  2D3G A;  2M0X A;  2REX A;  2MSE D;  4I6L B;  4IWO A;  2GBJ A;  3ZLZ A;  4G3X B;  1KOT A;  1WR6 E;  4W9H A;  4HJK A;  2I1K A;  1VD2 A;  3ZKJ C;  2ZEQ A;  2LXA A;  3C0R B;  2JPH A;  4ZRI A;  1E8Z A;  3X0W A;  1Q0W B;  1RAX A;  5HKH A;  4WJN A;  4FUL A;  2FCM A;  2N9P C;  3HIZ A;  2KLC A;  3QX1 A;  4MGY E;  1X1M A;  2N7E A;  2L7R A;  1YX5 B;  3A1Q B;  3DVN V;  4IM3 A;  4ICV A;  4DDI D;  1KJT A;  5E6O A;  1L2N A;  3W1S A;  2LJ5 A;  1UBQ A;  4TV3 A;  2BF8 B;  2G4D B;  4GOC A;  3V61 A;  4TQ1 A;  1M94 A;  4N9F 4;  1XT9 B;  2CU1 A;  2DEN B;  3PT2 B;  3OLM D;  5IAA C;  4HLE A;  1GC7 A;  4NY0 A;  5G55 A;  1R4N I;  1WJ4 A;  3ECI A;  3VH4 B;  1ZKH A;  2BYV E;  3U30 A;  2IZV B;  1H4R A;  2EMS A;  2N9X A;  3K9O B;  3S2A A;  4ZRK A;  1IYF A;  2MBB B;  3PV1 A;  3X23 A;  3PTF C;  4ANV A;  2KLG A;  3BY4 B;  4FHJ A;  2FCN A;  4K7W A;  2KTF A;  2LI5 A;  4W9C A;  4ZYN A;  1YIW A;  3WA0 A;  1OGW A;  3ZUN A;  1ISN A;  1CMX B;  2DYO A;  2J0J A;  1JRU A;  3QK0 A;  2RD0 A;  5LXH A;  2LGY A;  3W1Y A;  1WGD A;  4W9I A;  2AL3 A;  2KO3 A;  4DHJ B;  2BPS A;  5CHV C;  3B0A A;  1KM7 A;  2L3Z A;  4CHK A;  2NCN A;  3H7P A;  1RFA A;  2GBN A;  4NNJ B;  3RUL A;  1Y8R C;  3ONS A;  5TR5 A;  3VTW A;  1K8R B;  2OJR A;  3L08 A;  3PGE A;  4IM2 A;  3EC8 A;  4AJW A;  1V9J A;  3VUY A;  4W9J A;  4A20 A;  2JF5 A;  2JRI B;  3H7P B;  1LFD A;  1YQB A;  4EKU A;  2IY1 B;  3N3K B;  4HWI B;  3HM3 A;  1UEL A;  4K81 A;  1J19 A;  1XQQ A;  2YVC A;  2KD0 A;  2K6D B;  4IG7 B;  5CTR C;  2LRW A;  2KXJ A;  2LVP A;  2IY0 B;  4RMA A;  2KHW B;  2LVQ A;  3A9J B;  4K7S A;  1BT0 A;  2KK8 A;  4PYU A;  1ZGU B;  4BKT A;  2BWE S;  1E8X A;  2MWS B;  3L17 A;  3M62 B;  5DCN A;  4EZK A;  2M4N A;  4WJP A;  3KW5 B;  2LAS A;  1NI2 A;  1MG8 A;  3ZNI D;  3ZRF A;  3HM6 X;  3ALB A;  2G4S A;  3JVZ X;  1ZW7 A;  2KVR A;  1WXS A;  3M95 A;  4OVU A;  5CHW A;  1EF1 A;  3ZTC A;  1GC6 A;  3KVF B;  2D07 B;  2FCS A;  3UGB B;  4ZRJ A;  2FID A;  2K8H A;  2ZZP B;  3T9L A;  3CF6 E;  1WMH A;  4GSW A;  2DHZ A;  3IBE A;  5E6P A;  4BKS D;  2C7H A;  2PE6 B;  2J0M A;  3PSE B;  2D2Q A;  2KOX A;  2HTH A;  3OAW A;  4TQ0 A;  4MJS B;  3SD5 A;  4KSL C;  1LM8 B;  2MRP A;  2UWQ A;  1I42 A;  2C7N B;  5FR6 A;  2KWU B;  2N7D A;  3UIP B;  2ZNV B;  4GU2 A;  3NZU A;  4PS7 A;  2WX0 A;  4ANU A;  2A4Z A;  4FBJ B;  4MJS A;  2KMA A;  1P1A A;  2KWC A;  4MGZ E;  4HK2 A;  1TTN A;  2RSU A;  4KIK A;  1WFY A;  2DAJ A;  2IO3 B;  3DBL I;  3L16 A;  3NHE B;  2GOW A;  3V62 A;  2NBV B;  5DPS A;  2KJ6 A;  4DK5 A;  4EUT A;  4KDL B;  2PEA A;  1YD8 U;  2L0T A;  2Y5B B;  2B3A A;  5KHO A;  3QAQ A;  5DPR A;  2MLB A;  2YLM A;  3TJP A;  4HDO A;  4WQO B;  3KYC D;  3NOB A;  2CHX A;  4FHK A;  4HPL B;  3A33 B;  4I6P A;  2BYE A;  5D7G A;  1YJ1 A;  2MBO A;  4FJY A;  5BO4 B;  3R7Q A;  3DVN U;  2BKR B;  1WX9 A;  1VCB A;  1P9D U;  2KNB A;  2JRH A;  3NS8 A;  2N9E B;  3DCG A;  4AWJ A;  1E8W A;  4ICU A;  3WIM A;  4PYZ A;  2L0F A;  3GOE A;  4MH0 E;  2KAN A;  2NPT A;  2FIF A;  1WX7 A;  1WM3 A;  4FJV B;  3T8M A;  1H8C A;  2XEW A;  4A3P A;  2KJH B;  1RLF A;  2KDB A;  1TGZ B;  3EEC A;  3VUX A;  4HVB A;  2KFJ A;  4WWN A;  1I35 A;  3JYU A;  2PE9 A;  1S3S G;  2K6Q A;  4FJZ A;  4ASW C;  3DVG Y;  3A9J A;  1WX8 A;  4WJQ A;  2OOB B;  5E6N A;  1V5O A;  2BGF A;  2FAZ A;  1WR1 A;  2LRU A;  3VQI A;  4JQW C;  1E7V A;  2BYF A;  3LDZ E;  2MQJ A;  3H6N A;  2GMI C;  4JIO U;  4XZ4 A;  1P3Q U;  2K25 A;  4DHJ D;  2LXC A;  3EFU A;  3DPD A;  2MX2 A;  4KVG B;  3I3T B;  1J8C A;  4MEM A;  2ZVO A;  3B08 A;  3MJW A;  1V81 A;  2C9W B;  2RR9 A;  3RUI B;  1V86 A;  5JHA A;  1OQY A;  2NS5 A;  5DPW A;  2PPH A;  4TKN A;  2MBE A;  5LLI A;  2K1F A;  2DZI A;  3APD A;  5AZG A;  5AEK B;  3N30 A;  5JZE B;  4MGI E;  4LJO B;  3CMM B;  1RRB A;  1Q5W B;  2J0K A;  2RPQ A;  2ZJD A;  3Q3J A;  4MM3 A;  4WJO A;  5C23 A;  5AZH A;  2JXX A;  1LXD A;  3UIN B;  4HDQ A;  4NQL B;  4FLH A;  3HK0 A;  1GNU A;  3PHW B;  3PS6 A;  3DQV A;  4PS3 A;  4DWF A;  2KMC A;  5C1Z A;  3IVF A;  4B9K A;  3UIO B;  3KYD D;  2WYQ A;  3ZW3 A;  4NPN A;  1NDD A;  3WAN A;  3ML8 A;  2DYB A;  1E8Y A;  3QAR A;  4BOS C;  2M8S A;  5JHB A;  4DHZ B;  1WXV A;  5L95 C;  1WZ3 A;  2KQS A;  3CSF A;  2LWP A;  1UH6 A;  3PZD A;  2CS4 A;  2KTR A;  3DBS A;  2XK5 B;  2NBW B;  2RGF A;  1TZ1 A;  2MA9 B;  3L0W B;  2DZJ A;  4KZ0 A;  1WYW B;  2KQ7 A;  1YX6 B;  3JW0 X;  4M8M A;  2KTR B;  5CX3 A;  3R3M A;  2JT4 B;  3W1S C;  4BFR A;  3NY5 A;  4TUU A;  2O6V A;  4FAD A;  2JVC A;  2GBR A;  1E5W A;  1UZX B;  3QIJ A;  4JLC A;  4BOZ B;  2WWZ A;  4FA6 A;  4W9F A;  3UQA A;  4FN2 A;  2K8C A;  1TBE A;  4W9K A;  3ZRC A;  2M17 A;  2KZR A;  2KDI A;  4HXD A;  2KC2 A;  2AL6 A;  4II3 B;  1OEY A;  2ZCB A;  4URK A;  1Q1O A;  3N32 A;  4II2 B;  2KWV B;  4DDG D;  4F1S A;  1WJ6 A;  1R4M I;  3HHM A;  1HE8 A;  1QZE A;  3VAW A;  4GB9 A;  1WIA A;  1V49 A;  