2ZVOB

Nemo cozi domain in complex with diubiquitin in c2 space group
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
GMQLEDLRQQLQQAEEALVAKQELIDKLKEEAAQHAIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBC protein
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/signaling protein
total genus 34
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 2zvoB00
3FX0A 3JSVC 2ZVNB 2ZVOB 4OWFA 2V4HA 4BWNA 3F89A
chains in the Genus database with same CATH superfamily
1LWUA 1SQPE 2IFNA 3M0AA 5AVXB 3GLMA 4BWNA 1ZXGA 5AW3B 4I6MC 3E1IA 2M0BA 2KXPB 1LT9A 1FJPA 3B5NB 3A3YB 3CX5E 1JTHA 3G9RA 3CCEP 1OFCX 3HUSA 1M1JA 3NMDA 3RK2D 1IK7A 3CXHI 1EZVD 4LLHA 1UIIA 1NTZG 1IZNB 2YKPA 1URQC 3V2RA 1GW3A 4JYCA 2E74D 1NWQA 2FYUG 1HH0A 2WITA 5AVTB 2OYIC 2BCCE 1OX3A 5AVSB 1NTMK 2V7QH 2GA1A 1SQPD 2PAJA 4JBZA 3CMAP 2GUSA 2Y0CA 4N6JA 3TNUB 3H1HE 1SQVE 1X0TA 3RL0B 4JYBA 1L0NE 3CX5D 3GHGA 2Y9ZA 3HE5B 3CC4P 4L76A 3BVHA 2N1TA 5DJUB 3L73E 4RKUJ 2KZJA 1LWUB 1JCCA 2RH0A 4UB6H 5KKZC 2IBZI 4XA4A 4C7NA 4DJGA 2IPPA 1MFTA 2ZXXA 1X8YA 2KLUA 1S5LE 4NPFX 1LJ2A 3SWFA 1T8ZA 3MIWA 1SQVD 1BE3E 2QVAA 2P10A 4Y99B 2WSCJ 1FZEA 3CWBE 3KHUA 1S5LX 1GDTA 1K8AQ 3L73D 1GW4A 3ABVC 1OW6A 2MKVA 2N9YB 1SQBD 2I1JA 2WSEJ 1QGKB 3EQ2A 3AE4C 2K37A 5APTA 2GUVA 3N4XA 2M8RA 2Q3IA 1NU1G 4C7RA 4CPGA 1KB9E 5KLIB 2JR8A 1KTMA 3CX5H 1USDA 1KV4A 4K35A 3GHGB 3AEBC 2G8YA 3WU2E 1RQVA 1SQBJ 3IN6A 1NAYA 3H1KG 1AQTA 5AW1B 3M06A 2LXCB 2J5UA 2YO2A 2JP3A 1R5SA 4PV1D 3VMAA 1OVUA 1AVOA 1BDCA 4WVZA 2FKWB 2O01N 2FBWC 1SQXE 2ZYGA 2NPSA 1Q81Q 1N2DC 1LTJB 5KLIC 1KB9D 1ZOYC 4XE5B 3H1IE 2QRXA 1SQVK 2FYUJ 3AEFC 3TF5A 3MUDA 2FXMA 3CCRP 1ZP0C 1AJYA 3PLNA 2AEJA 1NKNA 3VYIA 1UIXA 3F5HA 3IF4A 1SQBK 3LIDA 2OTJP 4EI2A 2AXTH 1J1EB 4WY4A 1VQ4P 1Q86Q 1NTKE 5KJ7A 2OGUA 1S5LH 1SQXD 3F89A 3CC2P 1LTJC 4WBAA 5AVRB 4U3FG 3H1ID 3H25A 2IDBA 3VP9A 5BU8B 1PL5A 4NPEA 2KSJA 1OXZA 2FYUK 4IFDK 1L4AD 2VRSA 3JC22 4OGQD 1QX8A 3H1IJ 3RGUA 1KMIZ 5APWA 1IFNA 3GW6A 2M3BA 1J1EC 3LW5H 1N7SA 1KB9H 4OWFA 1NU1D 1IK9A 3WU2H 2OYHC 1Y9BA 4HYTB 1QVFO 2E76B 3TYYA 1NYHA 3SWKA 4PD4D 5TJHA 5APUA 1NU1J 3N7NA 2KS1A 3A5TA 2C0XA 2Y0EA 1VQ6P 1FZCB 4LC1A 2E42A 3FX0A 2W6BA 1AA0A 4TT3H 1SFCB 4IFMA 3H1KJ 2Y0DA 2H88C 2O1KA 2Q9IA 5CCGD 5BU5A 2KOGA 5B5EE 1KILC 4PJ0H 1FBMA 1VQ5P 1QL1A 4AYCA 1EQ7A 4UB8H 2E76C 1U7MA 1RF0C 3HTKA 2WWWA 3H1LE 3Q5PA 1KQLA 3AEDC 2M5AB 1FC2C 5CCHC 1FZCC 1IFPA 1XTGB 4H0LD 5KLVE 1QL2A 3UIAA 2QJYC 3HD7D 1NU1K 2XV5A 1PGQA 1EDJA 2V4HA 3Q3DA 4RESB 5CCHD 3JSVC 2XNXA 3FWLA 3CPWO 1YJ9P 1MUUA 1ZV8A 3H1LD 2QG4A 4Y28J 1ZLLA 2C9NY 1KYOD 4GOFA 3L70G 2YIUB 5KLVD 3IAOA 1YQ4C 1A02F 1HUCA 2IBZG 3H1LJ 3E7KA 5EFWB 4D6TG 4QMAA 5BVZA 3Q2YA 2YNYA 1BCCE 2JDIH 3KYQA 1L2PA 