2ZVOB

Nemo cozi domain in complex with diubiquitin in c2 space group
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'GMQLEDLRQQLQQAEEALVAKQELIDKLKEEAAQHAIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/signaling protein
total genus 34
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvoB00
3FX0A 2ZVNB 2ZVOB 4OWFA 2V4HA 3JSVC 4BWNA 3F89A
chains in the Genus database with same CATH superfamily
1BGYD 2AEJA 2YXQB 4B86A 5KLVD 1YHQP 5APWA 1S2EA 2KSEA 1UIIA 2QJYB 2FY8A 2G8YA 1S72P 2MJZA 3KZIH 1FZCB 3V6IA 2ZT9D 3H6PA 1AVYA 1SFCB 3AE2C 1SFCA 1NTZE 1RE3A 1AQTA 3E1RA 1R5LA 5GTHH 1YIJP 3VMXA 1RF0A 1LP1A 3I5CA 2QEXP 1H88A 2LXBA 1SLQA 1KQGB 2V7QH 2IPPA 1FE6A 3W68A 2WPRA 1HUCA 1KMIZ 2E75B 4UB6E 1SQVK 5KAIE 4L76A 1SQQK 2YXRB 2KZIA 3L70E 3V4WA 3H1LD 5AW1B 2KIKA 2A45I 2P67A 4PD4E 2WVRA 2E74C 5KLIB 3SWYA 3RK3B 4NPEA 1X22A 1URQB 2YKQA 1SQPG 1URQA 1ZXGA 3UIAA 3CCMP 1NTKJ 4ASVA 4HB1A 2AEMA 1GK6A 3PP5A 2OYHB 3CC2P 2OYHA 2J58A 2K37A 1NGMB 4UB6H 1IFIA 4CPGA 5KAIH 2D2CD 3E7KA 1L0NG 1ZN5A 3KPEA 4DCKA 1ZOYC 2G3AA 3P8CD 1PGQA 5B5EE 2W6AA 3WUTA 2NPSC 4C46A 2YO3A 1NAFA 2HODB 1A02F 2HODA 3AEFC 4L74A 3D6ZA 4PD4H 3GHGC 1L4AD 3H1LE 2IYPA 3TGUE 1H8AA 1IO4A 3M9QA 1PPJD 3V5BA 1JY2N 4H0LC 2R3SA 1YJWP 1L0LG 2A06G 2PAJA 1XTGB 1QLED 3G6EP 1LTIC 4N6JA 2O1KA 4H44C 2PGDA 3AEDC 1PP9G 1KQLA 2XNDH 3AE9C 2O3JA 1JUNA 3CX5E 1CSBA 3L74E 3SFDC 3L72J 4GIFA 4GDOA 2WSCJ 1JTHA 2FYUD 1NTKG 2KYVA 1U7JA 3P8CE 2M3BA 1FDIA 4D6TG 3LIEA 1S5LX 1TU3F 1GL2D 2BCCJ 2IBZD 3MUDC 1JCCA 1SQPK 4R4LA 2R44A 4W7ZA 1SQVE 3AE1C 2OYOA 1FZBA 5APXA 1SQQE 1NTMJ 1NJIQ 1PPJE 1SQXJ 3CCUP 5AVXB 4LC1A 1SQBG 1N7SC 2N1TC 3L73D 4JBZA 4ASWA 3H1IJ 1KB9D 1EDJA 5M1BA 1SFCD 1L0NK 3B5NC 4PJ0H 1JMMA 3H1HJ 2KNCB 2BASA 1OZHA 3JC22 3BCCD 2M3EA 2QIWA 5B66H 1M90Q 4I1LA 1ZLLA 1VQ9P 4WWIA 1VF5C 2RH0A 2E74B 1DEEG 3H1KJ 3BASA 2JO1A 1KYOI 3MGNA 3N7NA 2Q3EA 5KAFE 1JB0J 1BE3J 3WMM0 2QG4A 2W6BA 2QE7H 3HD7D 1L0LK 2XZRA 5C39A 2E43A 3GF7A 2POHA 3M0AA 4HYTB 1EXIA 3V2PA 3RK3D 1QGKB 2XNXA 1BGYG 1BCCJ 1S1CX 1URQD 5KLVG 1A02J 1SQPD 1RHZB 4N78D 2NPSB 5CCHD 4UB8E 4EOTA 1EDIA 2M8RA 1KFMA 2K9JB 4RO0A 1T3UA 1KB9E 3GHGB 1NTKK 2QA4P 1VQKP 1KILD 4H0LB 3BCCE 1D7MA 3L4FA 1ZR4A 1NU1J 1ZMEC 3IAOA 1CI6B 2AXTE 3AE3C 1CI6A 4KHXA 1XTCC 1YJNP 5APSA 5KJ7D 3H1HG 1LJ2A 4H44B 2O01N 1KN7A 3MIWA 2FXMA 3TK1A 3A0BE 1FZGA 3GW6A 1R5SA 3AE5C 1SQBK 3FWNA 1WRGA 1FJKA 1Q86Q 2WPVB 1K04A 3VMZA 2IFMA 1PFIA 2QJKC 1JM0A 2E75C 1BE3G 4H13D 1JY3N 3BRVB 1VQ5P 2XDJA 1SQPE 5CBOA 5AVUB 4PV1C 4Y99C 3FXDA 1Q82Q 2HR3A 2OARA 2R32A 3WUUA 1L0NE 2ZFCA 2K88A 3Q1MA 1KILE 3RL0C 1NTKD 1FU1A 1NO4A 1CW5A 1DH3A 1OWAA 3AE7C 1FDMA 5KLVK 2Z4EA 1W2EA 3Q2YA 1FZEA 4IFDK 1M7LA 4U3FJ 1JO5A 1N73A 3S4RA 1VF5B 1K9MQ 2HPCB 2ZXXA 4U7JA 2Y9YA 2NRGA 1VQMP 3TSIA 5BU8B 2QSIA 2VRSA 3RL0g 2A06E 3D6YA 3C8VA 5AVWB 5AVTB 3QWOC 2W27A 4JPZB 1PP9E 2WMMA 2HFED 2B87A 4JQ0D 3N4XA 2E74D 2Z5IA 2YMKA 4GODA 3CXHD 2JR8A 5APQA 4I6MC 2FYUG 2R5BA 3HUSA 2LR2A 3L37A 1Q81Q 3RGUA 2WSEJ 4K3AA 3AE6C 1NTKE 4DJGA 3A0HE 3BRTB 1M1JA 4D6TE 2P1JA 3GMAA 3L72D 2KSJA 2H43A 2IBZG 2L91A 1FC2C 3L75J 2NPSD 3RK2C 3Q5RA 1X8YA 3L71J 1S5LE 2BCCD 3OA7A 1HBWA 3FX0A 4IL6H 3AE8C 3L73G 4JYBA 1SQBE 2V4HA 1FS0E 3PLNA 1P84H 4U3FG 1NTMD 4PD4I 4H0LD 1OIPA 1SQXD 1LP1B 3BCCG 2OTKE 1EDKA 1N2DC 3EWKA 2CK3H 2P10A 3L35A 3H1ID 4EYYQ 1U57A 2QJKB 3CXHE 4H44D 1M1KQ 1PZQA 1GW3A 3H1HD 4Z1MH 2W8ZA 3B4SA 3HE4B 3Q5SA 3HE4A 1PIXA 3ZDMA 4PV1B 1QX8A 1EZVI 3AEBC 3LIDA 2CPSA 3A5TA 2Q6QA 5H2FE 4Y99B 3LW5H 3A2AA 3H1JJ 3H1KD 4XA4A 1GK4A 4IFFA 1RQUA 3L72E 5CCGA 3AEGC 2NZ2A 2LXCB 1N86A 1BE3D 1BGYE 4AQRD 3RL0B 4YXWH 4GOEA 5CJ4A 5KLVE 4RJTA 5CBNA 2XKMA 5CMZA 1FBMA 2I1JA 2O1JA 1AJYA 3OAKA 2FYUK 1BCCD 4QMAA 1W2BO 1PGJA 1DD3A 1E79H 5AVVB 3EFGA 2YKPA 3L71G 2I1KA 2V7QJ 2N1TD 1N7SD 3CCQP 3MZWB 1JCDA 3B5ND 4C7NB 4MN4C 4C7NA 3CLQA 1JY2O 3H1HE 2ZVNB 3S1KA 1HGVA 1J1DC 4A7PA 3LW5J 1NU1D 1VF5D 3CMAP 4OGQB 3M9BA 1U7MA 5AVRB 1GMJA 1HGZA 1YITP 3TF5A 1IK7A 2OYIC 1YBKA 1NTZJ 3EFFK 1BE3E 2QM8A 1T8ZA 1IFPA 2JWDA 2KLUA 3BATA 3H1JG 2Q9IA 1NWQA 1IFNA 1IFMA 3AECC 5B5EH 3U59A 1SP4A 1G1JA 5L8RJ 3MP7B 3RK2B 1JTHB 3L70J 1LT9A 4NPDA 3NXSA 5APUA 1VQ6P 5BU5A 2XV5A 2GA1A 3ITKA 4WY4C 3FWLA 2KZJA 3CCEP 1MKMA 3FGAD 5TJHA 4GT1A 2Y0EA 3CC4P 3CX5H 4L73A 4TT3H 4KT0J 3V2NA 5APTA 1MUUA 1SVFA 3MD0A 4U3FD 1N8RQ 1NAYA 1OFCX 1OVRA 3HRNA 5GTIE 1KYOD 3L36A 4YPCA 2E75D 1N73C 2C9LY 2H8PD 3AEEC 3SWKA 4PV1D 2FYUE 3TGUJ 1LNQA 3CWBJ 2WQYC 5APYA 4K35A 4DT0A 1ZV8A 1IJDB 5AW4B 1AVOA 2Y0DA 1AQ5A 5KKZB 3L72G 1LTBC 1LT1A 3GF3A 2KOGA 5BVZA 2IFNA 4JF7A 3RL0D 2QJPC 2IBZE 4ZKUA 1YQ4C 1NYHA 1S3JA 1OX3A 1OMIA 1S9KD 3HUSC 5AVQB 5GTIH 1QL2A 1UIXA 2BCCG 2Q1KA 3L74J 3V4QA 4EIJA 5E79E 3CCLP 2IZ1A 3L73E 4DZOA 1M1JC 1NKZB 3NMDA 1J1DB 3CCSP 1JY2P 5AW0B 4U3FE 4BRYB 1NTMG 3TYYA 4BRYA 3L71D 1AA0A 1SQXG 1ZRTD 1LTAC 5KAFH 2ZYAA 2MKVA 1KYOE 3CL3D 3H1IG 1Y9BA 2ZYDA 1VQPP 2H89C 2B9BA 2JEEA 2OYIB 3G71P 2OYIA 2A45G 5AVSB 3M9HA 2P7JA 4EI2A 1SQVJ 1SQQJ 2B88A 2OQQA 1Q7YQ 3NTNA 1Q90D 1VQ8P 3H1KG 1JY3O 4UB8H 1VQNP 2JJLA 1IFDA 2P58A 3RK3E 2KUBA 1DD4A 1KB9H 1FOSE 2GUVA 2WSFH 1DX7A 4RKUJ 2ZJSE 3C1LA 2Y9ZA 2BEQD 3H1JD 4N78E 1YTZT 1VL2A 1H0TB 1H0TA 3Q3DA 4WY4B 1QEXA 4WY4A 3AE4C 1VDFA 5DJTB 1PGOA 2W6JH 2AXTH 1KD1Q 1BCCG 3WU2E 3RK2D 1PGPA 1K73Q 1BSNA 5CCGC 1T2KC 3IN6A 2YKOA 2O01H 3L71E 1RE4A 3CCVP 3A0BH 1HH0A 1P84D 1KV4A 1L2PA 2FYZA 3HD7C 1GU4A 1Q2NA 4W7YA 1GTWA 2YIUC 4IFMA 1EC5A 1P84I 