2ZVPX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and p-nitrophenol
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
LDVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 110
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvpX00
4B3BA 3CZQA 3KKPA 3B9QA 2ZM5A 4DT1A 2AKAB 2ZJOA 3K9HA 4QGFA 2BWJA 1HH4A 2FWRA 2FGJA 3ASYA 3K70B 2QPOA 3P32A 1OV4A 4WAUA 1E2QA 2OESA 1PLJA 4B33A 2ZJ8A 4D26A 2QN6A 1XZQA 5EZ6B 5J40A 3GLGA 4LJ8A 1E4YA 4KFUA 1G18A 3GFOA 4IDNA 2H1LA 3IQWA 3AVOA 3CF0A 1XJQA 3TJZA 5FBVB 2EYQA 2RH5A 5A0FA 4E22A 2O8FA 4RFSA 3SQXA 4ERNA 1MV5A 2F7SA 3A4LA 4QHTA 4HDCA 4U00A 2ERXA 4KVAA 2ZYUX 1KI4A 3D8BA 3KKMA 3P20A 2FZ4A 3QIAA 4HDQB 4EPVA 2GBLC 4FI3C 1IN8A 2A5YB 1XEXA 2EWVA 2VHJA 2ZQ5A 2ZJAA 1DAIA 4FW9A 4EPRA 2GXAA 1HE1C 1U0JA 3L82B 1E9SA 2VP4A 4MRVA 2DHRA 1XTJA 2BKUA 3OFND 2C2HA 5F3WB 3VR2A 1IN5A 4PSVA 1NBMA 4LV8B 4B47A 3H1TA 3LAWA 4HB0A 5AJVB 3ND8A 2EFDB 4IOLA 2EFGA 5DGXA 1IY1A 2QQEA 1P2SA 3LVRE 3NVAA 4P4UA 4WXPA 2PCJA 4AC9A 4DDWA 2XNDA 4KLZA 2WHXA 1XMVA 4PR0A 2HYIC 5JJKA 1RE0A 2A5GA 1EFHA 5FUWA 3V00A 4X8HA 1KK2A 2WWFA 2BM0A 4GBMA 2W6JD 4Q1DA 1BOFA 1YRBA 2CLSA 4M21A 3R20A 5H1YA 4FIDA 2F9MA 1VG1A 3IILA 1VG0B 2QA5A 4I1VA 5JWHA 3FKSA 1E6CA 4WIAA 1P2VA 4JJZA 2HF8A 4X8OA 3HU2A 1VCNA 1KI7A 2AD1A 5DN6D 4U7DA 4M1OA 4RVCA 3AF0A 4A8JB 4PC6A 2BEKA 2RGNA 3KL4A 1DAKA 5FOTA 5JJLA 2MMCA 4MKIA 3KKOA 4MGYR 5FBQB 5EUQB 4TLDA 1DELA 1IQPA 1P5ZB 1HUQA 4CYMA 2CL0X 2J46A 4TSFD 2RGEA 2AFHE 4OQXA 1D9XA 4OQLA 2IYWA 5LB4A 1JAIA 1E9BA 3R9IA 5JS7A 2J0QA 2GNOA 5FPHA 3IPXA 1VMAA 2XZLA 4QM6A 3M6AA 5IHPA 3N5CA 1PJRA 3LO5A 5IK2A 4A0FA 2WJYA 1ZCAA 1YZQA 1SHKA 1O87A 1TUEA 2RGBA 4XWAA 2PJRA 3IEVA 3ZLJA 4TT3D 1Q44A 4UNQA 1JALA 1F2TB 3F8TA 5TY0A 1XJCA 3IIJA 4A2QA 1FUUA 4Q9KA 3MSXA 4NCHA 3LBHA 1XTIA 2BCGY 4JLJA 5HTKA 4G5RA 1E2HA 2V9PA 4B3GA 3TQCA 3RHFA 4IW3B 2CK3A 3PVSA 5C46F 2E9SA 2PEZA 2WKQA 4OJKA 3VKHA 3W34A 3ECCA 3LBIA 1GRRA 2WV9A 1ETUA 3I62A 1UDWA 3FDIA 4OHYA 3A1SA 1RW4A 1KOFA 2H5EA 4M0LA 4TQUS 4CEHB 3UWKA 3FMFA 2NGRA 2W0SA 2OM2A 4GOKA 4LJ9A 3OIWA 1R0YA 5CLQA 4LHXA 2IA5A 1DO2A 1NI3A 1G7TA 3GLHB 3TKLA 2G83A 2AN9A 1OB2A 3BB1A 2FSIA 1OFUX 1ZP6A 4JKIA 4Q03A 2R6GA 4K8OA 2ZI3A 1N6OA 1YR6A 2IXFA 1D2MA 5EXPA 4LYFA 4B6EA 3VR5A 2JLVA 1ZM4A 4YMSA 4HAVA 4Q9HA 3PG5A 2C8VA 4D81A 1NG9A 4ARZB 1F2UB 4X8LA 2X2FA 3BH0A 5EE0A 5J4VA 2DY1A 2GRJA 2GF0A 4F38A 3VNVA 3GEIA 5LDDC 1Q1EA 5B57C 4L16A 4M9QA 5BN5A 3GLHE 3VU9B 2LKCA 2YV5A 1NVUQ 2AXPA 1W2HA 2BMFA 4KAXA 2GA8A 4ON9A 1DG3A 4QOSA 4RD6A 4CEJB 3KQUA 2ZIAA 3WYAA 3NC0C 3PENA 4I81A 3T1TA 2FZLA 2F43B 4M9ZA 3NHAA 1W0JD 3QKRA 4UXIA 1YZUA 1Z08A 2GJ9A 5IF9A 1FW6A 4YLGA 1WBBA 4HAYA 3ZS8A 1HA3A 1XU4A 2RAPA 2YZ2A 5HPYB 3H4MA 4OK6A 4IVPA 3GP8A 3T5GA 3VR6A 5KHOC 1JQJC 3CH4B 4N3NA 5KTYA 1LS1A 4XVRA 2SHKA 1T9HA 1VYUA 4JT2A 2QTFA 2YINC 1JEDA 1DVRA 2ANBA 5KPJA 2Z43A 3M1IA 3EIQA 5BYKA 1M1YE 1AM4D 1W44A 5HE9A 4ZPXA 2HCJB 1WB9A 1VIAA 2OAP1 5KPDA 2YKGA 2QMHA 2D62A 1E99A 3OEHA 3SN6A 4B3FX 1AQUA 2BMEA 4U02A 4R9UC 4AG6A 2IYZA 2PH1A 3DMNA 1OIXA 1JJVA 2OCYC 1E4VA 2ZE5A 1PLLA 2D4HA 3B1VA 2GHIA 2ZI9A 4C0JA 2GZDA 5FUYA 2GBLA 2J3EA 4L5BA 4TYWA 1H65A 2ZSAA 4UNRA 3THXA 1DARA 3X2SA 4LI0A 1AQYA 2G6BA 4WVFA 4LJYA 4Q02A 4QBFA 2A9KA 3VX4A 1FMLA 2FJUA 4C0SA 2WAXA 521PA 4QRHA 2Q3MA 2RGDA 4TMVA 3AP3A 1I4TD 4U5XA 1E9DA 1EK0A 221PA 2WPDA 3BGWA 2OE2A 3KB1A 4PO8A 4Q9JA 3TVTA 1YZNA 2BBOA 3O8CA 5BQ5A 4ASUD 2OHFA 2PX0A 2NO7A 4NONA 2Q21A 1QVRA 4TMZA 4B71A 2ZYVX 5FH9A 3FMIA 4QKQA 2O8DA 1D6JA 2MSCB 3EZ9A 5BW8A 1QHHA 1W5TA 2PL3A 3I61A 3UIEA 4ZDJA 4B73A 1F2UA 2WMNB 4OK3A 3QVVA 4DLYA 1E2LA 2FPLA 3KQLA 4JYCA 1RKBA 1RRGA 1KO4A 2CNWA 5LB2A 4DLRA 4Q1AA 4GZLA 3T12A 1E79A 1WF3A 3C7KA 3B1YA 4DUGA 3IO5A 3T61A 4KFRA 3VU9A 4RD0A 4NMMA 2VLIA 4DSNA 4E03A 4CEJA 2ZR0A 4NYIR 4UJ5A 1OPXA 1ZM2A 2IEZA 1YVDA 2G9NA 4OK5A 3FTQA 5K8IA 4HB3A 2GK7A 2PZGA 3GJ7A 4D6PA 2HDNB 2OBLA 3D31A 4LPSA 4FN5A 1B0UA 3BJIC 1J8MF 3ETLA 3EZ7A 4O0MA 2IWRA 4ZI2A 4HLQB 3EXAA 1KMHB 2Q3FA 2RCNA 4GOXA 1UBCA 2FSHA 5DO9A 2ODNA 3K0CC 3FKQA 2AK3A 4FMDF 1AK2A 3GLFA 2O8EA 2V6JA 3FVQA 1OH5A 1A4RA 2EYUA 3QBTA 3T06B 3PITA 4DCUA 1BO6A 4FCWA 2VO1A 3L2OB 4C0AC 1SVIA 3G5UA 1S8FA 1XEFA 1LS6A 5AUPB 3CUEF 1Z0JA 3RRNA 2QT1A 3AP1A 1IONA 1G9XA 3CRW1 4MGIR 4GMXA 4IOMA 5A4JA 2C95A 4WA7A 5FOUA 1Q1ZA 3DOEA 4PHGA 4L4UA 2QQ0A 2JDIA 2IUSA 4A15A 2EFEB 1KO5A 821PA 3QKTA 4Q48A 3HP1A 2ZS7A 5JS8A 1ZU5A 3C5CA 2XNDD 4MRNA 4NYJQ 4URWR 2GXQA 4G01B 4XJXA 4EFNA 1E2FA 2W0MA 3U2QA 2RGCA 1G3MA 1M7GA 3NDBB 2GCOA 1IY0A 4LBZA 2FOLA 3OZXA 2QI9C 3WY9A 2HLDD 3HJNA 1MT0A 2QENA 5KSOA 4UXHA 5IRCD 5FI0B 2J7PD 3WMFA 2FX3A 3K0FA 3RWMB 2XTMA 1MKYA 1Y3AA 1G8YA 1T0HB 1PUJA 2VH5R 4CVNA 3UG6A 3FKSD 2GJKA 2OCBA 1VYTA 4DC9A 2Q3HA 3FMOB 3AVYA 4KCGA 3R7WB 2PLRA 1P75A 2W6JA 3NKVA 3TBKA 3U3MA 1Z3IX 1N6NA 5G3ZA 5L3VA 1SVMA 3IKJA 3O8DA 1QHXA 1J7KA 3FHCB 3THOA 1NN3A 