2P1JA 3L75E 3AE9C 1S9KE 4OH8B 3R4YA 2Y9YA 1OW8A 1LTGC 1NTME 2W83C 1RF1A 2LXBA 1M90Q 3AECC 1BGYD 1FE6A 1E79H 1YTZI 5B5EH 1ZRTE 2OQQA 1HTLC 1P84D 1K04A 4IL6E 2KZIA 1GK6A 2E75D 5AW6B 2IZ1A 3CD6P 2ZVNB 2YMKA 3H32A 1BGYJ 1H0TB 4L73A 1BCCD 3L72E 2ZT9D 4IL6X 3L75D 3KPEA 2Q3EA 1S9KD 4R4MA 4H44B 4NPDA 1VF5C 3L36A 1NTMD 2O01H 1DD4A 4UB6E 1AV1A 2HPCA 3KXDA 5KLVK 3Q5RA 3RK2B 3A0BE 3CL3D 1HVVA 5AVZB 2B9BA 1ZRTD 4RJTA 2BCCG 3H1JD 2JJLA 1VQ7P 1LP1B 3PHLA 2ZYDA 1KQFB 4H13B 3O6QA 3SSUA 4RO0A 4GT1A 1N86A 2FFDC 1VQOP 3H1HG 3R2PA 1RE3C 3L72D 1RF1B 1YIJP 1L0NG 4H44C 4XFJA 2H8PD 3H1JJ 1VQNP 1P84H 1NAFA 2CPBA 1Z56A 3GF3A 5AVWB 5APSA 1PPJG 3WMM0 3L72J 1J1DB 3AE8C 2XZRA 3SFDC 2Z5HA 4N78E 3AE3C 1PIXA 1GL2C 1BE3G 2RMZA 3G71P 2BEZF 2KP8A 1Y47A 3CWBG 3TDKA 1QEXA 1PV3A 1URQD 1M1KQ 4IL6H 3B5NC 1YI2P 1JM0A 1GL2D 1K05A 3IFMA 3CCSP 1RH5B 2K9JB 3V2PA 1VQPP 1SQBE 4BRYB 1W2EA 4N78D 2SPZA 2P2UA 4MN4C 2W6JH 4OVNF 3A2AA 3B5ND 3L74D 2D2CB 1JY3P 1LT9B 2AXTE 2IYOA 3BCCG 1JTHB 3A0BH 1KQGB 3HUSB 1M1JB 5APXA 3QWOC 1YQ3C 1PP9D 2A45H 4KJMA 4W7YA 1G2CA 3RL0C 3BRTB 3L74J 1NTZE 4ASWA 1EZVI 2I8DA 1GMJA 1L0LG 1T3UA 3FGAD 4N3YB 1Q2NA 2FYUE 1SQQD 3SWYA 1JY3N 1L4AA 3QH9A 1PP9J 2CPSA 1LWUC 2QJKB 1M8OB 3RL0D 5APQA 1OZHA 1LT9C 3CCQP 4JQ0D 5CJ4A 3HE4A 4ASVA 2KNCA 3HUSC 1SQQJ 1PPJD 1JY3O 2E43A 2N1TB 5C39A 2FYNB 4Y99C 2NRGA 3CX5I 1NTZD 2JO1A 3I5CA 1NOHA 3B71A 2WSCH 1YJNP 2OYHA 3G4SP 2AEFA 3M9BA 2FYUD 3MP7B 4C7NB 2MJZA 1JY2P 2QJKC 1GD2E 3VTPC 2WSEH 2BEQD 1NTZJ 5CCGA 1LTSC 4W80A 1G2CB 3V4QA 4PJ0E 4GODA 3GHGC 1WRGA 2P7JA 3PRJA 4HJGH 1RHZB 2PGDA 2WVRA 4L75A 4UB8E 2N1TC 2FYNC 1NHLA 1Q90D 1LNQA 3CMEP 2YKOA 4OGQB 1SQQK 4GKGA 1JY2N 1MFZA 2IZ0A 2ZXEB 1PZQA 3P8CD 1IFIA 1NU1E 5GTIE 3HD7A 3EWKA 2KIKA 1OVRA 3FXEA 2B87A 2WPVB 3H1KE 3HRNA 4EYYQ 5CCHA 1JY2O 4PD4E 2I1KA 4YXDC 3OAKA 4W7ZA 3I55P 1NTZK 3H6PA 3P8MC 1L0LD 3B8EB 3BCCJ 2DW3A 3D70A 3TGUG 3CCVP 5CHXA 1KZUB 2NPSB 1M7LA 1FZFA 4L74A 2Z4EA 1L0LJ 1KD1Q 1QVGO 3RK3B 2P67A 1KB9I 3USSA 3H1KD 1IFDA 5TISE 1EC5A 1U57A 2A06G 1KILE 1FDIA 1NGMB 1X22A 1N73A 1CZQA 3B4SA 3EFGA 2YO3A 2PRRA 1VQ8P 4WY4B 4DZOA 3MGNA 5DJTB 2NPSC 2B87B 5AW0B 1PGOA 4B86A 1S72P 1J2JB 2KB7P 1HWTC 3RK3C 2BASA 3AE7C 3L71G 3L35A 1JMMA 1L0LK 3S1KA 1BDDA 1KILD 1KYOE 3V4WA 3M0DA 1N7SB 1VQLP 2E76D 1VDFA 5GTIH 4WY4C 5KJ7C 1SFCC 1QLED 1DX7A 2K1AA 1KC8Q 4DT0A 2YXQB 4PD4H 2H89C 3A0HE 4U3FD 2QA4P 4GOEA 1Y8AA 3PH0A 1SFCD 4I7ZB 3ZDMA 2KS1B 1DD3A 4R4LA 3CI9A 1T2KC 3MZWB 1CSBA 4GDOA 3TSIA 1BGYE 2AXCA 3TGUD 4U3FJ 2JKVA 1AFOA 1P84E 2FFDA 2Q5UA 3CCLP 1RE3A 2E75B 1T2KD 1S3JA 2LKMA 2KK7A 3HTKB 5TISH 3TGUJ 2ZT9B 3KZIE 2E5YA 3MTUE 1YJWP 3BASA 3FWNA 5CBOA 1EZVG 1BSHA 2QJPB 1RE4C 4LGDE 2Z5IA 1G1JA 4YTPC 3PP5A 2QM8A 