3CCJP 2JDIH 3H32B 1NU1G 3H32A 3JCUE 5AW8B 1MFTA 1N73B 1DIPA 1LTGC 1G2CA 1GU5A 1PV3A 3M0DA 1HVVA 2Z5HA 1HJ0A 3U1CA 3HE5B 3HE5A 1EXJA 1KQSO 1QVFO 2PP6A 3T97A 1NTMK 1GD2E 1SQXK 1ZW0A 1LTTC 4KJMA 1HWTC 1L4AA 1OW8A 2JP3A 4XFJA 2FFDC 2KP8A 4JYCA 3H1JE 2B87B 3USSA 2P2UA 4RESB 3I55P 4OGQC 2WT7B 2WT7A 2QJPB 1NTZD 3P7KA 1GDTA 2O01J 1Y8AA 1KC8Q 1J1EC 2SPZA 3GG2A 3HUSB 2FXOA 3O6QA 3KZIE 3R2PA 3TNUB 3TNUA 2DW3A 1LTSC 3S9OA 2CPBA 2WSSH 3OW2O 3IFMA 1M1JB 5AVYB 1JEKA 5GTHE 3KDPB 3L70D 3ABVC 2N9YB 1YQ3C 1OW7A 4DOJA 3D70A 2Q5UA 4H13C 5CHXA 1LT9C 2J59M 3KYQA 1RY3A 2Q7CA 4PD4D 1S4XA 1OVVA 5AW6B 2KS1B 2KS1A 3A3YB 3QH9A 1JOCA 3U1AA 1H89A 1L0NJ 3KXDA 1VQ7P 4XE5B 1NHLA 1LTJC 3RBXA 1FZCA 2FBWC 1WMKA 1YJ9P 3A0HH 1JY3P 1EZVD 1G1IA 3FXEA 1KFNA 2HG5D 4OH8B 1IK9A 1X9VA 2YNYA 1NU1K 1JMBA 3VP8A 2QRXA 1FDOA 1EDLA 1USEA 2FXPA 4BWNA 1L0LJ 1S5LH 4LLHA 1MFZA 1VQ4P 1E5WA 3TGUD 2BEZF 3CWBD 2L5GB 3OJAB 3VMYA 3H25A 1RH5B 1PP9J 2RKLA 5KTBA 2QM7A 3G3ZA 3HD7B 5AW3B 4WY4D 3HD7A 5AW9B 2BCCE 2OTLP 3PHLA 4W80A 2YIUB 3RBZA 2WWWA 3L75G 5KKZC 3CXHH 3G9RA 3B71A 1BDCA 3CX5D 1NTME 1HJBA 5TISE 1T6AA 1SQXE 3A7OA 3L74D 5CCHA 2E76C 1GZLA 1NVOA 4D6TJ 3H1IE 5H2FH 3VTPC 3CX5I 1EZVE 2AXCA 2K3RA 1AFOA 3GLMA 1HTLC 2WSCH 2E5TA 2FFDB 2FFDA 2AEFA 1KILB 1KILA 3CD6P 4ZNCA 1RQVA 5APVA 4I7ZC 3H1KE 1SQBJ 2ZAEB 5KJ7A 3SWFA 1J1EB 1SQVD 3PJSK 1VPCA 1SQQD 3W67A 2FYNC 2ZT9C 3CWBE 3VYIA 3CPWO 2C0WA 2WZ7A 4IL6X 4ZKPA 2PFXA 3F89A 5TISH 1PL5A 3MHVA 4Y28J 2E5YA 1BCCE 3KQGA 2KI7B 1RF1C 2YO2A 4H13B 1LT9B 1ZP0C 2QVAA 5AW2B 1FZFA 2A45H 3VN0A 4TLFA 2GUSA 1DEBA 3P32A 3G4SP 4GOFA 4BXLA 2FKWB 2ZVOB 4WBAA 4PJ0E 4AUWA 3JSVC 1Y47A 3CCRP 1EQ7A 4YXDC 5B66E 3Q5PA 1BGYJ 1FJPA 2M0BA 1R8EA 2OGUA 5KLVJ 5AVZB 1LTJB 3D71A 1LTJA 1NU1E 1RE4C 2N9BA 1USDA 4R4MA 1K05A 1WT6A 2E42A 4N3YB 3VP9A 4EDFA 1YYCA 4IOIH 2IX7C 1KQFB 1YTZI 2WITA 4LGDE 1T3JA 4HH2A 1M56D 1IC2A 3R4YA 2D2CC 5CJ0A 3V2RA 1FAVA 2IBZI 2KK7A 1M8OB 1LWUC 3M0DC 3IF4A 1NTZG 1NKNA 2KNCA 2KB7P 2JWAA 1KTMA 2I8DA 3H1LJ 1KB9I 5AW5B 1L4AC 1VQLP 5CCGD 1T2KD 1K8AQ 2W90A 5EFWB 1X0TA 3L70G 3SFEC 3SSUA 5K5GB 3VOPA 1NH4A 2H88C 4OVNF 3C9IA 2E76B 3CC7P 3M06A 2OTJP 1BDDA 1QL1A 2WPSA 2R5DA 2J5UA 4C7RA 3L75D 2GM4A 1J2JB 2NPSA 4I7ZB 4HKZH 3PRJA 2K9JA 1FOSF 2ZYGA 3GHGA 1EZVG 2WPQA 2FYNB 4AYCA 2ZT9B 1KZUB 1SS1A 1GL2C 1L0ND 4OGQD 3BVHA 5DJUB 2ITAA 3CMEP 2QJYC 2B89A 1FZCC 1RF1B 1RF1A 2K1AA 2KXPB 3TDKA 3H1LG 5E79H 3TGUG 1KORA 3CWBG 3HTKB 1SFCC 3HTKA 1RE3C 4WB4A 4WVZA 2RMZA 1RF0C 2HYNA 1FZAA 1S9KE 1X79B 1L0LD 1NTZK 2A06D 1N7LA 3MTUE 1KYOH 4M3LA 1QVGO 2LKMA 1M57D 2R3CA 1W5CE 3L75E 4ZMDA 1NOHA 2Q3IA 1PP9D 2FYUJ 3PTZA 4I2LC 3II6A 1YI2P 3L74G 2C9NY 1ZRTE 2IZ0A 1OW6A 3MUDA 3PH0A 3IR9A 1OXZA 2W83C 