1Z6TA 4CRWB 1NRJB 1W4RA 4JVMA 3W5JA 5AJYA 4Z8XA 3TSZA 1UKVY 1LTQA 1SVSA 4ACAA 1SULA 2Z4SA 3UG7A 2R8RA 3SBEA 1BYUA 2AWNA 4ZO4A 4B75A 5ANRB 3AKYA 1G64A 4DKXA 3AF2A 4LBWA 3LQRA 1Z0KA 3HU3A 4W5JA 3MRSA 4A9AA 1Q21A 2CL6X 1GUAA 2BBTA 1CEEA 2F55A 3BFXA 5H68A 3K70D 5DISB 2C96A 3EG5A 5KOYA 4LRWA 3TRFA 2FSGA 1SZPA 3I5XA 2BJWA 4KLNA 4NBSA 5FFMA 3U7FB 1YU9A 4NYMQ 4EQ6A 2JEOA 2QRZA 2UVQA 5JI2E 5KSZA 3U61B 3WHKA 1K5GA 1KMHA 4I1SA 5G3YA 4A0RA 2YC4C 2HEIA 2VYFA 4EDHA 3R9WA 5BXQC 4TT3A 4JT4A 3L0PA 1KIMA 1HT2E 2ZRKA 1JBKA 4JL8A 2FA9A 2CK3D 4W7SA 4ZDIA 1Z06A 5JRZA 5GJBA 2PT5A 4LJ4A 1GFIA 3VNUA 4BEBA 3N2IA 4Q9IA 1Z6AA 2IX3A 1SKYB 3P1JA 5FPTA 3WNDA 4AYXA 4BE7B 2BKEA 3RRMA 4QC2A 2I3BA 4IKEA 2WM9B 2YHSA 1EX7A 5FL3A 4C2UA 1TU3A 1Q57A 4FMCF 4PHHA 5F2EA 2RMKA 2WBLC 3B82A 5GJCA 4Z1MA 5CYPA 4DZZA 1GRQA 1G8HA 1AS3A 1XD8A 1CU1A 3KQHA 4DSOA 1E9FA 3U7EB 1UBEA 4B44A 3FGNA 1N25A 4IDOA 2J5XA 4B32A 3H86A 1M74A 2Z6VA 3EPJA 4EPYA 4Q4LA 5KSPA 1SKYE 1U9IC 1Z6XA 3KDSE 4A2PA 2Z83A 3B9PA 2KWIA 3P27A 3K9NA 4I1OA 4HLCA 4Q4JB 3BH7A 5FTKA 2LWIA 4M9XA 2Q9AA 5HR5A 1W36D 2CLDX 1OXSC 1P62B 3EASA 3WMEA 3G0HA 2LKDA 1JXMA 1DOAA 1ANKA 4ZV4A 4O2RA 1GDDA 3OIYA 3EPLA 1NL3A 1Z83A 4WBSA 3UANA 3RC8A 4JVNA 4IFEA 1P60A 2J0SA 3EWSA 4TYNA 1UBGA 1G6HA 1YHNA 1IN4A 3ZDQA 1KZGB 3TGPA 1CIPA 4Q1CA 1SKQA 3BIFA 4HSEA 2XSZA 1SXJE 1MH1A 2GEUA 3GEHA 3OE7A 3Q5DA 5DI3B 3O8RA 4GOJA 3P4XA 3LH5A 1G3UA 2GETA 2OG2A 4DBLC 3ZQJA 5KDDA 3ZD7A 3CW2A 4B35A 5LBIA 2ZU0C 2NMVA 1YRAA 2GZAA 2WSMA 4IFBA 1Q12A 4DT1B 2AXNA 1G41A 2DWPA 2REOA 3U7GA 4NZYA 2ECKA 4DDUA 5JCZA 1D2EA 1FFHA 2R2AA 4Q21A 4AKEA 1RRCA 2OO7A 2ZVQX 1FL9A 1OFHA 3MJHA 4QNRA 1XWIA 2BHRA 3ZJYA 3GLGB 1RZ3A 2AK2A 3FHOA 3RWOA 1Z0DA 5G40A 3TUJC 4US0R 1KGDA 2C9CA 2GEVA 2Q9CA 3AV0B 3NEJA 1YR7A 2BOVA 2PT7A 3OEHD 4M1YA 1AA9A 5DNYB 1FNMA 4HAWA 2O8FB 1KJYA 3BERA 4GI7A 2VTKA 4OL0A 3GJ6A 3K0CA 4DJTA 2P2LA 4OI2A 2ZUCA 3I72A 2IS4A 1KYIA 1TQ4A 1JAHA 3NG1A 3QEJA 4KFSA 2I4IA 1UAAA 3VFDA 2DWOA 1CTQA 1T8UA 4G3XA 1M2OB 4MKFA 1N0UA 3QVUA 2WIAA 4P4SA 2OFXA 1J99A 1ZNYA 3X1WA 4Y0VA 2YOHA 5FTMA 1UM8A 4N0DA 1LW7A 3IBYA 2A30A 3PUVA 1GITA 4DCTA 4EFMA 2RKOA 3GLGE 4MUAA 3JZMA 1L4YA 1XP8A 2IS2A 1GM5A 3ADKA 5JZVA 2J41A 2WPDD 5HKKA 1EWRA 2AR7A 4OHVA 1QG2A 2WJGA 4UNNA 1ZD9A 4HI0E 3LV8A 3OIUA 4GT1A 4V0NA 2QMOA 4EFLA 1Z8FA 4EPWA 1FZQA 4BFSA 2NO0A 3TVDA 3AF1A 5AUQA 1NVXQ 1E98A 5KNCA 2OFOA 3FOZA 4DDTA 2ZPTX 3DZ8A 1JQLB 3CBQA 3K0EA 2F3TA 4URUR 4Q4JA 2H18A 5EJEA 1R0WA 2H16A 3I8SA 4M1TA 1DBSA 4YDHB 1NBME 4B2IA 1XPRA 2GKSA 2CNWD 3N2EA 1E79D 4P3YA 4QHYA 3IEUA 1NIJA 3AKEA 5EQTA 4OHZA 4DUGD 3EA5A 3MWYW 4DCSA 1GL9B 1S3GA 2QORA 3AVXA 2OILA 5CLLA 4IOKA 5E7JA 4AD8A 4KXFB 1Z28A 1MO4A 4A4DA 1XNJA 3REGA 4JLKA 4JL5A 2DYKA 5DI3A 3W6PA 1X8KA 2OBNA 1RJ9A 2VHCA 4Q4HA 1ZW6A 2ZSBA 2WSSA 3SHWA 3V9PA 4C0QC 3EX7C 1E2KA 3OHMA 4MDEA 1U81A 4WXRA 1FPMA 4XWOA 3VR1A 4DIDA 4X8MA 2HT1A 1Z0IA 2D06A 3TH5A 1F6BA 5J4HA 4OI0A 4HZUA 1IN6A 1WQ1R 2V1UA 3CNLA 4E5UA 2KE5A 1NSFA 2QU8A 4LJ6A 5DYGA 4FD2A 5EE5B 1QF9A 3PQCA 1LY1A 1R0ZA 5FOVA 1S4QA 1IBRA 1FX0A 1E2MA 4XSGA 1VIYA 1UJ2A 1G16A 4IVQA 3T35A 4TL7A 3KXIA 2IEYA 4TZ0A 1P9WA 4HDOB 4AWXA 5CB6A 1ZBDA 2DCUA 3NXSA 5FPKA 2FSFA 4LHWA 2R6FA 1G5TA 2JDID 3B1XA 3BRWD 3RRZA 3QXXA 1JR6A 2XX3A 2QM8A 1E2IA 3CO5A 3LLUA 2YWGA 3F0TA 4OQFA 1KSJA 3UXMA 2O8CB 4AY2A 2WWIA 1EFTA 1QG4A 1MABA 5AUOB 3ND9A 1U2RA 3TR0A 3W8NA 3EZ2A 1W7AA 5GVRA 1G20E 2J7KA 4GMDA 621PA 1XDBA 2P65A 3EC1A 1XFAA 4K81B 1CR4A 2DWQA 4YMWA 2JAQA 3KZ1E 5H70A 3WBKA 4GP6A 2GAOA 1R0XA 5FOWA 2REBA 5K8UA 4NCIA 3OEED 4ZI3A 3LLMA 1SVKA 4FCTA 4Q7MB 2YOGA 1IHUA 2HLDA 1XD2A 2W83A 2PCLA 2C77A 2J7PA 1U9IA 1ZVQA 1JI0A 5EP1A 4DLSA 3BD9A 3I1FA 4N0EA 1G1MA 1W36B 3ADDA 1MO5A 1S9HA 3WNBA 3KXLA 2HCBA 5JJIA 2NTYC 2D7CA 3IBGA 3IPYA 4DRZA 1XEWY 1NY5A 3QUSA 4YMTA 3PEUA 3A37A 3AKDA 4UQOA 2OUKA 2QM7A 1WMSA 4TL8A 4XD7A 2WTUA 1SVLA 1Z63A 3NWJA 2OXCA 4US1R 3EC2A 2ZRBA 1E94E 1DG1G 4Z51A 1KDRA 3QKRB 2HF9A 3X1DA 2FN4A 2WWXA 2BBSA 1W48A 4HEJA 3TE6A 4PSKA 4CW7A 5KU1A 2OZEA 1S2MA 2NZ8A 2QROA 3QJYA 3QPUA 4C0LA 3DHWC 3HR7A 1CLUA 2ZI7A 2XXAA 1KNQA 5DH9A 2IYLD 4JBXA 2AKYA 1P61B 4DLVA 2O0KA 2P0EA 1RYFA 1UEJA 3AGQA 4PC7A 4HAZA 4TTQA 4BECA 5AJZA 4TLBA 3O8BA 1IAQA 5TMPA 4RD2A 1TF5A 3Q7PA 3SE0A 4WOPA 4I1UA 5LPNA 2UKDA 5KNBA 2H7VA 1TF7A 4BFVA 3GLIB 2P3SA 2DR3A 1BH2A 2DFKB 1N0WA 1KZ7B 4JS0A 5EP2A 2ZROA 2XJ9A 4S35A 5AUNB 4RZ3A 3PEYA 2IUTA 3THXB 3KUDA 1PVOA 4IHQA 1NIPA 4B3CA 4Z1MD 2FEOA 2ZTSA 1DEKA 3NHBA 2Q0HA 2O8CA 3Q3JB 4CEIA 2C9OA 1E69A 4O25A 4CZ2A 1OIWA 1J90A 3WBJA 4CT4B 2GILA 4JSYA 2XJ4A 2X2EA 4NYMR 2PEYA 1IN7A 4BFWA 4LYJA 1ZAKA 2Z4RA 1XMIA 4G0NA 3D3QA 1TEVA 3T15A 2GZHA 3KKQA 2XEXA 3TSOA 2FFQA 1K6MA 3BFVA 1P72A 2GXUA 4QBGB 3AVUA 1IJEA 4D4MA 4M8NE 2PBRA 5G53C 2NOAA 2W6IA 4RJLA 1P2UA 1U98A 2O8DB 1YQTA 1ZIOA 3QSYA 1FQKA 4ZDKA 1CKEA 1QHHB 1RYHA 1JECA 4C3ZA 5FTLA 1RIFA 