1FU1A 1URQA 2WPQA 2ZJSE 1RY3A 1S2EA 3GG2A 1DH3A 1SVFA 2G3AA 2YXRB 2YIUC 3H1JE 3S9OA 2OYIA 1GL2A 1SQPG 2P58A 2WSFJ 1NO4A 1GTWA 1PFIA 4U7JA 5AW7B 3CXHD 1NJIQ 1FS0E 1KYOH 1OW7A 1ZW0A 1CW5A 2XU6A 5KAIE 1JUNA 1DIPA 4HB1A 1JO5A 2OYOA 3L70E 1EDLA 2H43A 3L4FA 1KYOI 3PTZA 2IBZE 1LGHB 1EXJA 2QM7A 1VF5D 3A0HH 1KQSO 3A7OA 1FAVA 2IX7C 1Q7YQ 4I2LC 2E74B 2R44A 1AVYA 4KHXA 4IFFA 1HGZA 3K5BA 3BRVB 1SQVG 2ITAA 2J59M 5K5GB 3TNUA 3W68A 2WT7A 3PJSK 3M9QA 2HLOA 3U1CA 2RN0A 1H89A 2Q6QA 1RQUA 3HE5A 1S1CX 3L73G 2OYIB 2V7QJ 1SQBG 3L70D 1HJBA 2N9BA 2CK3H 3C9IA 3RK2C 1JOCA 1R5LA 2IBZD 2E5TA 3JCUE 3LIEA 4H44D 1P84I 1X9VA 3H32B 3OW2O 4D6TD 3TK1A 3KZIH 3CXHH 1KORA 3MHVA 3SFEC 4H13C 1LTIC 2AEMA 2R32A 2PP6A 2E74C 2WPSA 1W2BO 1BSNA 2XKMA 3L70J 3I56P 3L74E 3VOPA 1U7JA 1RF1C 3NTNA 3P7KA 3M91A 2HPCB 1NKZB 4D6TJ 5CBNA 2K88A 4H13D 1PP9E 2WTYA 3V2QA 1SS1A 1AQ5A 1FJKA 3OA7A 5KKZB 3O6QB 4I1LA 5AVUB 4HKZH 1J1DC 5AW9B 1K73Q 3C1LA 2HR3A 1FZAA 4ZKPA 2K9YA 1SQQE 5CJ0A 2WT7B 1FDMA 3AEEC 2ZFCA 3L37A 5KAIH 2WSSH 1LTTC 3AEGC 3S4RA 1YHQP 1FZGA 1SQPJ 2QIWA 4IOIH 2KSEA 1PPJE 4EIJA 1GK4A 5E79E 2BCCD 2HYNA 3VP8A 4JF7A 1SQXG 1IO4A 1DEEG 2JWDA 4PV1B 2A45I 2OTKE 3H1IG 1LTJA 1PGJA 3H1HD 3RL0g 3D71A 2FY8A 1E5WA 3WUUA 1L0ND 3RBZA 2D2CC 2BCCJ 1MZ9A 2KLVA 1M1JC 1CI6A 3JCUH 3H1HJ 1SQVJ 3G6EP 1ZR4A 4KT0J 1L0NJ 1SQPK 3T97A 2D2CD 1NTKG 1GZLA 3IR9A 4EDFA 3L73J 4PV1C 3P8CE 1N7LA 5GTHE 1BE3D 1IFMA 3CWBD 1FDOA 3E1RA 1OIPA 3U1AA 2ZYAA 3BCCE 2OARA 2ZAEB 5B66E 4EOTA 1ZN5A 2IFMA 1OMIA 3V6IA 4YXWH 3V2NA 1BE3J 2IYPA 2L5GB 1VPCA 5KAFE 4A7PA 3CWBJ 5KTBA 1L0LE 1L4AB 1H88A 2RKLA 1KILA 2QEXP 1LT1A 1L0NK 1YBKA 3AE1C 3G3ZA 1RF0A 4AQRD 3HE4B 2N1TD 4K3AA 5AVQB 1T6AA 3FXDA 2KNCB 1CI6B 3BCCD 3LW5J 5AW4B 1R8EA 5H2FE 3AE5C 1T3JA 4C46A 2R3SA 4DCKA 5E79H 3T97B 4ZNCA 2K3RA 1FZCA 2R5BA 3GMAA 3MD0A 2HFED 1DEBA 3WUTA 1SFCA 2OYHB 2W8ZA 3CLQA 2R5DA 1L4AC 4OGQC 2M3EA 1JMBA 2XDJA 4AUWA 4ZKUA 2POHA 1PGPA 3H1LG 2KI7B 3ITKA 4ZMDA 4WWIA 3W67A 1ZR2A 1SQXJ 3VN0A 1FOSE 2JEEA 5AVYB 2M5AA 4HH2A 1X79B 1KN7A 2HODA 1IFJA 1OWAA 5KLVG 5AW5B 1FOSF 1W5CE 2O1JA 3WUVA 1VQKP 1KILB 1NTKD 3BATA 5AW8B 3O8ZA 2J58A 1JNMA 5GTHH 3RK3E 4DOJA 1ZMEC 1SLQA 4H0LB 2WMMA 1G1IA 3HD7B 1IC2A 4M3LA 4WB4A 5CCGC 1GU4A 1YYCA 1NTKJ 5B66H 1YTZT 1N8RQ 5AVVB 3CCJP 3OJAB 4U3FE 1RE4A 1BGYG 1KFNA 3MUDC 2QJYB 5KAFH 1HF9A 2XNDH 1JB0J 2NPSD 1SQXK 2H7HA 4JPZB 4YPCA 3TGUE 1IJDB 1EXIA 1MV8A 3RK3D 3D6YA 4H0LC 1BCCG 3HD7C 3L75G 1WT6A 5H2FH 2WZ7A 2O3JA 1Q82Q 5CMZA 3VMXA 1NTMG 2HODB 4GIFA 2Q7CA 3KQGA 3NXSA 1M56D 2WQYC 2UWJE 4WY4D 1GU5A 5KJ7D 2WPRA 1N73B 5L8RJ 2A06E 1NTKK 1YITP 4Z1MH 2W90A 1M57D 4PD4I 3H1JG 1EDIA 1S4XA 2L91A 1TU3F 1NH4A 3GF7A 1N7SC 3AE2C 3L72G 1H0TA 2QSIA 3RBXA 2QE7H 3AE6C 