4HCN B;  4G50 A;  1LQB A;  2CHZ A;  4NJ6 A;  2AEH A;  3M3J A;  4RM8 A;  5D94 A;  2FNJ B;  4MDK E;  2NR2 A;  3TIX A;  3L13 A;  4EOY A;  4IC7 B;  4IM0 A;  4A3O A;  1XD3 B;  1EUV B;  1F9J A;  2ASQ A;  4BVU C;  4GDL B;  1PQS A;  2D10 A;  4E71 A;  4ANX A;  2HJ8 A;  3LJ3 A;  5DPT A;  2Z0D B;  2L05 A;  4G0N B;  4OVV A;  3V6C B;  1WGG A;  4EZL A;  3QHT A;  4GDL A;  2NVU I;  1S1Q B;  2GBM A;  2JZZ A;  2Z59 B;  4ANW A;  3ML9 A;  1WXA A;  3A9K B;  3EHV A;  1WH3 A;  4KIK B;  2IO2 B;  1WY8 A;  4RM9 A;  4KDI C;  2KKC A;  3QC8 B;  3AXC A;  3ZIM A;  2K8B A;  1WI0 A;  2DZK A;  5LXI B;  4NAW B;  1V2Y A;  3UQB A;  1WJU A;  3QWZ B;  3VXW A;  2MBH A;  3DVG X;  4CYE A;  2IBI B;  2IO1 B;  2EKE C;  2N1W A;  2VRR B;  2LGX A;  3RD2 A;  1P0R A;  2V3S A;  2JUO A;  3TBL D;  2ZNV C;  4E74 A;  4IWP A;  1V6E A;  3WAP A;  3O65 B;  2C60 A;  2LD9 A;  1J0G A;  4F7Z A;  3RZF A;  3L54 A;  3P2B A;  4EFO A;  4DHZ E;  4NQK E;  5GMV A;  4AP4 C;  1AAR A;  1Z5S B;  4AOF A;  3VH3 B;  4DXA B;  2L00 B;  4XX5 A;  4W9E A;  2LVO A;  2O2V A;  2KDF B;  2R2O A;  2DYM A;  2XK5 A;  3K9P B;  4MEL A;  3ZNG C;  2NPT B;  2J7Q B;  2G45 B;  1GUA B;  3TCA A;  2XBB C;  1EO6 A;  4IWQ A;  3DDC B;  2WDT B;  3PRZ A;  4HPM B;  3RT3 B;  2KJR A;  3ZNH B;  4BKG A;  5L83 A;  2O2V B;  3PPA A;  2BKF A;  1SGH A;  2JWZ A;  2L76 A;  2N4F A;  3APC A;  3RCZ A;  2O6V B;  3APF A;  3BIN A;  3ZTD A;  2FUH B;  3DOW A;  4J6I A;  1WZ0 A;  3ENE A;  4AUQ C;  4GXB A;  2V1Y A;  2IYD B;  3SDL C;  3DBR I;  3IG3 A;  5D2M B;  1UGM A;  2QHO A;  1UD7 A;  5EDS A;  5J18 A;  3VUW A;  4CO7 A;  2JY6 A;  2K39 A;  4ZDV A;  2KDE B;  4LDT B;  4P7I A;  2MCN B;  1L7Y A;  4WWO A;  3L10 B;  3OJ3 A;  3PRE A;  4M0W B;  2MP2 A;  2HD5 B;  3QA8 A;  3AUL A;  1UBI A;  2N1V A;  2IO0 B;  4I6N B;  1SIF A;  4W9L A;  3VHT C;  1E90 A;  3PLV A;  2A5U A;  3VTU A;  3CST A;  2D11 A;  3H9D A;  3R66 C;  3KUC B;  3VVW B;  4LCD E;  2ZPN A;  4GN1 A;  3RYT A;  1OTR B;  1WGR A;  3VDZ A;  3JSV A;  2M1M A;  3PLU A;  2NBU A;  1E7U A;  2JZ3 B;  4BKS A;  4HCP B;  4JL9 A;  1KLV A;  1WE6 A;  3TL5 A;  2LUE A;  3H7S A;  4XC2 A;  2KX0 A;  2C7M B;  3VFK A;  2KX3 A;  2Z0E B;  2ZCC A;  3D32 A;  2CKH B;  3QQ8 B;  4GGQ A;  2LGD A;  2EMT A;  2MW5 A;  4MGK E;  2W9N A;  1EF5 A;  4W9D A;  3A9K A;  2GBK A;  1V5T A;  3PHX B;  3GZN I;  4BBN F;  1IP9 A;  3DBH I;  1FXT B;  5J17 A;  2DZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...