3SJZA 4B34A 1ZNWA 3A8TA 4ESVA 3AF4A 1LB1B 1CP2A 2GJAA 1TX4B 3DM5A 1QHNA 1M34E 1X3SA 1YZTA 5CITA 3L43A 5JI3E 5CYOA 2XSZD 2F1IA 2OAQ1 3OE7D 1KI2A 2ZANA 3UKDA 1PV4A 1LNZA 5FBWB 5BWMA 4JMPA 4IDHA 3BC1A 1EFUA 1XTKA 2CHGA 2R6DA 3K8YA 5CM9C 5TARA 2A7QA 4N1AA 1Q1QA 1KAOA 1NN0A 3QF7A 4D4KA 1NJFA 3EPHA 1E96A 1W2GA 2R9VA 1L8QA 2HXYA 1S9DA 3KTAA 3C5HA 4Q01A 1ZUHA 1UKEA 1CR1A 1G8PA 1YZLA 4V0MA 1IXSB 4LJ5A 2C99A 3PR1A 5TDHA 4HLUA 1F3OA 2XITA 5JEEA 1FTSA 2MSEB 1KDOA 2GCNA 4LBVA 4LJ7A 1XEWX 3GLFB 3U6KA 2O8EB 1UPTA 3FFBA 1T0JB 4M1WA 1TADA 1LF0A 5M04A 2ZRAA 2WZQA 3UK6A 3SNHA 5J4KA 3CNOA 3Q72A 1W0KA 1KSGA 1YKSA 1OHHD 3THYB 1T3SA 5FUVA 5KDLA 5BYJA 1CR2A 1ESMA 1ELOA 3EIHA 3SHFA 4D0NA 3GLIA 3MMPA 3DZDA 2EFCB 3GJ0A 4MGKR 2G77B 1II0A 1U90A 3BOSA 1KK0A 3ZQ6A 3EAQA 1G5RA 4JLDA 2WKPA 1Z22A 2MMGA 2IBMA 3E1SA 5HKKD 1D8TA 1N5LA 5AWFC 2VQSA 5AK0A 1FQJA 2CDNA 2QAJA 3GLFE 2B8TA 2XTZA 4Z8YA 421PA 1KY3A 1OF1A 2GCOB 4CDGA 2VL7A 4PZYA 2QGZA 5J4LA 4RD3A 4HB2A 2BV3A 1T5IA 1R5OA 2ZSFA 2IYTA 3CPHA 1AGPA 3IQXA 4PPQA 5C4GB 1W4AA 4IXMA 3K0FB 1FP6A 5CB8A 2JJ1D 1AS2A 1P4SA 3CONA 2IYQA 1R4AA 4MQBA 3MAAC 5SZHB 3EARA 3U3JA 3VHLB 5JLJA 3AVQA 4BGDA 3GPLA 2ZSDA 4LWZA 1T3LA 4A6PA 1GTVA 3WHLA 3ONWA 4NCNA 2F9LA 1TQ6A 1NMXA 3WXMA 4D0GA 4KVGA 1NNEA 1DAFA 2F1HA 4DSUA 4URXR 4FINA 4ZCIA 5J4YA 1AKEA 1RPZA 3TUIC 1FNNA 2QMUA 2A5DA 4M1KA 2VSFA 4B2LA 1NG1A 3ZGXA 1XPOA 1ZM9A 2WSSD 1CJKC 2ODWA 4W5WA 2ZITA 3GJ5A 4HUQA 4V0OA 3QXJA 3NH6A 4FCVA 1WBDA 2IXGA 3L8YA 4RKEA 2QUZA 2V4ZA 2P5TB 3BE4A 3K0AB 2IHYA 2FV8A 3U4QA 3M0EA 1ZM7A 4C0HA 2G1JA 1XMJA 1G4UR 4KHZA 5KSYA 4BFXA 5SZIA 1GRNA 1L2TA 4TN1A 4NU0A 5E4FA 1XX6A 2JLRA 2NPFA 3CX7A 1P2TA 1MOZA 3RS0A 1G7SA 5JBQA 4EQ6B 2QP3A 2HV8A 1QHYA 2W2VA 1E0JA 2VP0A 2IXEA 2WMOB 2EWWA 1Q20A 3I32A 3CIOA 2ONJA 2E87A 2FMXA 2Z0MA 2ZI5A 1ESNA 1BYIA 3QG5A 4JL6A 4Q4AB 4ESHA 3LA6A 3THYA 4M53A 4JVLA 4IDQA 3WRYC 1ZNZA 1L7VC 4XH9B 2ZU6A 2FG5A 2ZJZA 3CWQA 5FR2A 3MFYA 1QDEA 4LCBA 3K0SA 4GFDA 4MITA 4KYUA 2WOOA 4HLDA 4LYAA 2NIPA 2H57A 5DYIA 1B23P 2X8AA 2ZYWX 1YZGA 1AGRA 2C03A 4I99A 4MKGA 1KO1A 1L4UA 3EWAA 3VX3A 1NP6A 2N1BA 3MD0A 5CDFA 1OKKD 2KJQA 2CXXA 5K8TA 3C4JA 4NP6A 4L15A 3QENA 1GG2A 1D2NA 2CEAA 2OT3B 4RZ2A 3CPJB 1NJGA 3GJXC 4D25A 4FWIB 4Q19A 5FBLB 4P4TA 3Q85A 4BLPA 3PUZA 1HTWA 2PZEA 4IOJA 3CRRA 1OSNA 2OEPA 4B3DA 1XPUA 1KI1A 2YWFA 1XMSA 1OW3B 3E5HA 3RNLA 3A4NA 4G5GA 3LDAA 5KYKA 3FE2A 4TMWA 3SJCA 3OEEA 8OHMA 2FFAA 3N70A 1G21E 4W5HA 4S2EA 4LHYA 1AS0A 1WE2A 4BLSA 1DAGA 1OH7A 1HEIA 4A1FA 3DVLA 2BMDA 3JZAA 3MJRA 1OXTA 1NN5A 2ZUBA 1E2JA 1CULC 2I1QA 3C16C 4XD7D 1R2QA 4MRRA 3UATA 4V02A 1FTNA 2G88A 3W3AA 3HYRA 5EE3A 2IW3A 2RGAA 1NVVQ 1EWQA 1NLYA 4P32A 3Q9LA 3TAUA 1T6NA 4M1MA 4C0BA 2ZAOA 4DLWA 2QP9X 4KITB 3K1JA 4PC3A 2IWHA 1LVGA 3H0KA 2RB4A 2YJTD 4Q1FA 2OSBA 1SQ5A 5BN4A 4W9MC 4UJ3A 4EAQA 3C14C 3IO3A 4QJ4A 1NF3A 4PAOA 1XF9A 4JLAA 4Q00A 4K46A 4PXAA 3K0AA 1KY2A 4L9WA 3O47A 1R5NA 1E1QA 1I4LD 4PO1A 4A82A 5GADl 1JR3A 2XZOA 3ZZ0A 4D0LB 1CJVC 3NBYC 2G1KA 2AX4A 2JJ2A 2QPTA 2WWHA 1XCPA 4CGZA 5F9HA 4LBYA 2CVFA 2EVWX 1N3BA 4L9SA 2IC5A 4ILEA 3R8CA 5JWRA 5ELXA 2C5LA 1P73A 2IS6A 3QG1A 4O3MA 1E9EA 4QM7A 3HPRA 3LY5A 4BLQA 1P6XA 3U3KA 2WJVA 4LHVA 1A2BA 2BJVA 3D6TB 4TYPA 3RANA 3KJHA 1FUKA 4BWYA 4KFTA 2AFIE 3AF3A 3QQ5A 4Q4AA 1XXHB 2R44A 4G5QA 1U8YA 1HV8A 2QG6A 1ZRHA 2QBYA 3B7GA 1II8A 2GDJA 2WIBA 3RVBA 1EX6A 4F4IA 4P4SB 4NDZA 3A1UA 2ATXA 4LUCA 1QBKC 4BFZA 4YQFA 1RC8A 4US2R 3QF4B 3VTKA 3W6OA 1FP7A 2JLXA 2VA8A 4IXNA 5DI9A 2XB2A 1F48A 1SVWA 2IYYA 3AQ4A 3EW9A 2G3YA 4ZCMA 1NMZA 3CKLA 2ZUDA 3LX8A 4M4SA 5FOSA 1JNYA 4JBYA 4DEYA 4Z54A 2R6CA 1U8AA 2NG1A 5EUMA 4DSTA 2W6ID 3T1OA 3WP0A 4PO9A 2R62A 3KB2A 4DEXA 4ACBA 2EFHB 4ZKEA 1TF2A 4LHZA 2QTHA 6Q21A 4TQ9A 3I3SR 1U8ZA 2WJHA 2A2ZA 2VEDA 3RSLA 3TK1A 2ZEJA 2ZREA 1VHLA 2EW1A 2HJGA 3R8FA 1ZIPA 4A2WA 1VTKA 4BZPA 2FU5C 3SFZA 5D3MA 4PAMA 1D5CA 1ZYUA 2D2EA 4LC1A 4PAQA 3TW8B 2KBEA 4R2HA 4NTZA 4QBIA 4WZBE 1VECA 4DB2A 2N46A 1KKLA 1G291 4IEIA 5TV2A 3KQKA 2KSQA 3REFA 1G8GA 3W6NA 4B2PA 2B92A 4NKRA 3TQFA 1W46A 2ZI4A 1OLOA 3FB4A 3PUXA 2X1VA 3QXCA 4KU4A 2K5UA 1EG7A 1RJ9B 4Q4HB 3V4FA 3MUFA 4CF7A 1E0AA 1TQ2A 2ZJ5A 1R8SA 4O2LA 1YR9A 3RABA 3BS4A 3TR5A 2JLZA 3AUYA 4HZUB 3E70C 1OB5A 5SZKB 3ZVNA 5UKDA 5EE9A 2IT1A 1GL7A 2Y8EA 3SDZA 2ZRDA 3AUXA 1FX0B 1SVOA 2NO6A 4H1VA 4JKYA 5DSZA 2VP2A 3ZYCA 2VSOA 1VCIA 2V7QA 4URYR 4LYHA 1JPJA 1N6KA 1W0KD 4JIMA 1XTSA 2WKRA 5B58C 1JB1A 1EFRA 2G0NA 4EPTA 3RLFA 4LPKA 4JLVA 5LD2C 2F1RA 4HZIA 1XCMA 2Q6TA 5HCIA 5C2JB 5JWOA 5IDVA 3LD9A 5L3SA 1T8TA 4XSHA 4IDPA 3CH5A 2XAUA 1OHHA 1XXHA 4Q1BA 3L0SA 1C4OA 2ZJBA 2WWGA 3AB3A 1AZSC 2ZRIA 3QKUA 4G5OA 4QGGA 2YVUA 3FFAA 4BQSA 1KI6A 1MABB 1S1MA 1W49A 1G8FA 2FPKA 4PC2A 1ODFA 1MO3A 4JSTA 4OBEA 3QF4A 3WP1B 3BFKA 1JXOA 4QJ5A 2O8BA 4JZKA 1X8LA 2KBFA 3NEYA 1COWA 1NLZA 1BMFA 3KFXA 3LBNA 1RFLA 2MSDB 2VP9A 4KV9A 4DHEA 1N6RA 