1N7SD 1VQ9P 3CXHE 3L71E 3KDPB 2W27A 1VL2A 1N73C 4I7ZC 1EDKA 1H8AA 2A06D 2JWAA 3M9HA 2A45G 1LTBC 3VMZA 1KFMA 5APYA 1LP1A 2O01J 5KLVJ 1VF5B 1D7MA 3V5BA 5M1BA 2LR2A 2C0WA 3CCMP 2FXOA 1JCDA 2E75C 2YKQA 2B89A 1JEKA 1K9MQ 1XTCC 2ZT9C 4TLFA 2B88A 3L71D 1HBWA 3C8VA 5APVA 3B5NA 3Q5SA 2KUBA 2R3CA 1FZBA 2YMYA 3M0DC 3D6ZA 2QJPC 2ZVOB 2FFDB 2FYZA 1OVVA 1HGVA 1A02J 2NZ2A 1SP4A 3L74G 3L71J 1LTAC 4D6TE 3CC7P 1MKMA 1HJ0A 3II6A 2KYVA 3Q1MA 2OTLP 4O9BA 3U59A 1USEA 1BCCJ 1PP9G 3EFFK 3L75J 2WSFH 1EZVE 2C9LY 2GM4A 2PFXA 2FXPA 1WMKA 3AEAC 3P32A 3CCUP 1NTMJ 1URQB 3NFQA 1NVOA 3VMYA 1SQQG 2Q1KA 1VQMP 2W6AA 5AW2B 1GL2B 2K9JA 4BXLA 4BRYA 2HG5D
chains in the Genus database with same CATH topology
3FX0A 3JSVC 2ZVNB 2ZVOB 4OWFA 2V4HA 4BWNA 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX0 A;  3JSV C;  2ZVN B;  2ZVO B;  4OWF A;  2V4H A;  4BWN A;  3F89 A; 
#chains in the Genus database with same CATH topology
 1LWU A;  1SQP E;  2IFN A;  3M0A A;  5AVX B;  3GLM A;  4BWN A;  1ZXG A;  5AW3 B;  4I6M C;  3E1I A;  2M0B A;  2KXP B;  1LT9 A;  1FJP A;  3B5N B;  3A3Y B;  3CX5 E;  1JTH A;  3G9R A;  3CCE P;  1OFC X;  3HUS A;  1M1J A;  3NMD A;  3RK2 D;  1IK7 A;  3CXH I;  1EZV D;  4LLH A;  1UII A;  1NTZ G;  1IZN B;  2YKP A;  1URQ C;  3V2R A;  1GW3 A;  4JYC A;  2E74 D;  1NWQ A;  2FYU G;  1HH0 A;  2WIT A;  5AVT B;  2OYI C;  2BCC E;  1OX3 A;  5AVS B;  1NTM K;  2V7Q H;  2GA1 A;  1SQP D;  2PAJ A;  4JBZ A;  3CMA P;  2GUS A;  2Y0C A;  4N6J A;  3TNU B;  3H1H E;  1SQV E;  1X0T A;  3RL0 B;  4JYB A;  1L0N E;  3CX5 D;  3GHG A;  2Y9Z A;  3HE5 B;  3CC4 P;  4L76 A;  3BVH A;  2N1T A;  5DJU B;  3L73 E;  4RKU J;  2KZJ A;  1LWU B;  1JCC A;  2RH0 A;  4UB6 H;  5KKZ C;  2IBZ I;  4XA4 A;  4C7N A;  4DJG A;  2IPP A;  1MFT A;  2ZXX A;  1X8Y A;  2KLU A;  1S5L E;  4NPF X;  1LJ2 A;  3SWF A;  1T8Z A;  3MIW A;  1SQV D;  1BE3 E;  2QVA A;  2P10 A;  4Y99 B;  2WSC J;  1FZE A;  3CWB E;  3KHU A;  1S5L X;  1GDT A;  1K8A Q;  3L73 D;  1GW4 A;  3ABV C;  1OW6 A;  2MKV A;  2N9Y B;  1SQB D;  2I1J A;  2WSE J;  1QGK B;  3EQ2 A;  3AE4 C;  2K37 A;  5APT A;  2GUV A;  3N4X A;  2M8R A;  2Q3I A;  1NU1 G;  4C7R A;  4CPG A;  1KB9 E;  5KLI B;  2JR8 A;  1KTM A;  3CX5 H;  1USD A;  1KV4 A;  4K35 A;  3GHG B;  3AEB C;  2G8Y A;  3WU2 E;  1RQV A;  1SQB J;  3IN6 A;  1NAY A;  3H1K G;  1AQT A;  5AW1 B;  3M06 A;  2LXC B;  2J5U A;  2YO2 A;  2JP3 A;  1R5S A;  4PV1 D;  3VMA A;  1OVU A;  1AVO A;  1BDC A;  4WVZ A;  2FKW B;  2O01 N;  2FBW C;  1SQX E;  2ZYG A;  2NPS A;  1Q81 Q;  1N2D C;  1LTJ B;  5KLI C;  1KB9 D;  1ZOY C;  4XE5 B;  3H1I E;  2QRX A;  1SQV K;  2FYU J;  3AEF C;  3TF5 A;  3MUD A;  2FXM A;  3CCR P;  1ZP0 C;  1AJY A;  3PLN A;  2AEJ A;  1NKN A;  3VYI A;  1UIX A;  3F5H A;  3IF4 A;  1SQB K;  3LID A;  2OTJ P;  4EI2 A;  2AXT H;  1J1E B;  4WY4 A;  1VQ4 P;  1Q86 Q;  1NTK E;  5KJ7 A;  2OGU A;  1S5L H;  1SQX D;  3F89 A;  3CC2 P;  1LTJ C;  4WBA A;  5AVR B;  4U3F G;  3H1I D;  3H25 A;  2IDB A;  3VP9 A;  5BU8 B;  1PL5 A;  4NPE A;  2KSJ A;  1OXZ A;  2FYU K;  4IFD K;  1L4A D;  2VRS A;  3JC2 2;  4OGQ D;  1QX8 A;  3H1I J;  3RGU A;  1KMI Z;  5APW A;  1IFN A;  3GW6 A;  2M3B A;  1J1E C;  3LW5 H;  1N7S A;  1KB9 H;  4OWF A;  1NU1 D;  1IK9 A;  3WU2 H;  2OYH C;  1Y9B A;  4HYT B;  1QVF O;  2E76 B;  3TYY A;  1NYH A;  3SWK A;  4PD4 D;  5TJH A;  5APU A;  1NU1 J;  3N7N A;  2KS1 A;  3A5T A;  2C0X A;  2Y0E A;  1VQ6 P;  1FZC B;  4LC1 A;  2E42 A;  3FX0 A;  2W6B A;  1AA0 A;  4TT3 H;  1SFC B;  4IFM A;  3H1K J;  2Y0D A;  2H88 C;  2O1K A;  2Q9I A;  5CCG D;  5BU5 A;  2KOG A;  5B5E E;  1KIL C;  4PJ0 H;  1FBM A;  1VQ5 P;  1QL1 A;  4AYC A;  1EQ7 A;  4UB8 H;  2E76 C;  1U7M A;  1RF0 C;  3HTK A;  2WWW A;  3H1L E;  3Q5P A;  1KQL A;  3AED C;  2M5A B;  1FC2 C;  5CCH C;  1FZC C;  1IFP A;  1XTG B;  4H0L D;  5KLV E;  1QL2 A;  3UIA A;  2QJY C;  3HD7 D;  1NU1 K;  2XV5 A;  1PGQ A;  1EDJ A;  2V4H A;  3Q3D A;  4RES B;  5CCH D;  3JSV C;  2XNX A;  3FWL A;  3CPW O;  1YJ9 P;  1MUU A;  1ZV8 A;  3H1L D;  2QG4 A;  4Y28 J;  1ZLL A;  2C9N Y;  1KYO D;  4GOF A;  3L70 G;  2YIU B;  5KLV D;  3IAO A;  1YQ4 C;  1A02 F;  1HUC A;  2IBZ G;  3H1L J;  3E7K A;  5EFW B;  4D6T G;  4QMA A;  5BVZ A;  3Q2Y A;  2YNY A;  1BCC E;  2JDI H;  3KYQ A;  1L2P A;  2P1J A;  3L75 E;  3AE9 C;  1S9K E;  4OH8 B;  3R4Y A;  2Y9Y A;  1OW8 A;  1LTG C;  1NTM E;  2W83 C;  1RF1 A;  2LXB A;  1M90 Q;  3AEC C;  1BGY D;  1FE6 A;  1E79 H;  1YTZ I;  5B5E H;  1ZRT E;  2OQQ A;  1HTL C;  1P84 D;  1K04 A;  4IL6 E;  2KZI A;  1GK6 A;  2E75 D;  5AW6 B;  2IZ1 A;  3CD6 P;  2ZVN B;  2YMK A;  3H32 A;  1BGY J;  1H0T B;  4L73 A;  1BCC D;  3L72 E;  2ZT9 D;  4IL6 X;  3L75 D;  3KPE A;  2Q3E A;  1S9K D;  4R4M A;  4H44 B;  4NPD A;  1VF5 C;  3L36 A;  1NTM D;  2O01 H;  1DD4 A;  4UB6 E;  1AV1 A;  2HPC A;  3KXD A;  5KLV K;  3Q5R A;  3RK2 B;  3A0B E;  3CL3 D;  1HVV A;  5AVZ B;  2B9B A;  1ZRT D;  4RJT A;  2BCC G;  3H1J D;  2JJL A;  1VQ7 P;  1LP1 B;  3PHL A;  2ZYD A;  1KQF B;  4H13 B;  3O6Q A;  3SSU A;  4RO0 A;  4GT1 A;  1N86 A;  2FFD C;  1VQO P;  3H1H G;  3R2P A;  1RE3 C;  3L72 D;  1RF1 B;  1YIJ P;  1L0N G;  4H44 C;  4XFJ A;  2H8P D;  3H1J J;  1VQN P;  1P84 H;  1NAF A;  2CPB A;  1Z56 A;  3GF3 A;  5AVW B;  5APS A;  1PPJ G;  3WMM 0;  3L72 J;  1J1D B;  3AE8 C;  2XZR A;  3SFD C;  2Z5H A;  4N78 E;  3AE3 C;  1PIX A;  1GL2 C;  1BE3 G;  2RMZ A;  3G71 P;  2BEZ F;  2KP8 A;  1Y47 A;  3CWB G;  3TDK A;  