1Z56A 4L75A 2D2CB 5KLIC 3RK3C 2IDBA 3VMAA 3CI9A 2YMYA 1URQC 2N1TB 1N7SB 1LGHB 2N1TA 1N7SA 3F5HA 4OWFA 2WSEH 2C0XA 4GKGA 4D6TD 1G2CB 1LWUB 1LWUA 3B5NB 2JKVA 3B5NA 2IYOA 5CCHC 3L73J 2OYHC 2HLOA 3T97B 1SQVG 2WSFJ 3WUVA 2PRRA 2WTYA 1SQQG 3WU2H 1VQOP 3M91A 1PPJG 1L4AB 3BCCJ 3AEAC 1HF9A 3E1IA 1MV8A 2M5AB 2HPCA 1KILC 2M5AA 1SQBD 2Y0CA 3K5BA 1L0LE 3V2QA 2K9YA 3I56P 5KJ7C 4O9BA 2UWJE 4HJGH 3B8EB 1MZ9A 1IZNB 3KHUA 4YTPC 3O6QB 3O8ZA 4IL6E 2KLVA 1JNMA 1ZR2A 2RN0A 3JCUH 1P84E 4NPFX 3NFQA 2XU6A 2ZXEB 1CZQA 2E76D 3CXHI 1GW4A 1OVUA 1SQPJ 1IFJA 1BSHA 1AV1A 3EQ2A 3P8MC 1GL2B 1GL2A 2H7HA 5AW7B
chains in the Genus database with same CATH topology
3FX0A 2ZVNB 2ZVOB 4OWFA 2V4HA 3JSVC 4BWNA 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX0 A;  2ZVN B;  2ZVO B;  4OWF A;  2V4H A;  3JSV C;  4BWN A;  3F89 A; 
#chains in the Genus database with same CATH topology
 1BGY D;  2AEJ A;  2YXQ B;  4B86 A;  5KLV D;  1YHQ P;  5APW A;  1S2E A;  2KSE A;  1UII A;  2QJY B;  2FY8 A;  2G8Y A;  1S72 P;  2MJZ A;  3KZI H;  1FZC B;  3V6I A;  2ZT9 D;  3H6P A;  1AVY A;  1SFC B;  3AE2 C;  1SFC A;  1NTZ E;  1RE3 A;  1AQT A;  3E1R A;  1R5L A;  5GTH H;  1YIJ P;  3VMX A;  1RF0 A;  1LP1 A;  3I5C A;  2QEX P;  1H88 A;  2LXB A;  1SLQ A;  1KQG B;  2V7Q H;  2IPP A;  1FE6 A;  3W68 A;  2WPR A;  1HUC A;  1KMI Z;  2E75 B;  4UB6 E;  1SQV K;  5KAI E;  4L76 A;  1SQQ K;  2YXR B;  2KZI A;  3L70 E;  3V4W A;  3H1L D;  5AW1 B;  2KIK A;  2A45 I;  2P67 A;  4PD4 E;  2WVR A;  2E74 C;  5KLI B;  3SWY A;  3RK3 B;  4NPE A;  1X22 A;  1URQ B;  2YKQ A;  1SQP G;  1URQ A;  1ZXG A;  3UIA A;  3CCM P;  1NTK J;  4ASV A;  4HB1 A;  2AEM A;  1GK6 A;  3PP5 A;  2OYH B;  3CC2 P;  2OYH A;  2J58 A;  2K37 A;  1NGM B;  4UB6 H;  1IFI A;  4CPG A;  5KAI H;  2D2C D;  3E7K A;  1L0N G;  1ZN5 A;  3KPE A;  4DCK A;  1ZOY C;  2G3A A;  3P8C D;  1PGQ A;  5B5E E;  2W6A A;  3WUT A;  2NPS C;  4C46 A;  2YO3 A;  1NAF A;  2HOD B;  1A02 F;  2HOD A;  3AEF C;  4L74 A;  3D6Z A;  4PD4 H;  3GHG C;  1L4A D;  3H1L E;  2IYP A;  3TGU E;  1H8A A;  1IO4 A;  3M9Q A;  1PPJ D;  3V5B A;  1JY2 N;  4H0L C;  2R3S A;  1YJW P;  1L0L G;  2A06 G;  2PAJ A;  1XTG B;  1QLE D;  3G6E P;  1LTI C;  4N6J A;  2O1K A;  4H44 C;  2PGD A;  3AED C;  1PP9 G;  1KQL A;  2XND H;  3AE9 C;  2O3J A;  1JUN A;  3CX5 E;  1CSB A;  3L74 E;  3SFD C;  3L72 J;  4GIF A;  4GDO A;  2WSC J;  1JTH A;  2FYU D;  1NTK G;  2KYV A;  1U7J A;  3P8C E;  2M3B A;  1FDI A;  4D6T G;  3LIE A;  1S5L X;  1TU3 F;  1GL2 D;  2BCC J;  2IBZ D;  3MUD C;  1JCC A;  1SQP K;  4R4L A;  2R44 A;  4W7Z A;  1SQV E;  3AE1 C;  2OYO A;  1FZB A;  5APX A;  1SQQ E;  1NTM J;  1NJI Q;  1PPJ E;  1SQX J;  3CCU P;  5AVX B;  4LC1 A;  1SQB G;  1N7S C;  2N1T C;  3L73 D;  4JBZ A;  4ASW A;  3H1I J;  1KB9 D;  1EDJ A;  5M1B A;  1SFC D;  1L0N K;  3B5N C;  4PJ0 H;  1JMM A;  3H1H J;  2KNC B;  2BAS A;  1OZH A;  3JC2 2;  3BCC D;  2M3E A;  2QIW A;  5B66 H;  1M90 Q;  4I1L A;  1ZLL A;  1VQ9 P;  4WWI A;  1VF5 C;  2RH0 A;  2E74 B;  1DEE G;  3H1K J;  3BAS A;  2JO1 A;  1KYO I;  3MGN A;  3N7N A;  2Q3E A;  5KAF E;  1JB0 J;  1BE3 J;  3WMM 0;  2QG4 A;  2W6B A;  2QE7 H;  3HD7 D;  1L0L K;  2XZR A;  5C39 A;  2E43 A;  3GF7 A;  2POH A;  3M0A A;  4HYT B;  1EXI A;  3V2P A;  3RK3 D;  1QGK B;  2XNX A;  1BGY G;  1BCC J;  1S1C X;  1URQ D;  5KLV G;  1A02 J;  1SQP D;  1RHZ B;  4N78 D;  2NPS B;  5CCH D;  4UB8 E;  4EOT A;  1EDI A;  2M8R A;  1KFM A;  2K9J B;  4RO0 A;  1T3U A;  1KB9 E;  3GHG B;  1NTK K;  2QA4 P;  1VQK P;  1KIL D;  4H0L B;  3BCC E;  1D7M A;  3L4F A;  1ZR4 A;  1NU1 J;  1ZME C;  3IAO A;  1CI6 B;  2AXT E;  3AE3 C;  1CI6 A;  4KHX A;  1XTC C;  1YJN P;  5APS A;  5KJ7 D;  3H1H G;  1LJ2 A;  4H44 B;  2O01 N;  1KN7 A;  3MIW A;  2FXM A;  3TK1 A;  3A0B E;  1FZG A;  3GW6 A;  1R5S A;  3AE5 C;  1SQB K;  3FWN A;  1WRG A;  1FJK A;  1Q86 Q;  2WPV B;  1K04 A;  3VMZ A;  2IFM A;  1PFI A;  2QJK C;  1JM0 A;  2E75 C;  1BE3 G;  4H13 D;  1JY3 N;  3BRV B;  1VQ5 P;  2XDJ A;  1SQP E;  5CBO A;  5AVU B;  4PV1 C;  4Y99 C;  3FXD A;  1Q82 Q;  2HR3 A;  2OAR A;  2R32 A;  3WUU A;  1L0N E;  2ZFC A;  2K88 A;  3Q1M A;  1KIL E;  3RL0 C;  1NTK D;  1FU1 A;  1NO4 A;  1CW5 A;  1DH3 A;  1OWA A;  3AE7 C;  1FDM A;  5KLV K;  2Z4E A;  1W2E A;  3Q2Y A;  1FZE A;  4IFD K;  1M7L A;  4U3F J;  1JO5 A;  1N73 A;  3S4R A;  1VF5 B;  1K9M Q;  2HPC B;  2ZXX A;  4U7J A;  2Y9Y A;  2NRG A;  1VQM P;  3TSI A;  5BU8 B;  2QSI A;  2VRS A;  3RL0 g;  2A06 E;  3D6Y A;  3C8V A;  5AVW B;  5AVT B;  3QWO C;  2W27 A;  4JPZ B;  1PP9 E;  2WMM A;  2HFE D;  2B87 A;  4JQ0 D;  3N4X A;  2E74 D;  2Z5I A;  2YMK A;  4GOD A;  3CXH D;  2JR8 A;  5APQ A;  4I6M C;  2FYU G;  2R5B A;  3HUS A;  2LR2 A;  3L37 A;  1Q81 Q;  3RGU A;  2WSE J;  4K3A A;  3AE6 C;  1NTK E;  4DJG A;  3A0H E;  3BRT B;  1M1J A;  4D6T E;  2P1J A;  3GMA A;  3L72 D;  2KSJ A;  2H43 A;  2IBZ G;  2L91 A;  1FC2 C;  3L75 J;  2NPS D;  3RK2 C;  3Q5R A;  1X8Y A;  3L71 J;  1S5L E;  2BCC D;  3OA7 A;  1HBW A;  3FX0 A;  4IL6 H;  3AE8 C;  3L73 G;  4JYB A;  1SQB E;  2V4H A;  1FS0 E;  3PLN A;  1P84 H;  4U3F G;  1NTM D;  4PD4 I;  4H0L D;  1OIP A;  1SQX D;  1LP1 B;  3BCC G;  2OTK E;  1EDK A;  1N2D C;  3EWK A;  2CK3 H;  2P10 A;  3L35 A;  3H1I D;  4EYY Q;  1U57 A;  2QJK B;  3CXH E;  4H44 D;  1M1K Q;  1PZQ A;  1GW3 A;  3H1H D;  4Z1M H;  2W8Z A;  3B4S A;  3HE4 B;  3Q5S A;  3HE4 A;  1PIX A;  3ZDM A;  4PV1 B;  1QX8 A;  