3ZVRA 1HURA 2ZI6A 2GF9A 3P4YA 4P31A 3EIEA 1S1CA 2GVZC 1KK3A 3Q8XB 4C30A 3B78A 4JJKA 2ORIA 5TXGA 2OCAA 3X1ZA 1XD2B 4GL2A 2HYDA 1LFDB 2OBMA 2VIIA 1Q22A 2CCKA 2JJ1A 2RGGA 3PEVA 4OYHA 3QBVA 1KDTA 3A1WA 4IRUB 2JASA 4TLEA 3SJBA 1IJFA 2I1VB 2O52A 3UPUA 4PQFA 3TSWA 4JLMA 3DO6A 3K9GA 5JSZA 1TTTA 2WVJA 4QGHA 1E9AA 4AG5A 4UKDA 2ZAMA 4NYIQ 3SZRA 4EKDA 5EP4A 2J1LA 1ONBA 1Z5ZA 1VG9B 1ZM3A 1AIPA 4MA4A 1X8JA 4BLTA 5IT5A 5JECA 1KJWA 2VPPA 3U44B 2D7DA 5P21A 2J0UA 1ZUIA 1F5NA 2ZXUA 2BCJQ 4YXWA 3RC3A 2JCSA 1XJ0A 2WWWA 5FOXA 2DB3A 3KKNA 4A8JC 3JVUA 5AJWA 1NKSA 2XXAB 1H8EA 2FFBA 2QAGA 4HLUC 2HJVA 4XIGS 2IK8A 5EZ5A 2CL7X 3LX5A 2ORWA 2IYSA 2OFWA 4DCVA 1O3YA 3DOFA 4M2LA 1M6NA 1T3HA 2EQBA 1GNQA 2IL1A 1CF4A 1HY3A 1EXMA 1SHZA 1KKMA 1UFQA 1NMYA 3VHXA 4EJSC 1Y63A 2RHDA 2XOKA 5D3QA 4V0KA 2ATVA 1VDZA 2V54A 1E2PA 1A5TA 1OYYA 1R8QA 2RHMA 4EIWA 3P26A 5J47A 3FPAA 3QPWA 3WRXC 4KJZA 5EXTA 3ADBA 4YC7A 5LD2B 1ZJ6A 2ZRFA 2WWYA 4C0KA 3TNFA 3AVVA 3WYFA 3DDCA 2NQ2C 1ZC4A 3VQTA 4C4PA 1XRJA 3CNNA 3SR0A 3W9YA 3ADCA 2NO1A 2CE2X 5JEDA 1PLKA 1Z6GA 3IDQA 4CEIB 1ZMXA 5CJPA 3DKVA 3L8ZA 4DLUA 5HE8A 1ZC3A 1OKKA 3HR8A 5KDOA 5EXXA 4WZAE 2BM1A 3NBZC 4QNMA 1U0HC 1TUIA 2YWHA 3S1AB 3QXSA 3HDTA 1CRPA 4XOIA 2L0XA 2CLCX 3W3ZB 1H8HD 2QGNA 2AD5A 4PC1A 5L3QA 3IHWA 3AVTA 2R65A 1OIVA 1S0UA 3QNUA 2B6HA 5B30A 1QVAA 3GD7A 1GKYA 1V43A 1E2NA 4F93B 1N5KA 2CE7A 1IM2A 2B7BA 2QY9A 4OHXA 4ABYA 4TWZA 2CVHA 4P33A 1NKTA 1G5PA 3RYTC 1T5LA 2CCJA 1OFIA 3QKSA 4B74A 3BWDD 1ZINA 2C04A 4NYJR 4AKIA 1BIFA 4NCJA 2ZRPA 4LOAA 1XZPA 1KI9A 1UKYA 1D9ZA 1OYWA 2IF2A 3CR7A 3GCGA 5CIQA 1WXQA 3F5FA 4D4JA 3CX8A 1G3RA 1W4BA 2R6AA 2A3RA 4Q9LA 1GZSA 1ZCBA 5HZKA 3AP2A 1TPZA 2B7CA 2QEQA 4DCNA 3U44A 4TMTA 5DE3A 4ITRC 4ZCLA 1VPLA 3FMPB 5CM8B 1E1QD 2VHQA 5CJ2A 3PCRB 1JR3D 4RKFA 4TTRA 2FPMA 3KTAB 3QY0A 3RDPA 2JJ2D 3FYHA 5AR1A 3WNCA 3U3RA 4Q7JB 4XVQA 1N5JA 5J5CA 3EPKA 4II7A 3SFVA 1UBFA 3LXRA 2XGJA 2CHVA 2PX3A 4RFVA 1F60A 4Q1EA 1G3IA 1BKDR 3K09A 3F3YA 1K5DA 2J0VA 3I5YA 3ZVLA 2QT0A 4A6XA 1NVVR 4NHOA 4TLAA 5JHHB 4DWJA 4EJSB 4MH0R 1OXUA 2QRNA 4PANA 1CS4C 2P67A 1C9KA 3AVPA 2ZJ2A 4Q18A 2W58A 4D2IA 5GVSA 2QSYA 4BPBA 3LRPA 1RRPA 5DHFA 4OKSA 2FNAA 4LZZA 4AURA 5A5GA 4V0ME 4KI0A 3NBXX 4FWTA 3UMFA 3I92A 4C9BA 3SJAA 5FI1B 4E09A 5C4MA 4D4LA 3QPVA 2W2XA 5DLQC 2BEJA 4YDSA 2YNMA 4RSGA 3SI7A 1E9CA 4PPFA 1N0VC 2IS1A 2ZE8A 4R98A 3RS7A 3S1AA 3Q7QA 1M7HA 1S96A 3ZH9B 2ZETA 1IY2A 1HYQA 1U94A 3GLIE 2ERYA 1NY6A 2B21A 1RVDA 2V1XA 2G0TA 2OLKA 4TMXA 3CRVA 5JRJA 4HATA 2QNRA 3CRQA 4H9GA 4CT5A 2J87A 2FGKA 3KUCA 2UZIR 3C8UA 2WJIA 2QL6A 2ZRNA 2DFTA 1AZTA 3U7HB 3LVQE 3OAAA 2P6UA 2PJZA 1HQCA 3LW7A 3DL0A 3IUYA 2VF8A 1GWNA 3DPUA 1GOTA 2QE7D 3GJ8A 2P5SA 1KI3A 4HUQB 1CXZA 1Z2AA 4KSCA 1US8B 2H17A 4GPTA 4BUJA 3I73A 2WOJA 2C98A 2ZR9A 4HUTA 4OQMA 1JEEA 1MRSA 4G5SA 4F92B 3U4QB 1NN1A 4JYBA 1T4GA 3MCAA 5EXSA 3NIBA 1WP9A 4LK2A 4PQYA 2DBYA 1Z2CA 4QGAA 3ZIAA 3VKGA 4MYTA 4MKHA 4PZZA 4BEJA 2JLUA 4GRAA 1Q3TA 3PJRA 1QRAA 2V7QD 4A8JA 2ORVA 3B1ZA 3KJGA 1UKZA 1CJMA 5CK5A 1EFRD 5SZJA 3W90A 2JA1A 3U6BA 1UEIA 1TMKA 1J70A 121PA 2QZ4A 1MR3F 3PUYA 5EP3A 1DE0A 1OXXK 1DTSA 1NLFA 2WJJA 4EJSA 2IUUA 5C18A 2AWOA 1HQYE 4LJAA 2FF7A 3A58B 4TL9A 4BZQA 1W4CA 3SYNA 4ZIRB 4ZDWA 2W00A 4PX9A 1W1WA 3BK7A 4R2IA 3SU8A 1TEXA 3W8RA 2F1JA 4MDFA 4BFUA 2PLFA 5FUXA 4POAA 1EFCA 2GAAA 3GMTA 1COWD 2J59A 1BMFD 3AEZA 1NVWQ 4AI6A 1F2TA 3H84A 2IHBA 2NZJA 3CWZA 1Z07A 1SGWA 4LX0A 1E2GA 3KFVA 4RCZA 3GFTA 1RRFA 1E3MA 5KO2A 4FMDB 5JMTA 3T34A 1YR8A 1GIAA 5FL7A 3W5IA 1OT3A 3QI2A 2P6NA 3UMSA 2F3RA 1QHIA 4DB4A 2GESA 4LV6A 3LNCA 1DO0A 1DADA 2VHTA 1KSHA 4QHSA 5JFGA 4MYCA 1ZD8A 3OIVA 2ZE7A 2VP5A 4Q47A 4UNSA 4YONB 4F4CA 5CDFE 4CEHA 3HYTA 1KAGA 2JATA 1N6IA 4JBWA 1E1RA 3PV0A 3CR8A 2X77A 5GJVC 3TW4A 1SXJD 2JIZA 4YMUA 2XZPA 1MO6A 1W5SA 3GLHA 2REXB 2JLQA 2QMEA 2V55B 4HB4A 4DLZA 2ODEA 2AHOA 2NPIA 3A1TA 4TYQA 1OE0A 5L3RA 1T91A 2IYVA 2VP6A 1G7RA 1TQDA 4MUBA 4YXWD 1VG8A 4OI1A 3U60B 4G1UC 3EA0A 1VYVA 1MRNA 3KJEA 3A6PC 4ARZA 1US8A 1H8ED 3THWB 2HT6A 1DS6A 2HUPA 4A36A 4TZ6A 3PIRA 4D80A 3B1WA 2D74A 2Q9BA 1P9RA 4XWKA 1DPFA 1LF5A 4NL4H 5FPSA 3MG9A 1R5BA 1U99A 4EUNA 2O5VA 3C15C 721PA 1CJTC 1WDTA 2XOKD 3TUZC 2CJWB 3ICEA 3CF6R 4MRSA 1W47A 2V8OA 3LXXA 5FTNA 3JVVA 4TYYA 5CIWA 3M4YA 4KYIB 2WAYA 1WCV1 3KJIA 4PTLA 1GVNB 3IHLA 1G4AE 1Z0FA 3PFIA 3J81k 2F43A 4QFMA 4RZUA 3ZZTA 1J8YF 4LDJA 2QBYB 2IYRA 2GJSA 3EZFA 1II8B 4TQAA 4C2TA 1K8RA 4EPXA 3E2IA 4ZIRA 3UWOA 5EE1A 4F91B 1EESA 1X1RA 3I8XA 2A5JA 1JR3E 1R10A 4R71A 4BLRA 2V3CC 3AVWA 2ZRHA 1M7BA 1TL7C 4D82A 1VCOA 4RD1A 3HU1A 3ZVMA 3NBFA 1AN0A 1TNDA 4AYTA 4B3XA 3LWNA 4GZMA 1G17A 1R7RA 1UDXA 3R9XA 4HAUA 3T1VA 4QL3A 2BC9A 4B48A 3OF5A 1U0LA 1P3JA 1G3QA 4OQNA 1N6PA 1QHGA 5FTJA 3HWSA 3VMFA 1NBMD 3GJ3A 4TL6A 3BORA 2C9YA 2P6RA 2ZS8A 2VSXA 4A0HA 1KHTA 3ASZA 4QJ3A 3K9LA 3LFUA 3QOFA 1FMJA 1H8HA 1OFTA 1HE8B 2DFLA 2FFHA 