1QEX A;  1PV3 A;  1URQ D;  1M1K Q;  4IL6 H;  3B5N C;  1YI2 P;  1JM0 A;  1GL2 D;  1K05 A;  3IFM A;  3CCS P;  1RH5 B;  2K9J B;  3V2P A;  1VQP P;  1SQB E;  4BRY B;  1W2E A;  4N78 D;  2SPZ A;  2P2U A;  4MN4 C;  2W6J H;  4OVN F;  3A2A A;  3B5N D;  3L74 D;  2D2C B;  1JY3 P;  1LT9 B;  2AXT E;  2IYO A;  3BCC G;  1JTH B;  3A0B H;  1KQG B;  3HUS B;  1M1J B;  5APX A;  3QWO C;  1YQ3 C;  1PP9 D;  2A45 H;  4KJM A;  4W7Y A;  1G2C A;  3RL0 C;  3BRT B;  3L74 J;  1NTZ E;  4ASW A;  1EZV I;  2I8D A;  1GMJ A;  1L0L G;  1T3U A;  3FGA D;  4N3Y B;  1Q2N A;  2FYU E;  1SQQ D;  3SWY A;  1JY3 N;  1L4A A;  3QH9 A;  1PP9 J;  2CPS A;  1LWU C;  2QJK B;  1M8O B;  3RL0 D;  5APQ A;  1OZH A;  1LT9 C;  3CCQ P;  4JQ0 D;  5CJ4 A;  3HE4 A;  4ASV A;  2KNC A;  3HUS C;  1SQQ J;  1PPJ D;  1JY3 O;  2E43 A;  2N1T B;  5C39 A;  2FYN B;  4Y99 C;  2NRG A;  3CX5 I;  1NTZ D;  2JO1 A;  3I5C A;  1NOH A;  3B71 A;  2WSC H;  1YJN P;  2OYH A;  3G4S P;  2AEF A;  3M9B A;  2FYU D;  3MP7 B;  4C7N B;  2MJZ A;  1JY2 P;  2QJK C;  1GD2 E;  3VTP C;  2WSE H;  2BEQ D;  1NTZ J;  5CCG A;  1LTS C;  4W80 A;  1G2C B;  3V4Q A;  4PJ0 E;  4GOD A;  3GHG C;  1WRG A;  2P7J A;  3PRJ A;  4HJG H;  1RHZ B;  2PGD A;  2WVR A;  4L75 A;  4UB8 E;  2N1T C;  2FYN C;  1NHL A;  1Q90 D;  1LNQ A;  3CME P;  2YKO A;  4OGQ B;  1SQQ K;  4GKG A;  1JY2 N;  1MFZ A;  2IZ0 A;  2ZXE B;  1PZQ A;  3P8C D;  1IFI A;  1NU1 E;  5GTI E;  3HD7 A;  3EWK A;  2KIK A;  1OVR A;  3FXE A;  2B87 A;  2WPV B;  3H1K E;  3HRN A;  4EYY Q;  5CCH A;  1JY2 O;  4PD4 E;  2I1K A;  4YXD C;  3OAK A;  4W7Z A;  3I55 P;  1NTZ K;  3H6P A;  3P8M C;  1L0L D;  3B8E B;  3BCC J;  2DW3 A;  3D70 A;  3TGU G;  3CCV P;  5CHX A;  1KZU B;  2NPS B;  1M7L A;  1FZF A;  4L74 A;  2Z4E A;  1L0L J;  1KD1 Q;  1QVG O;  3RK3 B;  2P67 A;  1KB9 I;  3USS A;  3H1K D;  1IFD A;  5TIS E;  1EC5 A;  1U57 A;  2A06 G;  1KIL E;  1FDI A;  1NGM B;  1X22 A;  1N73 A;  1CZQ A;  3B4S A;  3EFG A;  2YO3 A;  2PRR A;  1VQ8 P;  4WY4 B;  4DZO A;  3MGN A;  5DJT B;  2NPS C;  2B87 B;  5AW0 B;  1PGO A;  4B86 A;  1S72 P;  1J2J B;  2KB7 P;  1HWT C;  3RK3 C;  2BAS A;  3AE7 C;  3L71 G;  3L35 A;  1JMM A;  1L0L K;  3S1K A;  1BDD A;  1KIL D;  1KYO E;  3V4W A;  3M0D A;  1N7S B;  1VQL P;  2E76 D;  1VDF A;  5GTI H;  4WY4 C;  5KJ7 C;  1SFC C;  1QLE D;  1DX7 A;  2K1A A;  1KC8 Q;  4DT0 A;  2YXQ B;  4PD4 H;  2H89 C;  3A0H E;  4U3F D;  2QA4 P;  4GOE A;  1Y8A A;  3PH0 A;  1SFC D;  4I7Z B;  3ZDM A;  2KS1 B;  1DD3 A;  4R4L A;  3CI9 A;  1T2K C;  3MZW B;  1CSB A;  4GDO A;  3TSI A;  1BGY E;  2AXC A;  3TGU D;  4U3F J;  2JKV A;  1AFO A;  1P84 E;  2FFD A;  2Q5U A;  3CCL P;  1RE3 A;  2E75 B;  1T2K D;  1S3J A;  2LKM A;  2KK7 A;  3HTK B;  5TIS