1EZV I;  3AEB C;  3LID A;  2CPS A;  3A5T A;  2Q6Q A;  5H2F E;  4Y99 B;  3LW5 H;  3A2A A;  3H1J J;  3H1K D;  4XA4 A;  1GK4 A;  4IFF A;  1RQU A;  3L72 E;  5CCG A;  3AEG C;  2NZ2 A;  2LXC B;  1N86 A;  1BE3 D;  1BGY E;  4AQR D;  3RL0 B;  4YXW H;  4GOE A;  5CJ4 A;  5KLV E;  4RJT A;  5CBN A;  2XKM A;  5CMZ A;  1FBM A;  2I1J A;  2O1J A;  1AJY A;  3OAK A;  2FYU K;  1BCC D;  4QMA A;  1W2B O;  1PGJ A;  1DD3 A;  1E79 H;  5AVV B;  3EFG A;  2YKP A;  3L71 G;  2I1K A;  2V7Q J;  2N1T D;  1N7S D;  3CCQ P;  3MZW B;  1JCD A;  3B5N D;  4C7N B;  4MN4 C;  4C7N A;  3CLQ A;  1JY2 O;  3H1H E;  2ZVN B;  3S1K A;  1HGV A;  1J1D C;  4A7P A;  3LW5 J;  1NU1 D;  1VF5 D;  3CMA P;  4OGQ B;  3M9B A;  1U7M A;  5AVR B;  1GMJ A;  1HGZ A;  1YIT P;  3TF5 A;  1IK7 A;  2OYI C;  1YBK A;  1NTZ J;  3EFF K;  1BE3 E;  2QM8 A;  1T8Z A;  1IFP A;  2JWD A;  2KLU A;  3BAT A;  3H1J G;  2Q9I A;  1NWQ A;  1IFN A;  1IFM A;  3AEC C;  5B5E H;  3U59 A;  1SP4 A;  1G1J A;  5L8R J;  3MP7 B;  3RK2 B;  1JTH B;  3L70 J;  1LT9 A;  4NPD A;  3NXS A;  5APU A;  1VQ6 P;  5BU5 A;  2XV5 A;  2GA1 A;  3ITK A;  4WY4 C;  3FWL A;  2KZJ A;  3CCE P;  1MKM A;  3FGA D;  5TJH A;  4GT1 A;  2Y0E A;  3CC4 P;  3CX5 H;  4L73 A;  4TT3 H;  4KT0 J;  3V2N A;  5APT A;  1MUU A;  1SVF A;  3MD0 A;  4U3F D;  1N8R Q;  1NAY A;  1OFC X;  1OVR A;  3HRN A;  5GTI E;  1KYO D;  3L36 A;  4YPC A;  2E75 D;  1N73 C;  2C9L Y;  2H8P D;  3AEE C;  3SWK A;  4PV1 D;  2FYU E;  3TGU J;  1LNQ A;  3CWB J;  2WQY C;  5APY A;  4K35 A;  4DT0 A;  1ZV8 A;  1IJD B;  5AW4 B;  1AVO A;  2Y0D A;  1AQ5 A;  5KKZ B;  3L72 G;  1LTB C;  1LT1 A;  3GF3 A;  2KOG A;  5BVZ A;  2IFN A;  4JF7 A;  3RL0 D;  2QJP C;  2IBZ E;  4ZKU A;  1YQ4 C;  1NYH A;  1S3J A;  1OX3 A;  1OMI A;  1S9K D;  3HUS C;  5AVQ B;  5GTI H;  1QL2 A;  1UIX A;  2BCC G;  2Q1K A;  3L74 J;  3V4Q A;  4EIJ A;  5E79 E;  3CCL P;  2IZ1 A;  3L73 E;  4DZO A;  1M1J C;  1NKZ B;  3NMD A;  1J1D B;  3CCS P;  1JY2 P;  5AW0 B;  4U3F E;  4BRY B;  1NTM G;  3TYY A;  4BRY A;  3L71 D;  1AA0 A;  1SQX G;  1ZRT D;  1LTA C;  5KAF H;  2ZYA A;  2MKV A;  1KYO E;  3CL3 D;  3H1I G;  1Y9B A;  2ZYD A;  1VQP P;  2H89 C;  2B9B A;  2JEE A;  2OYI B;  3G71 P;  2OYI A;  2A45 G;  5AVS B;  3M9H A;  2P7J A;  4EI2 A;  1SQV J;  1SQQ J;  2B88 A;  2OQQ A;  1Q7Y Q;  3NTN A;  1Q90 D;  1VQ8 P;  3H1K G;  1JY3 O;  4UB8 H;  1VQN P;  2JJL A;  1IFD A;  2P58 A;  3RK3 E;  2KUB A;  1DD4 A;  1KB9 H;  1FOS E;  2GUV A;  2WSF H;  1DX7 A;  4RKU J;  2ZJS E;  3C1L A;  2Y9Z A;  2BEQ D;  3H1J D;  4N78 E;  1YTZ T;  1VL2 A;  1H0T B;  1H0T A;  3Q3D A;  4WY4 B;  1QEX A;  4WY4 A;  3AE4 C;  1VDF A;  5DJT B;  1PGO A;  2W6J H;  2AXT H;  1KD1 Q;  1BCC G;  3WU2 E;  3RK2 D;  1PGP A;  1K73 Q;  1BSN A;  5CCG C;  1T2K C;  3IN6 A;  2YKO A;  2O01 H;  3L71 E;  1RE4 A;  3CCV P;  3A0B H;  1HH0 A;  1P84 D;  1KV4 A;  1L2P A;  2FYZ A;  3HD7 C;  1GU4 A;  1Q2N A;  4W7Y A;  1GTW A;  2YIU C;  4IFM A;  1EC5 A;  1P84 I;  3CCJ P;  2JDI H;  3H32 B;  1NU1 G;  3H32 A;  3JCU E;  5AW8 B;  1MFT A;  1N73 B;  1DIP A;  1LTG C;  1G2C A;  1GU5 A;  1PV3 A;  3M0D A;  1HVV A;  2Z5H A;  1HJ0 A;  3U1C A;  3HE5 B;  3HE5 A;  1EXJ A;  1KQS O;  1QVF O;  2PP6 A;  3T97 A;  1NTM K;  1GD2 E;  1SQX K;  1ZW0 A;  1LTT C;  4KJM A;  1HWT C;  1L4A A;  1OW8 A;  2JP3 A;  4XFJ A;  2FFD C;  2KP8 A;  4JYC A;  3H1J E;  2B87 B;  3USS A;  2P2U A;  4RES B;  3I55 P;  4OGQ C;  2WT7 B;  2WT7 A;  2QJP B;  1NTZ D;  3P7K A;  1GDT A;  2O01 J;  1Y8A A;  1KC8 Q;  1J1E C;  2SPZ A;  3GG2 A;  3HUS B;  2FXO A;  3O6Q A;  3KZI E;  3R2P A;  3TNU B;  3TNU A;  2DW3 A;  1LTS C;  3S9O A;  2CPB A;  2WSS H;  3OW2 O;  3IFM A;  1M1J B;  5AVY B;  1JEK A;  5GTH E;  3KDP B;  3L70 D;  3ABV C;  2N9Y B;  1YQ3 C;  1OW7 A;  4DOJ A;  3D70 A;  2Q5U A;  4H13 C;  5CHX A;  1LT9 C;  2J59 M;  3KYQ A;  1RY3 A;  2Q7C A;  4PD4 D;  1S4X A;  1OVV A;  5AW6 B;  2KS1 B;  2KS1 A;  3A3Y B;  3QH9 A;  1JOC A;  3U1A A;  1H89 A;  1L0N J;  3KXD A;  1VQ7 P;  4XE5 B;  1NHL A;  1LTJ C;  3RBX A;  1FZC A;  2FBW C;  1WMK A;  1YJ9 P;  3A0H H;  1JY3 P;  1EZV D;  1G1I A;  3FXE A;  1KFN A;  2HG5 D;  4OH8 B;  1IK9 A;  1X9V A;  2YNY A;  1NU1 K;  1JMB A;  3VP8 A;  2QRX A;  1FDO A;  1EDL A;  1USE A;  2FXP A;  4BWN A;  1L0L J;  1S5L H;  4LLH A;  1MFZ A;  1VQ4 P;  1E5W A;  3TGU D;  2BEZ F;  3CWB D;  2L5G B;  3OJA B;  3VMY A;  3H25 A;  1RH5 B;  1PP9 J;  2RKL A;  5KTB A;  2QM7 A;  3G3Z A;  3HD7 B;  5AW3 B;  4WY4 D;  3HD7 A;  5AW9 B;  2BCC E;  2OTL P;  3PHL A;  4W80 A;  2YIU B;  3RBZ A;  2WWW A;  3L75 G;  5KKZ C;  3CXH H;  3G9R A;  3B71 A;  1BDC A;  3CX5 D;  1NTM E;  1HJB A;  5TIS E;  1T6A A;  1SQX E;  3A7O A;  3L74 D;  5CCH A;  2E76 C;  1GZL A;  1NVO A;  4D6T J;  3H1I E;  5H2F H;  3VTP C;  3CX5 I;  1EZV E;  2AXC A;  2K3R A;  1AFO A;  3GLM A;  1HTL C;  2WSC H;  2E5T A;  2FFD B;  2FFD A;  2AEF A;  1KIL B;  1KIL A;  3CD6 P;  4ZNC A;  1RQV A;  5APV A;  4I7Z C;  3H1K E;  1SQB J;  2ZAE B;  5KJ7 A;  3SWF A;  1J1E B;  1SQV D;  3PJS K;  1VPC A;  1SQQ D;  3W67 A;  2FYN C;  2ZT9 C;  3CWB E;  3VYI A;  3CPW O;  2C0W A;  2WZ7 A;  4IL6 X;  4ZKP A;  2PFX A;  3F89 A;  5TIS H;  1PL5 A;  3MHV A;  4Y28 J;  2E5Y A;  1BCC E;  3KQG A;  2KI7 B;  1RF1 C;  2YO2 A;  4H13 B;  1LT9 B;  1ZP0 C;  2QVA A;  5AW2 B;  1FZF A;  2A45 H;  3VN0 A;  4TLF A;  2GUS A;  1DEB A;  3P32 A;  3G4S P;  4GOF A;  4BXL A;  2FKW B;  2ZVO B;  4WBA A;  4PJ0 E;  4AUW