3OFNA 4DDVA 4V03A 2RGXA 1PZNA 1FOEB 3GJ4A 2B8WA 2GCPA 3A4MA 5D3MB 5E7MA 4B76A 1P9NA 1UF9A 2FEMA 2Z5FA 4FMCB 3VKWA 1SXJC 3KQNA 4WZ6A 2F6RA 4QXAA 2UZ3A 3EZ6A 1GP2A 3DEFA 4QG7A 2X19A 4RY2A 4C7OB 2GVDC 4QBHA 1N5IA 1X6VA 1DAMA 2BIFA 4FXPA 4UXJA 2H8KA 3V4RA 4PHTA 2JJ8A 1GNPA 4PZLA 1GKUB 1GNRA 2JLYA 3B85A 3RRYA 2E1RA 2QAGC 3SYKA 4UNPA 3CZPA 1A1VA 3RS2A 4RD4A 2ZRJA 3THWA 4DVGA 4J0QA 4JLBA 2ASEA 1LV7A 5DIFA 1XD9A 1I4DD 3BBPA 5BN3A 2ZVPX 3MGCA 2GWHA 4LC0A 5TB5A 4CIDA 4AK9A 1CR0A 2ODBA 4Q7KA 2HXSA 1A7JA 2ZS9A 4RZXA 5DN6A 3SOPA 2AL7A 2CJWA 3LW8A 1CJUC 3T1QA 4DXAA 1KI8A 3BB4A 1E0KA 1GSIA 1J2JA 1A82A 1HT1E 3TLXA 4FMBB 2OLJA 3AKCA 2J45A 1Q3HA 5L3SB 5CK4A 4BFTA 4PPNA 3PUWA 5IK2D 3IIKA 3QEOA 1DAHA 3CM0A 3IGFA 4TLCA 4TSFA 3SC3A 3WMGA 3U5ZB 1PUIA 4PFSA 4M9SA 4KBGA 2QSZA 1KSFX 4MRPA 2BDTA 4TMKA 1CBUA 3B5JA 1QHSA 1KI6B 4OJQA 2PMKA 2ZRLA 2CMKA 3UMRA 1XTRA 3CF2A 2O8BB 4JLOA 5FPYA 2IYXA 2BMJA 3CX6A 4LV5B 3TAHA 3H2YA 5E3HA 3B2EA 4B43A 3RS5A 3L0IB 3ZZUA 2OXRA 4BLOA 3BH6A 4P0TA 4Y0AA 4DLXA 5HZHA 2EU8A 3VR3A 3DMDA 1AJEA 5G41A 4JVSB 2QPAA 4MGZR 1KNXA 3AH8A 4PPGA 1II9A 3B60A 1XXHE 2ZRGA 5AJXA 2O0JA 4MYHA 1E32A 3ZD6A 3PXGA 4BRWA 1IXRC 1Z29A 1X1SA 2DPXA 2TMKA 3NC1C 3AM1A 1A2KC 1E2EA 1ZD1A 1VKJA 4A0GA 4Q7LA 1Q0UA 2FH5B 4GDFA 2GK6A 1QZXA 5K8LA 3OAAD 3SYLA 1OJLA 2O0HA 3HPQA 2W2TA 2OCPA 3KXKA 2N42A 3GEEA 5JSZB 4AKGA 3Q5EA 1YE8A 1XBTA 2CHQA 1VHTA 1Z0AA 1Z6YA 3FWYA 3G82C 1UADA 1GL6A 2CBZA 1G7CA 1SXJB 2FDCA 2ZYTX 2PZFA 3LQQA 3A1VA 1XTQA 2QP4A 4C7OA 4OHWA 1KDPA 4TTPA 1AKYA 4BZXA 3ICQB 4KBFA 1EGAA 1GILA 1G6OA 3MLEA 4M1SA 5KNDA 4NPHA 2J0UB 2QE7A 4GP7A 3ZIAD 3R7WA 5HCNA 5GJWC 3BB3A 2GTPA 2LCFA 2DFNA 2QAGB 3NTUA 3CB4A 2RGNC 2GXSA 3I4LA 3VR4A 2JGNA 1ZNXA 5KUTA 4BASA 2WICA 4M22A 1DAEA 4MYUA 1YJ5A 4AKHA 3VAAA 3K09C 3TMKA 4JLPA 3OESA 5L8VA 3CRMA 5E95A 4KSBA 2YWEA 3U3OA 2VBCA 1E0SA 1BS1A 3SBDA 1Z47A 1NSTA 3PEWA 2GJ8A 2BBWA 4NCKA 4BRUA 3C41J 1M8PA 3K70C 4LSGA 4Q5IA 1GKIA 1TU4A 4V0LA 2JLWA 1I2DA 1V5WA 4HAXA 3RAPR 2NO9A 3X1XA 4IVRA 1GAJA 1W0JA 2IYUA 2ZRMA 2VHUA 2D2FA 1I2MA 3BAFA 1KTVA 1YZKA 2V6IA 2VF7A 1OH8A 1OH6A 2XNSA 2IF0A 2XTNA 1JJ7A 1KO7A 4GNKA 1KO8A 4KODA 2ZSEA 1IXZA 5DHAA 2A5FA 3B13B 3NH9A 2ANCA 5E7IA 2ONKA 2KB0A 4RFSB 3IIMA 2ZRCA 3QXHA 3X1YA 4PHFA 3DM9B 4DLTA 4I4LA 1JPNA 5FL7D 4IJMA 4F7WA 4B6FA 4URVR 3GFPA 3T5DA 2A78A 3SS8A 1XEXB 4F4JA 1ZU4A 1N6LA 3CLVA 1XB2A 2J9RA 4DIEA 4H1UA 4A92A 3FHTA 1R6BX 3RS4A 4NE2A 1N2CE 2QTVB 4BFYA 5JHGB 5L3QB 2YC2C 2YOFA 3B8HA 3AGPA 2ZR7A 1N6HA 3B6EA 3QE0A 4AYWA 1E1RD 3L0OA 3MWLA 2YYZA 2JIZD 2JLSA 3ZS9A 1Q1BA 2CCGA 3A36A 5F98A 1KK1A 4PSAA 3BXZA 4JLNA 1KJZA 3CPEA 4OI4A 3QKSB 2H92A 2XB4A 5F9FA 2OV2A 2KI5A 5B64A 2D3WA 3MWJA 2ZJYA 1X86B 2ZE6A 4RCYA 2C78A 4XTRA 4NH0A 1SXJA 1TAGA 4XTCS 1P7CA 1XCGB 5C1BA 4LGMA 5FR1A 4E07A 4GSYA 4PQRA 4WW0A 4ASUA 2PMDA 3RSOA 3NDPA 1W36C 1E2DA 4Q66C 5JCPA 5H8WA 2FE4A 3WYGA 4XVUA 4ZKDA 4AIIA 2BVNA 4R7ZA 2GEDA 1WRBA 1WA5A 4YMVA 5B2ZA 3RS3A 4HYYA 4L8GA 3DKPA 1VCMA 1E9RA 1OXVA 3K53A 1IOZA 3KX2A 1C1YA 3GQBA 1CRQA 2VRWA 4LY6A 4IEEA 1KMQA 1ZUNB 1S3SA 3D7MA 3SEAA 3TIFA 5FBRB 5TVKA 3SQWA 3MWKA 4KO8A 4URZR 1G19A
chains in the Genus database with same CATH superfamily
1XE3A 2JAOA 5DYWA 3NZEA 2NPOA 3KKPA 3BJMA 4WXYB 4TKUA 3PHBE 1P0PA 3D1JA 4QGFA 4WXMA 3SAJA 2X8LA 3NPMA 3QVMA 4RE5A 4W5OA 3ASYA 4Z9YA 3ZWYA 1H6DA 5G1NA 3P32A 3FRHA 3NKLA 3W9UA 4L5YA 3OUZA 4LZJA 4KLCA 1TCBA 4DM4A 1VCHA 2PIDA 2O2YA 4PG6A 4XVHA 5FA5A 9ABPA 3AZQA 3UFXB 3VC2A 1G18A 3LPLA 1XHEA 2H1LA 4DE5A 1OBHA 5IPFA 4B6JA 4N03A 5KYUA 5FBVB 3TS1A 1UMBA 2RH5A 3EEFA 2EGHA 4E22A 2JEYA 1VQ1A 1SQFA 3RVLA 3JASB 3SQXA 3A4LA 4U00A 3F6BX 1WIWA 3INYA 3JQ9A 1Q14A 4KVAA 3H9EO 1STOA 4I36A 3NDIA 5G0WA 1AO3A 3WLTA 3ZJUA 3QIAA 2FZ4A 1F51E 3Q8LA 3K73O 1L4LA 4K9LA 4XIIA 5E1DA 1M1UA 4ALMA 2VT6A 2ZCJA 1Y1TA 2ZQ5A 2GGSA 2VHJA 4G36A 4EPRA 1DAIA 1MZVA 2H65A 2VXCA 3I2FA 3T94A 3HSKA 1E9SA 4HUJA 1EVQA 1XTJA 4YT2A 4G6ZA 3WI7A 1CUGA 1SURA 3E61A 5DX0A 2WJWA 3VR2A 4JBNA 4ZZIA 5F2NA 1QIGA 1IN5A 1NBMA 4LV8B 3OG9A 3LAWA 4D3XA 1CS0B 3CEJA 3R23A 3NHKA 1T9GS 4HH1A 1BJTA 4YRTA 3SXUB 3LOQA 3O9ZA 1U04A 3NVAA 4OXKA 5AVSA 2HRZA 2XNDA 1ZHOA 3GRKA 4MPTA 3VU8A 5AM2A 1MX9A 2HNAA 4DL9A 4UVEA 1QNFA 2A5GA 2IHVA 2QL7A 3CSUA 2JLCA 3WIVA 4D9MA 5FUWA 5K9ZA 2A94A 1P5HA 1UJNA 1KK2A 4X8HA 2HWWA 2WWFA 2BFDA 4XVCA 4KRXA 2P90A 1BOFA 2CLSA 3ZHXA 4Z5XA 1QFZA 3EGEA 1L5ZA 2VZ9A 5IANA 1OASA 4PZAA 3KLOA 2X42A 1VG1A 2A14A 4HGPA 1VG0B 4I1VA 4CV1A 4I8IA 5DNDA 5JWHA 1VKOA 3HBFA 4F84A 1E6CA 1URPA 2XKAA 3A10A 4WIAA 5DBFA 1NUAA 5FDFA 2C2OA 4AJKA 1KI7A 1X1BA 4AF6A 4U7DA 1XNHA 1I13A 1K7YA 1Y33E 5A4FS 3BWBA 1BROA 2HQBA 1KJIA 2CUTA 3G2OA 3DBOB 5EGSA 1JU3A 1ZVJA 1ID8A 5INTA 1ECJA 5C5DA 1NBEA 1DAKA 2BZ1A 4NFYA 5FOTA 5JZOA 4UOZA 1I7QB 3PX2A 3MOSA 5JJLA 1Q7EA 2E4WA 2WR8A 4KR7A 3UXHA 3V8VA 2P5UA 3KHKA 2COKA 3RC1A 1X7ZB 5F2OA 3MJCA 1DELA 