H;  3TGU J;  2ZT9 B;  3KZI E;  2E5Y A;  3MTU E;  1YJW P;  3BAS A;  3FWN A;  5CBO A;  1EZV G;  1BSH A;  2QJP B;  1RE4 C;  4LGD E;  2Z5I A;  1G1J A;  4YTP C;  3PP5 A;  2QM8 A;  1FU1 A;  1URQ A;  2WPQ A;  2ZJS E;  1RY3 A;  1S2E A;  3GG2 A;  1DH3 A;  1SVF A;  2G3A A;  2YXR B;  2YIU C;  3H1J E;  3S9O A;  2OYI A;  1GL2 A;  1SQP G;  2P58 A;  2WSF J;  1NO4 A;  1GTW A;  1PFI A;  4U7J A;  5AW7 B;  3CXH D;  1NJI Q;  1FS0 E;  1KYO H;  1OW7 A;  1ZW0 A;  1CW5 A;  2XU6 A;  5KAI E;  1JUN A;  1DIP A;  4HB1 A;  1JO5 A;  2OYO A;  3L70 E;  1EDL A;  2H43 A;  3L4F A;  1KYO I;  3PTZ A;  2IBZ E;  1LGH B;  1EXJ A;  2QM7 A;  1VF5 D;  3A0H H;  1KQS O;  3A7O A;  1FAV A;  2IX7 C;  1Q7Y Q;  4I2L C;  2E74 B;  2R44 A;  1AVY A;  4KHX A;  4IFF A;  1HGZ A;  3K5B A;  3BRV B;  1SQV G;  2ITA A;  2J59 M;  5K5G B;  3TNU A;  3W68 A;  2WT7 A;  3PJS K;  3M9Q A;  2HLO A;  3U1C A;  2RN0 A;  1H89 A;  2Q6Q A;  1RQU A;  3HE5 A;  1S1C X;  3L73 G;  2OYI B;  2V7Q J;  1SQB G;  3L70 D;  1HJB A;  2N9B A;  2CK3 H;  3C9I A;  3RK2 C;  1JOC A;  1R5L A;  2IBZ D;  2E5T A;  3JCU E;  3LIE A;  4H44 D;  1P84 I;  1X9V A;  3H32 B;  3OW2 O;  4D6T D;  3TK1 A;  3KZI H;  3CXH H;  1KOR A;  3MHV A;  3SFE C;  4H13 C;  1LTI C;  2AEM A;  2R32 A;  2PP6 A;  2E74 C;  2WPS A;  1W2B O;  1BSN A;  2XKM A;  3L70 J;  3I56 P;  3L74 E;  3VOP A;  1U7J A;  1RF1 C;  3NTN A;  3P7K A;  3M91 A;  2HPC B;  1NKZ B;  4D6T J;  5CBN A;  2K88 A;  4H13 D;  1PP9 E;  2WTY A;  3V2Q A;  1SS1 A;  1AQ5 A;  1FJK A;  3OA7 A;  5KKZ B;  3O6Q B;  4I1L A;  5AVU B;  4HKZ H;  1J1D C;  5AW9 B;  1K73 Q;  3C1L A;  2HR3 A;  1FZA A;  4ZKP A;  2K9Y A;  1SQQ E;  5CJ0 A;  2WT7 B;  1FDM A;  3AEE C;  2ZFC A;  3L37 A;  5KAI H;  2WSS H;  1LTT C;  3AEG C;  3S4R A;  1YHQ P;  1FZG A;  1SQP J;  2QIW A;  4IOI H;  2KSE A;  1PPJ E;  4EIJ A;  1GK4 A;  5E79 E;  2BCC D;  2HYN A;  3VP8 A;  4JF7 A;  1SQX G;  1IO4 A;  1DEE G;  2JWD A;  4PV1 B;  2A45 I;  2OTK E;  3H1I G;  1LTJ A;  1PGJ A;  3H1H D;  3RL0 g;  3D71 A;  2FY8 A;  1E5W A;  3WUU A;  1L0N D;  3RBZ A;  2D2C C;  2BCC J;  1MZ9 A;  2KLV A;  1M1J C;  1CI6 A;  3JCU H;  3H1H J;  1SQV J;  3G6E P;  1ZR4 A;  4KT0 J;  1L0N J;  1SQP K;  3T97 A;  2D2C D;  1NTK G;  1GZL A;  3IR9 A;  4EDF A;  3L73 J;  4PV1 C;  3P8C E;  1N7L A;  5GTH E;  1BE3 D;  1IFM A;  3CWB D;  1FDO A;  3E1R A;  1OIP A;  3U1A A;  2ZYA A;  3BCC E;  2OAR A;  2ZAE B;  5B66 E;  4EOT A;  1ZN5 A;  2IFM A;  1OMI A;  3V6I A;  4YXW H;  3V2N A;  1BE3 J;  2IYP A;  2L5G B;  1VPC A;  5KAF E;  4A7P A;  3CWB J;  5KTB A;  1L0L E;  1L4A B;  1H88 A;  2RKL A;  1KIL A;  2QEX P;  1LT1 A;  1L0N K;  1YBK A;  3AE1 C;  3G3Z A;  1RF0 A;  4AQR D;  3HE4 B;  2N1T D;  4K3A A;  5AVQ B;  1T6A A;  3FXD A;  2KNC B;  1CI6 B;  3BCC D;  3LW5 J;  5AW4 B;  1R8E A;  5H2F E;  3AE5 C;  1T3J A;  4C46 A;  2R3S A;  4DCK A;  5E79 H;  3T97 B;  4ZNC A;  2K3R A;  1FZC A;  2R5B A;  3GMA A;  3MD0 A;  2HFE D;  1DEB A;  3WUT A;  1SFC A;  2OYH B;  2W8Z A;  3CLQ A;  2R5D A;  1L4A C;  4OGQ C;  2M3E A;  1JMB A;  2XDJ A;  4AUW A;  4ZKU A;  2POH A;  1PGP A;  3H1L G;  2KI7 B;  3ITK A;  4ZMD A;  4WWI A;  3W67 A;  1ZR2 A;  1SQX J;  3VN0 A;  1FOS E;  2JEE A;  5AVY B;  2M5A A;  4HH2 A;  1X79 B;  1KN7 A;  2HOD A;  1IFJ A;  1OWA A;  5KLV G;  5AW5 B;  1FOS F;  1W5C E;  2O1J A;  3WUV A;  1VQK P;  1KIL B;  1NTK D;  3BAT A;  5AW8 B;  3O8Z A;  2J58 A;  1JNM A;  5GTH H;  3RK3 E;  4DOJ A;  1ZME C;  1SLQ A;  4H0L B;  2WMM A;  1G1I A;  3HD7 B;  1IC2 A;  4M3L A;  4WB4 A;  5CCG C;  1GU4 A;  1YYC A;  1NTK J;  5B66 H;  1YTZ T;  1N8R Q;  5AVV B;  3CCJ P;  3OJA B;  4U3F E;  1RE4 A;  1BGY G;  1KFN A;  3MUD C;  2QJY B;  5KAF H;  1HF9 A;  2XND H;  1JB0 J;  2NPS D;  1SQX K;  2H7H A;  4JPZ B;  4YPC A;  3TGU E;  1IJD B;  1EXI A;  1MV8 A;  3RK3 D;  3D6Y A;  4H0L C;  1BCC G;  3HD7 C;  3L75 G;  1WT6 A;  5H2F H;  2WZ7 A;  2O3J A;  1Q82 Q;  5CMZ A;  3VMX A;  1NTM G;  2HOD B;  4GIF A;  2Q7C A;  3KQG A;  3NXS A;  1M56 D;  2WQY C;  2UWJ E;  4WY4 D;  1GU5 A;  5KJ7 D;  2WPR A;  1N73 B;  5L8R J;  2A06 E;  1NTK K;  1YIT P;  4Z1M H;  2W90 A;  1M57 D;  4PD4 I;  3H1J G;  1EDI A;  1S4X A;  2L91 A;  1TU3 F;  1NH4 A;  3GF7 A;  1N7S C;  3AE2 C;  3L72 G;  1H0T A;  2QSI A;  3RBX A;  2QE7 H;  3AE6 C;  1N7S D;  1VQ9 P;  3CXH E;  3L71 E;  3KDP B;  2W27 A;  1VL2 A;  1N73 C;  4I7Z C;  1EDK A;  1H8A A;  2A06 D;  2JWA A;  3M9H A;  2A45 G;  1LTB C;  3VMZ A;  1KFM A;  5APY A;  1LP1 A;  2O01 J;  5KLV J;  1VF5 B;  1D7M A;  3V5B A;  5M1B A;  2LR2 A;  2C0W A;  3CCM P;  2FXO A;  1JCD A;  2E75 C;  2YKQ A;  2B89 A;  1JEK A;  1K9M Q;  1XTC C;  2ZT9 C;  4TLF A;  2B88 A;  3L71 D;  1HBW A;  3C8V A;  5APV A;  3B5N A;  3Q5S A;  2KUB A;  2R3C A;  1FZB A;  2YMY A;  3M0D C;  3D6Z A;  2QJP C;  2ZVO B;  2FFD B;  2FYZ A;  1OVV A;  1HGV A;  1A02 J;  2NZ2 A;  1SP4 A;  3L74 G;  3L71 J;  1LTA C;  4D6T E;  3CC7 P;  1MKM A;  1HJ0 A;  3II6 A;  2KYV A;  3Q1M A;  2OTL P;  4O9B A;  3U59 A;  1USE A;  1BCC J;  1PP9 G;  3EFF K;  3L75 J;  2WSF H;  1EZV E;  2C9L Y;  2GM4 A;  2PFX A;  2FXP A;  1WMK A;  3AEA C;  3P32 A;  3CCU P;  1NTM J;  1URQ B;  3NFQ A;  1NVO A;  3VMY A;  1SQQ G;  2Q1K A;  1VQM P;  2W6A A;  5AW2 B;  1GL2 B;  2K9J A;  4BXL A;  4BRY A;  2HG5 D; 
#chains in the Genus database with same CATH homology
 3FX0 A;  3JSV C;  2ZVN B;  2ZVO B;  4OWF A;  2V4H A;  4BWN A;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...