A;  3JSV C;  1Y47 A;  3CCR P;  1EQ7 A;  4YXD C;  5B66 E;  3Q5P A;  1BGY J;  1FJP A;  2M0B A;  1R8E A;  2OGU A;  5KLV J;  5AVZ B;  1LTJ B;  3D71 A;  1LTJ A;  1NU1 E;  1RE4 C;  2N9B A;  1USD A;  4R4M A;  1K05 A;  1WT6 A;  2E42 A;  4N3Y B;  3VP9 A;  4EDF A;  1YYC A;  4IOI H;  2IX7 C;  1KQF B;  1YTZ I;  2WIT A;  4LGD E;  1T3J A;  4HH2 A;  1M56 D;  1IC2 A;  3R4Y A;  2D2C C;  5CJ0 A;  3V2R A;  1FAV A;  2IBZ I;  2KK7 A;  1M8O B;  1LWU C;  3M0D C;  3IF4 A;  1NTZ G;  1NKN A;  2KNC A;  2KB7 P;  2JWA A;  1KTM A;  2I8D A;  3H1L J;  1KB9 I;  5AW5 B;  1L4A C;  1VQL P;  5CCG D;  1T2K D;  1K8A Q;  2W90 A;  5EFW B;  1X0T A;  3L70 G;  3SFE C;  3SSU A;  5K5G B;  3VOP A;  1NH4 A;  2H88 C;  4OVN F;  3C9I A;  2E76 B;  3CC7 P;  3M06 A;  2OTJ P;  1BDD A;  1QL1 A;  2WPS A;  2R5D A;  2J5U A;  4C7R A;  3L75 D;  2GM4 A;  1J2J B;  2NPS A;  4I7Z B;  4HKZ H;  3PRJ A;  2K9J A;  1FOS F;  2ZYG A;  3GHG A;  1EZV G;  2WPQ A;  2FYN B;  4AYC A;  2ZT9 B;  1KZU B;  1SS1 A;  1GL2 C;  1L0N D;  4OGQ D;  3BVH A;  5DJU B;  2ITA A;  3CME P;  2QJY C;  2B89 A;  1FZC C;  1RF1 B;  1RF1 A;  2K1A A;  2KXP B;  3TDK A;  3H1L G;  5E79 H;  3TGU G;  1KOR A;  3CWB G;  3HTK B;  1SFC C;  3HTK A;  1RE3 C;  4WB4 A;  4WVZ A;  2RMZ A;  1RF0 C;  2HYN A;  1FZA A;  1S9K E;  1X79 B;  1L0L D;  1NTZ K;  2A06 D;  1N7L A;  3MTU E;  1KYO H;  4M3L A;  1QVG O;  2LKM A;  1M57 D;  2R3C A;  1W5C E;  3L75 E;  4ZMD A;  1NOH A;  2Q3I A;  1PP9 D;  2FYU J;  3PTZ A;  4I2L C;  3II6 A;  1YI2 P;  3L74 G;  2C9N Y;  1ZRT E;  2IZ0 A;  1OW6 A;  3MUD A;  3PH0 A;  3IR9 A;  1OXZ A;  2W83 C;  1Z56 A;  4L75 A;  2D2C B;  5KLI C;  3RK3 C;  2IDB A;  3VMA A;  3CI9 A;  2YMY A;  1URQ C;  2N1T B;  1N7S B;  1LGH B;  2N1T A;  1N7S A;  3F5H A;  4OWF A;  2WSE H;  2C0X A;  4GKG A;  4D6T D;  1G2C B;  1LWU B;  1LWU A;  3B5N B;  2JKV A;  3B5N A;  2IYO A;  5CCH C;  3L73 J;  2OYH C;  2HLO A;  3T97 B;  1SQV G;  2WSF J;  3WUV A;  2PRR A;  2WTY A;  1SQQ G;  3WU2 H;  1VQO P;  3M91 A;  1PPJ G;  1L4A B;  3BCC J;  3AEA C;  1HF9 A;  3E1I A;  1MV8 A;  2M5A B;  2HPC A;  1KIL C;  2M5A A;  1SQB D;  2Y0C A;  3K5B A;  1L0L E;  3V2Q A;  2K9Y A;  3I56 P;  5KJ7 C;  4O9B A;  2UWJ E;  4HJG H;  3B8E B;  1MZ9 A;  1IZN B;  3KHU A;  4YTP C;  3O6Q B;  3O8Z A;  4IL6 E;  2KLV A;  1JNM A;  1ZR2 A;  2RN0 A;  3JCU H;  1P84 E;  4NPF X;  3NFQ A;  2XU6 A;  2ZXE B;  1CZQ A;  2E76 D;  3CXH I;  1GW4 A;  1OVU A;  1SQP J;  1IFJ A;  1BSH A;  1AV1 A;  3EQ2 A;  3P8M C;  1GL2 B;  1GL2 A;  2H7H A;  5AW7 B; 
#chains in the Genus database with same CATH homology
 3FX0 A;  2ZVN B;  2ZVO B;  4OWF A;  2V4H A;  3JSV C;  4BWN A;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...