1PEAA 1ZXXA 4E70A 3BE6A 4CYMA 5E9AA 2J46A 2JI7A 1Z5VA 2VPWA 2AFHE 3IOMA 3OHSX 4TSFD 1TLLA 1I3MA 1JAIA 2J0QA 3I0NA 3C3PA 3KAQA 1IG3A 2GNOA 3QE4A 4XYGA 3WBFA 2XZLA 4WJZA 1KPIA 1FUYB 4G1EB 1ADJA 1LCIA 1PJRA 1SCNE 2DE0X 1DRVA 3OQHA 4LG1A 5EJAA 4DNXA 2Q6IA 3ZPXA 2PJRA 2RGBA 4UAJA 2R68A 3CURA 3RHZA 3WLRA 3F8TA 1ZH6A 5TY0A 1XJCA 4DMMA 1XHFA 3EBOA 4ZI7A 1ZL0A 4IDDA 3NHZA 4CODB 1F7UA 4DBZA 4Q9KA 3B6IA 3EY4A 1CY1A 3LBHA 2AEJA 2A9VA 2ZAYA 5ALPA 2E18A 4BB0A 4KUEA 3D6NB 2EDAA 4YRKA 2YXDA 4ZQGA 4IW3B 5CA0B 1DUVG 2QYOA 3RFUA 1N2HA 2E9SA 5DCUA 2ACVA 5FEMA 3E4CA 4J8PA 3L4SO 1BJRE 3V8EA 1QLHA 3ZE8A 1O96B 3OQNA 3HM9A 3QX3A 3ECCA 4EY3A 3O2JA 4LXGA 4ARVA 2WJZB 5EIEA 3I62A 4OHYA 2QVZX 4ZD6A 3TJMA 3LUCA 1MVNA 2YHIB 5BNZA 4L95C 1XQ6A 3FMFA 3GZTB 3UWKA 4EY8A 4CIBA 1YS7A 3ESQA 2C1XA 4KB5A 3L9XA 2AUNA 3NB0A 1Y80A 3EUEA 1OTHA 4LHXA 4J1TA 1SEPA 2IA5A 2JJYA 4YAJA 4B6GA 4CGYA 2D1FA 4YRZA 5A9TA 3NWOA 3ELBA 4OXYA 1ECGA 2VZLA 3PXEA 1Q1AA 4JKIA 2ZUTA 4YAKA 4E5YA 5B3LA 3VM6A 1TZCA 4F8JA 2Q1WA 5KNDD 5IVDA 1YR6A 3JYHA 3WWPA 1H4TA 3T99A 2XMGA 4J2HA 2ZATA 3TDMA 2HNBA 1ZS9A 2C8VA 4JDUA 3CSSA 5AICA 1D04A 1O8BA 3L5OA 3HNRA 1H05A 5JBIA 3RARA 3PUKA 4X8LA 5DLYA 1E3QA 3BH0A 1V8FA 1X80B 3KEMA 4CF3A 4HMQA 2PTGA 1MDBA 2YJZA 1QK3A 2FETA 3LQKA 3PE3A 2XUGA 2QZ9A 2EZTA 2WU4A 2QTRA 1YE3A 4RE6A 3GEIA 1M0SA 1Q1EA 2I3GA 5B57C 3KXDA 4L16A 1M1YB 5AVXA 1RLIA 1X7HA 3BCSA 3TSAA 1EMDA 1JFLA 2FZ5A 1E6KA 1NVUQ 2PPLA 3DYIA 4EGSA 1RADA 4ND1A 3EFOA 2EKBA 1EDEA 4NK5A 3UWPA 3VC7A 3ZEAA 1FPQA 3FOBA 4RH3A 3EZGA 3T7JA 2JD1A 1IPEA 4I81A 3LHDA 4ZVVA 2WP8J 4BMYA 3QKRA 4U1RA 3SYTA 2RCYA 3W79A 2A0UA 2R7AA 2VDVE 4IMIB 3UJAA 4RXMA 4YLGA 1C7RA 5JPCA 1SH7A 2VF4X 2RAVA 3L05A 3FOCA 1ML4A 4GWLA 4K9MA 1RKXA 3H4MA 3MS4A 4AUEA 2VSQA 3WIUA 3EXG2 1OBVA 3INTA 4J0JA 5F12A 4N3NA 1TYCA 2HTFA 3SR3A 1LS1A 5KTYA 2ID7A 3JQ7A 2SHKA 1T9HA 3WRVA 1DLIA 1CZHA 1U0SY 2DPHA 1G9TA 1IM5A 1M1YE 4GX2A 2W6PA 1C0LA 2XE7A 1GSAA 3AILA 1EVLA 4FGWA 1OXKB 1YBFA 2PVPA 4FDTA 4MQ4A 3S2ZA 4OMFG 4J1SA 4ZT7A 1WB9A 2D62A 3YASA 4RGVA 3HJCA 1M6VB 1ZKDA 3KOXA 1QJCA 2B98A 4FMPA 5IC5A 5JVDA 5L95A 4M9UA 4MUHA 2IYZA 5LBUA 4YCSA 1XI2A 2C5FA 1PL7A 5B55A 1TYBE 3JXEA 3DAGA 5FULA 4EHNA 1QUEA 2YL2A 2ZE5A 3L07A 3BDVA 3QHAA 5REQB 3IOBA 2SNIE 4HXGA 4MP6A 1T13A 2JEZA 3BWXA 2ZSAA 4HDRA 4DG8A 3WB1A 4MVJE 4B3SB 4Z7QB 4LJYA 4EYEA 1R9MA 4C0SA 521PA 3GPBA 4QRHA 5IKXA 3M7IA 3OPMA 1C9NA 1CUDA 4C2AA 3O21A 4LJLA 2X22A 2WWVD 2DPLA 1M34A 1QB7A 2GPWA 1UBHS 3AP3A 3IUEA 3OBBA 4E6PA 1RXWA 3NJ8A 1E9DA 2BFPA 1P1JA 2VPYA 5IEBA 5EPUA 3KB1A 4Q16A 4Q9JA 4PO8A 1GQFA 1O6FA 1Z2EA 1XLVA 4L85A 3O8CA 1XAJA 3LHIA 5DFAA 4NONA 3OF2A 4RVNA 1QVRA 2R00A 4BU0A 3WNZA 2ZYVX 3EUWA 5FH9A 3WYDA 2PUWA 1T8PA 1LI4A 1D6JA 3IESA 2MSCB 3PA8A 3RFXA 4QKQA 1JDBB 5BW8A 1L3CA 4RMNA 3E9NA 2IV7A 4CM9A 4DMCA 4ZVRA 4LF5B 2O48X 1DZ3A 3EGDA 2B9EA 5TJHA 2ONYA 4ZDJA 5LZ4A 4UE6A 3CINA 5T4EA 1ITZA 1E6WA 3CNBA 4Q34A 4QATA 3ME5A 1C3OB 1O97C 1ORWA 3AWDA 3T3EA 1V1RA 2QRVB 1ZEMA 3HRIA 4INZA 1RRGA 1NX6A 2CNWA 4JYCA 1GQYA 1UM9A 4FOTA 4D9BA 4IUBS 3H2ZA 2AE2A 1WF3A 4HNTA 5AVVA 2R4QA 4DUGA 1ULZA 2Z2JA 2F9FA 3T61A 5GMOA 4NE7A 3VU9A 5AFSA 3BBLA 3QBEA 1C1XA 2BGLA 3Q7RA 4RD0A 3PJGA 4E03A 1R6TA 3AY3A 4BLWA 1ZM2A 2Y6VA 4BB5A 2IEZA 1YVDA 3DFUA 5DPMA 2G9NA 1PL8A 1H4VB 2XDQB 3PCXA 2OGTA 3A4YA 3R5KA 5K8IA 4HB3A 1FTYA 3BMCB 2X1HA 1TI7A 2PY6A 3D31A 1EE2A 1FFXA 3MMZA 4S0XA 4DS3A 1DCFA 2FPIB 4ES6A 3AFGA 3L40A 4P08A 1DC8A 4JEIA 3R0ZA 4JUFA 3BJIC 3M6WA 2UXCB 1SN7A 1A95A 2RB5A 1O9BA 1SKBA 1ZMOA 2GTIA 1CG6A 2H54A 2Y0PA 3EZ7A 4GG1A 4M1QA 4O0MA 3EGIA 3KLPX 5DB4A 3EXEB 5DP1A 3RIMA 1TJPB 2ZSKA 3ZIUA 1OREA 2ODNA 3UCXA 2AK3A 3T7SA 1AK2A 1K7CA 2JFGA 2NV0A 3PRKE 4PX2A 3H2BA 3RVNA 2CL5A 2NTNA 2B0JA 2V6JA 3FVQA 5H81A 4DJTA 3QBTA 4DNOA 3PITA 5LQUA 4I55B 3TFWA 4JI1B 1SELA 2ORED 2VO1A 3OOSA 4DLKA 3EVEA 4C0AC 4JUBA 4EI7A 1F6DA 1W25A 2QYTA 1S8FA 3G5UA 3WWOA 1JBQA 2FOXA 2CNOA 4RWEA 2OYCA 4JCCA 3CUEF 1F12A 4HTFA 5LYYA 2C4NA 3CLUD 4G4SO 5AUPB 1H2ZA 2PK3A 2PSDA 1A7KA 1XTBA 1L7EA 3CRW1 4IOMA 3MJTA 3SF8B 4WA7A 3ZWQA 1Q1ZA 3V4VB 4RKWA 1HDCA 3D4BA 3HNOA 4S1PA 3I9V6 1A50B 2QQ0A 1VB3A 5D6OA 4BO8A 3TCKA 5D5HA 4ZT4A 4MOWA 5BMVA 1K6JA 4BVAA 1QVZA 3DSRA 1VL1A 2ZJ1A 4Q48A 5BY2A 4DAEA 3PSAA 4YAUA 1ZU5A 5JS8A 3I01A 4Z49A 1SBQA 2PLWA 2FZKA 4NYJQ 3A1EA 5F4BA 1PR4A 1E2FA 1NE7A 1M8JA 1EA5A 2OPBA 2ZW9A 3C5VA 4X45A 3RKRA 3HO1A 1E63A 1SC6A 2J9FB 1NJ5A 4GKVA 2CN1A 1G3MA 2PX2A 3KB8A 4G1MB 1SXIA 1JSZA 2VDJA 3HDJA 3I2YX 1EGHA 1BVYF 2GCOA 3BWEA 5IKOA 4AM8A 2FOLA 3ZWAA 3I09A 4MR7B 2Q7DA 3WY9A 2H9YA 4JNKA 1UANA 3SJ7A 1Y6JA 1GZHB 4UXHA 4BC0A 3HFRA 4FC6A 5FI0B 2FX3A 3RWMB 1ZH8A 4D4HA 2XTMA 3A6JA 3CH6A 5L4SA 1GR1A 3PA6A 3IKLA 3MMNA 3PVCA 4RK1A 4CVNA 5DASA 4F3RA 4F6RA 4EYOA 3AONB 2Q3HA 3FMOB 3NBQA 4GE3A 5EMKA 2PLRA 2W6JA 3NKVA 5TQ0B 3U3MA 1QC5B 1IUPA 3AHEA 1F1JA 3D8HA 3ZV7A 2XWPA 4ED9A 2VDOB 1ILWA 1SVMA 4QOHA 3G1WA 3MM4A 5DM70 5KAMA 1AUPA 4TTVA 3V6MA 4CRWB 4OY3A 1NRJB 1XDZA 2I4OA 1YBAA 3IELA 3W5JA 4KWCA 4UPVA 3TSZA 2X6RA 4OHBA 1KEPA 3HVKA 3S5JA 2R8RA 3SBEA 1BYUA 4KIGA 3VZQA 3GMDA 4QPCA 5JCOA 4DLLA 4Q3KA 5ELLA 1BQEA 3NUQA 2GS9A 5A71A 1MOPA 1JDUA 2HIHA 3COYA 4W5JA 1O08A 1U0GA 3WK9A 4JV5B 2V7XA 3QV2A 2MU1A 1IVYA 5KOYA 4R40A 3GV0A 2R8YA 4XJVA 4CTNA 3UJCA 1W5FA 5CCBA 3D6AA 1BQ4A 1R9JA 1DRUA 3CLSC 2NV6A 2RHWA 2OECA 3OCCA 4YT5A 5BNFA 3SF0A 3I5XA 4ETWA 3JQRA 4FU0A 1EJ0A 4CE6A 2C1EA 1U7UA 3QOWA 5HKOA 5KVCA 3EMKA 13PKA 1UQRA 2A1TR 1K7XB 4N5HX 1GKLA 1U9CA 2B1JA 3CUKA 2GN6A 1RQGA 1W87A 3M5PA 1K5GA 2AW5A 4FVTA 5G3YA 4ZVSA 3WHKA 4A0RA 3JZDA 3R76A 4DJJA 2YYYA 2NO4A 1ORIA 5C35A 1OFUA 3BUSA 3FWKA 5BXQC 3PWKA 4JT4A 2GN0A 3L0PA 3I30X 3FNEA 4X1OA 1KIMA 1HT2E 1VBFA 2ZRKA 4JL8A 1QWOA 1MD9A 2FA9A 2ZVJA 2QQFA 1ULSA 3KYCB 3PFWO 1CIVA 3PT5A 4LJ4A 5ALJA 2AVDA 3PRYA 2Q45A 4I1RA 2VJPA 4AY4A 2XTAA 3CLUC 4UQLA 2JIBA 1XVVA 2AJTA 1WW2A 2R7MA 1MJGA 3ORRA 1PT6A 3VVLA 4BO0A 3W78A 4IQ4A 5JD4A 3E8XA 1JA9A 2SICE 2YHSA 1DQYA 2NU7A 2BF4A 1ZGZA 4FDVA 1FNCA 1EX7A 5KOIA 3OSZA 3T3IA 3USES 2VYCA 3ZI7A 1IU9A 4PHHA 2W42A 5BWOA 2C7QA 3GFRA 1JKJB 2EATA 1ZQ1A 4E2FA 3KU1A 5GJCA 3BWMA 5CYPA 4OO3A 4TSRA 5TQ2A 3RYFB 4C4YA 4DZZA 4F7DA 1O2DA 3KQHA 4E4YA 2IP2A 3AJAA 3RYIA 4DSOA 3SZMA 2EL9A 2ADFA 2IWRA 5AW0A 4D3SA 1HE3A 3Q7SA 3U7EB 1SOVA 3GUHA 2FWMX 1S02A 1EZ4A 1UBEA 3BJZA 3ZE2B 1ZGHA 4CKWA 3RAFC 4B32A 3ZZMA 3H86A 4XIFA 2I5PO 3EPJA 3M4XA 3RTBA 1U9IC 3OPNA 5CR9A 3H5RA 2JGFA 3W2HA 4GOND 2V6FA 1GV0A 2Z83A 4G5HA 3T3PB 3P27A 7YASA 1U31A 4RK5A 2Y0CA 3L7MA 3QLVA 2CLDX 4IUYA 1HTTA 4X7RA 3HBLA 2EARA 2NXWA 4A3SA 3H1BA 5YASA 3K6KA 1BG6A 3SX4A 4M8IA 1RS0A 5IBQA 1LLQA 3VH1A 5ALRA 3L4BC 4BMXA 4MHSA 3EWSA 1VLVA 2HMTA 2C4UA 1QOPB 4IS2A 3ZK8A 1R64A 2Z2XA 1IN4A 4LXXA 3IIIA 2A58A 1JPUA 3IVRA 5BR4A 4Q1CA 4BAUA 1VIVA 3GNQA 2J08A 3UT5B 2JG3A 3FUCA 1NYQA 5LQCA 4FYXA 5F64A 3Q5DA 4KREA 3KJNA 1JHAA 3DOUA 3RG2A 1G3UA 1EIZA 3OWOA 4DBLC 3ZD7A 4X62B 2WTEA 1NE2A 1P80A 5LBIA 1WPGA 2AFIA 1GR0A 1UBRS 2RJNA 2WSMA 3F78A 1Q12A 2P3LA 4FYMA 4RA9B 1BXRA 4TKUB 4TUYA 1G41A 5LYJA 4J3NA 4ENQA 1GCUA 4EGAA 4JGBA 1D2EA 2JL1A 2XD4A 2R2AA 4Q21A 5EZSA 1CUCA 1RRCA 2OO7A 4YO8A 2ZVQX 4CJXA 1OFHA 4J0FA 1ZWLA 2BHRA 1PV2A 3ZJYA 1RM4A 5EHGA 3U09A 2VYNA 4IWYA 4X20A 3RWOA 4C7KA 2QUAA 3UMYA 1NW8A 1DC3A 4JKOA 1IJKA 2WU0A 1GNLA 1YJBA 2GEVA 3SLRA 5TF0A 4NV3A 2I6FA 1UMBB 2GFHA 3L8FA 2PT7A 3VZCA 2ZAGA 1AA9A 2JLBA 4HAWA 1DG9A 5IZCC 1IBMB 1TQ8A 4IKOA 5JMPA 4IY1A 4B6PA 1Y1SA 1RXYA 3K0CA 2HRDA 4GXTA 4NATA 1TO6A 3VGJA 1GUBA 3ELUA 2JFXA 5B6JA 1A2OA 3QEJA 4BVGA 2JZCA 3VFDA 1NJSA 1DCTA 2UUCB 2JH8A 4AUMA 1CTQA 4RU1A 2OQRA 3HCDA 3CEHA 1P4RA 3QVUA 3CX3A 4P4SA 2OFXA 3EVBA 2Z6QA 4C0WA 4Y0VA 2VBFA 2YOHA 5FFNA 4YIKA 4FDMA 5KNBH 5FLYA 3IBYA 2RD2A 3WIEA 1QIKA 3NHUA 2A30A 4PNZA 1A4XA 1D09A 1JLKA 3WOHA 1AE1A 2PSHA 3OU6A 4AZ3B 3ADKA 4E2ZA 5KYWA 1GM5A 4FPXA 4GLOA 1FFYA 2J41A 1J0XO 2D1QA 4O8ZA 2A9RA 4OHVA 4UNNA 4RX1A 1C9EA 1K75A 2AB0A 3O1JC 3N0XA 3ISTA 4DQDA 3CJTA 1UT6A 4B7ZA 2QMOA 1E6MA 1Z8FA 3M5CA 1CDOA 3I42A 4LYEA 4HXEB 5TS3A 4EPWA 1FZQA 3WIDA 1FLNA 3DEZA 5AUQA 2JS7A 1NVXQ 1XQWA 5CDUA 2BFDB 3K1AA 5KNCA 1Y8ZA 2CSXA 3N59A 3M1YA 3FOZA 2AOWA 2AYZA 3OJXA 5A3VA 4YT4A 1C29B 3B53X 4Q4JA 1SHJA 2H18A 1P91A 3I8SA 1EINA 1CX9B 4B6SA 2VVTA 1NBME 4B7AA 4B2IA 1KYXA 3I9FA 1TEZA 3V46A 3DAOA 5DU2A 5CDGA 2AKEA 1IWBB 3JD2A 4HFMA 1E79D 4LVNA 4P3YA 3IP6A 4QHYA 3HBJA 4OHZA 1DOZA 1YJAA 4BN0A 5K3FA 5JSFA 4O4JA 5FWNA 1S3GA 4J16C 4OVKA 4JNCA 1I01A 2CMDA 5E7JA 1N7HA 3I9MA 3E9QA 1H0HA 1JYEA 3M9LA 1MO4A 4R5HA 5AM3A 4XJTA 4D9NA 4YAFA 4G0XA 1EQAA 4JL5A 1TRKA 3V9PA 2ZSBA 1L5FA 5AKKA 1U3GA 2BUCA 1P31A 4C0QC 2J9XB 4CQLB 1DI0A 4EHDA 1M8KA 3NO4A 5C8YF 3VR1A 4UU8A 2HT1A 1Z0IA 3EXHA 5A5VA 1AUVA 4HZUA 4P5PA 3G6WA 3U7RA 1VMDA 2NO5A 3CNLA 3ZJ4A 1EVYA 2KE5A 4HXFB 4QTTB 3PCTA 5EE5B 4L0DA 5BSRA 1I80A 3PQCA 1E1MA 3WLOA 1R0ZA 3TRJA 3IP9A 5FOVA 3K6SA 4Y2GA 1W73A 4IKPA 3HCAA 4J9VA 4ZI7B 1Q83A 3ZHVA 4BL5A 2GOYA 5A9SA 5ICMA 1QANA 1E7RA 2DP4E 4UBMA 3RVJA 4TL7A 2PS3A 4E5SA 3KZXA 3UB3A 1PNRA 1FLAA 3LX6A 3KE8A 4FDUA 4AWXA 1TLTA 5CB4A 5CB6A 1ULUA 5JBNA 1ZBDA 1ZD5A 5JH7A 4OJYA 3C74A 3QPBA 2Q3JA 1QTRA 2FSFA 3EGVA 3GXOA 4LHWA 1IZ9A 4ND3A 4B4WA 4F4HA 4U8GA 1G5TA 1N2CA 2O0LA 3ND5A 1VHQA 2JGDB 1LBSA 3KJFA 5E7QA 3H7AA 3VNSA 4K86A 1L7AA 3OTQA 2AN4A 3F0TA 4IHKA 1KSJA 1XA0A 4U39A 3BGDA 2OC4A 1EFTA 4J4BA 3E35A 1N2OA 1A27A 2Q1XA 4ZK6A 5BSMA 2WF5A 1ODCA 3EC1A 3NVDA 2BZ0A 5AHWA 1Z4MA 2ID8A 1XFAA 1BX1A 4YMWA 5H70A 3WBKA 3HVRA 3BXOA 4G0ZA 4UAUA 4X44A 3SSOA 1K2VN 4X61A 1KU0A 2PT9A 2GAOA 4WT7A 1M2EA 1AY0A 1DRKA 2ZB3A 1K9VF 3P94A 3EUFA 1PFVA 5I7EA 5F51A 3OEED 1PN3A 2BKVA 1EHIA 4BQEA 4DMRA 2BGNA 4Q9AA 1BDHA 1VYHA 1KBQA 2HLDA 3VI3B 3I53A 4TKMA 1FFBA 2DR2A 3GCXA 5TLSA 3O82A 3BZUA 2JA2A 1Z8DA 2J7PA 5CH5A 3ZWVA 3LT1A 4E15A 4ZCRA 1JMKC 5EP1A 5HZGA 4OFWA 4FZ5A 4YQYA 3U1TA 5JJCA 1W36B 5ITZB 5JZ9A 4FWBA 2WVHA 4IHAA 4YI3A 3KXLA 1QF7A 2Q99A 1RD4A 3WMEA 2ZPUA 3ZQ4A 2Q3DA 2JZNA 3AZPA 1XEWY 5IFKA 1NQXA 3ESZA 3QUSA 3TZ6A 2RIPA 4ZYWA 3PEUA 1AHIA 3MNFA 3A37A 1DQRA 3QPCA 2FUCA 2QM7A 4OQZA 3HK2A 2OHJA 4TL8A 1RPTA 4XD7A 3S2EA 1RHUA 2AOTA 1CQJA 3UY4A 2XT9A 3RODA 1SVLA 4Q3NA 3T7RA 1CFZA 1PFYA 1U2GA 1Z63A 1H5QA 1ZN2A 4US1R 2XUFA 1LK0A 1H69A 1CT9A 3DMPA 3ROPA 4EUFA 3QKRB 2FCAA 2ZJ4A 3X1DA 1VE6A 4HGQA 2FFRA 5KU1A 3AEUA 3A2KA 4HEJA 1W9HA 3F1KA 1PT5A 2HU2A 1F8UA 4PNHA 3QPUA 4JJ4A 3HR7A 3T8YA 3KNZA 1M2WA 3FLAA 1YZFA 4QICA 1M2GA 2IYLD 3PE4A 3U40A 3MILA 2GR9A 3HSYA 4HVCA 1P61B 1I4EB 2O0KA 1RYFA 1UEJA 4MQFA 4MW6A 4PC7A 4L8LA 3R3XA 3HRKA 4WZAA 1YL7A 5AJZA 4ZRMA 2VXYA 3NNSA 3Q7PA 3GEBA 1VPTA 5JVDB 1I3NA 1RQ7A 5LPNA 5IW8A 1DPGA 2WNIA 4KZKA 2R4UA 4OJNA 2H4HA 4D8XA 2EQAA 2H9AA 1X2EA 1J7JA 1U6IA 2R47A 4BU1A 3GLIB 3H3XA 3Q0EA 1WSAA 4R9SA 1IQRA 2A1IA 1KZ7B 3BEOA 3R5HA 5EP2A 4FEYA 4ETMA 2AUMA 3LP8A 1JLSA 2XJ9A 1NAHA 3BA1A 5K8VA 3ZDAA 4FNOA 2IUTA 4F21A 5FFFA 2PV0A 3KUDA 4HDRB 4KKVA 4IHQA 3E84A 4B3CA 1EFAA 2R7NA 1E5TA 4BV3A 3BIXA 1G8MA 4Z0HO 2MSLA 2O8CA 2C9OA 3T5BA 2P3OA 3SWWA 1RHRA 5U4QA 1PJ3A 4LK3A 4Y9RA 4CT4B 2G4CA 2AZ4A 3S40A 4DN6A 3LFHA 2I2WA 2X2EA 3OT5A 4NYMR 2VJCA 2HHCA 4BJ1A 3A6EA 3N2LA 1M2VA 3EXFA 2VDWB 2Q4TA 3IT1A 4ER6A 3NHPA 4WY2A 4MUEA 1TJYA 1XMIA 2GD6A 4G0NA 4CLHA 4G63A 1T3GA 3OPVA 4XD2A 4CM1A 4DA9A 4B8YA 1DAOA 3AVUA 1WZ2A 5BQXA 4M8NE 3QWFA 3B2QA 1EP2B 4RJLA 3ZWMA 1RJWA 2LXNA 1AC5A 3UMCA 4XRRA 1YQTA 1Q7BA 2O7NA 3S99A 2VHWA 3SSMA 3L4KA 1BN6A 4Z4IA 1RYHA 1WCYA 4RW0A 1VMKA 1YCHA 2ZULA 3N76A 3QUQA 3OE4A 4MJLA 4MV6A 2OGSA 1RIFA 2DT8A 3RUAA 4B34A 1QQTA 1GNSA 3A6GA 3A8TA 3AF4A 4ESVA 1V1RB 3F73A 4FGSA 1ZPDA 1CP2A 1EUCB 2GJAA 3DM5A 1QHNA 1M34E 1X3SA 2PUBA 3FTCA 5JI3E 5CYOA 4A5SA 1EYZA 2G1AA 2XSZD 2F1IA 3OE7D 1KQNA 2FN3A 4CFSA 1PV4A 5KQPA 1D2AA 5TARA 2EKDA 3K8YA 2P2DA 2R6DA 4DA8A 1T26A 3KVYA 1SU4A 4PLCA 3KU4A 1D4OA 1G8KA 1KAOA 4RQAA 1XR3A 2VYQA 4RFLA 3I76A 2WV7A 1QGUA 4IGFA 1Z37A 3EPHA 5DYTA 1W2GA 1FFXB 2COEA 3FA2A 3UQYS 1B7GO 1UK6A 2BI4A 3M1AA 1Z5UA 4LXIA 4HLNA 3R4CA 5IT0A 3BCUA 4GHWA 1SUFA 2Q3LA 1CR1A 2QL9A 3IA7A 4MLDA 1PGOA 4Z4EA 1XNRB 1SC1A 4UBLA 3ETHA 2XMPA 1OOEA 3PR1A 1NURA 3AR2A 4CM7A 1ETHA 2XITA 2ON6A 5C37A 5JVDF 2BN4A 3UK1A 3GLFB 1Z4OA 3U6KA 2O8EB 2JANA 3WJ2A 4L5CA 3QOXA 3TKAA 2BD0A 1PGPA 3SNHA 4P34A 4L6IA 1L1EA 5LZ9A 3THYB 3WTBA 5GZ3A 4FI3F 4ADSG 1USIA 3DVSX 3JRXA 1PJTA 4HTFB 4D1YA 1YQQA 4H0CA 4GPD1 4D0NA 2VNJA 5LJLA 3GROA 1EDBA 1II0A 2G8NA 2Q4OA 3BOSA 1SY7A 1QDUA 1NDUA 3WGQA 5BMVB 1KMMA 2NTVA 4J49A 1U2DC 1XO1A 1E8NA 1I1OA 2MMGA 3D6FA 2B94A 1YC2A 2WF7A 3EWNA 3IA2A 2H3HA 4HCJA 5JAMA 4IJ6A 1ZA2A 4WLUA 3RQIA 1ML3A 1PE0A 3SQLA 4HY3A 4KWIA 2GWRA 4R7GA 3FCSB 4AS2A 3GLFE 2XTZA 2GCOB 5KQMA 3BREA 4RCVA 2YMQA 3CPSA 3QXGA 4PZYA 3S2IA 1UBLS 1R3DA 3TXYA 3UC5A 2XDAA 3GGOA 1Z6PA 5EPEA 1SVNA 1NPYA 5C4GB 4REOA 1VE7A 1J1IA 2JJ1D 3PNQA 2R6HA 4AP5A 1R0RE 3VHLB 3EARA 3TB4A 3VNQA 3ITDA 1LVHA 2XV1A 4YY3B 2DHEA 1HQKA 4F6RB 1NVTA 2ZSDA 5BVHB 2EF1A 3NX4A 1QQ7A 3ONWA 3LKBA 2WSIA 4MINA 4FXOA 2HPVA 4L76A 3WK8A 1R50A 4GYYA 5HBGA 9LDBA 1O77A 5ER9A 2IE8A 5ENVA 3GMSA 4URXR 1Z74A 1ZOPA 2QMUA 3BIWA 2R8PA 4G0QA 1JSLA 4MNTA 5T6BA 3TXXA 1BKYA 3GPIA 4CLDA 1KBZA 4B2LA 4BEWA 5HIJA 3WGUA 1D2RA 3LUBA 3U4IA 2HHJA 4IH1A 4YV2A 2H0RA 4QZVA 4HUQA 1WBDA 3NH6A 5JATA 4YMIA 2IXGA 3E9MA 3IEPA 3AW8A 1RM5A 3HA2A 5L4NA 4ARBA 3ZJVA 1XZAA 2R5NA 4AECA 4C0HA 1PUXA 4NABA 5KB3A 4CDMA 3H5OA 3N53A 2Z09A 3HCCA 4L3OA 4BFXA 2JGEA 2PA3A 2XZDA 1JIQA 2DFDA 4J7CA 1XX6A 3CX7A 1FU7A 1MOZA 1G7SA 1MIHA 3L1UA 5JBQA 4JI2B 1IWOA 5CLGA 1VRCA 3RM3A 4P0PB 2P9BA 2CFCA 1QS0B 2PXCA 2EKQA 3OLYA 5TRTA 4KW7A 4M36A 1E0JA 2BW0A 2HIMA 3AJ9A 3VR4H 2VP0A 4J0GA 1L4HA 1EJ6A 1Q20A 1A8UA 3AR7A 2E87A 3I32A 2ONJA 4WSOA 3RG8A 4CDNA 1W29A 1ADCA 1OAOC 4LZLA 1TQHA 4DARA 3D3KA 2NSLA 4HRYA 5DRYA 3CWQA 5K6AC 3MFYA 2I65A 1FLVA 2XUJA 3D4NA 4GFDA 5LQRA 4D97A 3EG9A 3D1LA 4LYAA 3VH3A 1FQOA 2H57A 3KEFA 3OWXA 1B23P 1M10A 2C03A 2YY6A 4MKGA 4X1KA 1CETA 1KO1A 2V7WA 3DE7X 2N1BA 3EWAA 4G9EA 5JQGA 2X9QA 4GX5A 2EXXA 2R6R1 4YRCA 4RC9A 3TLJA 4H0FA 5TQ2B 4ZYYA 4NP6A 3GNLA 4L15A 2OO5A 2CEAA 4QUJA 5CYFA 1LDYA 2BZSA 2ZP1A 3CPJB 4OKIA 3GJXC 4D25A 4H4EA 2IGTA 4H6WA 4OAPA 4P4TA 3DAHA 5CGZA 5B3JC 1HTWA 2NZYA 5AKJA 1IWPB 1TAQA 1OSNA 4HGNA 2OEPA 2OHVA 1XPUA 3DW3X 5FNZA 4B4UA 3VC3A 5E1OA 3D7NA 3A3PA 4QT0A 1GZVA 1ISFA 2O2ZA 1XMSA 4TKZA 4BO4A 4HN9A 3E7PA 2HSJA 3A4NA 5KYKA 3JQAD 5A5FA 3KDPA 2HJHA 2FHPA 1DINA 2MWMA 2BGKA 1YFZA 3OLVA 4O63O 2RG1A 5JI2E 1XRQA 3D9QX 3QPAA 8OHMA 4AQDA 2FFAA 3AL0C 1FDOA 5DLPA 4JU9A 2HRRA 3MINA 4LHYA 4G1BA 1U63A 1OH7A 2XUZA 4M0UA 2GCIA 1OC4A 3DVLA 3EVFA 4ZRDA 4AWBA 1IEWA 1KIAA 5KJEA 1E64A 1NBAA 2P6MA 4UUPA 5JDCC 2ZUBA 1E2JA 3R40A 3UATA 1K92A 2PKEA 5HX7A 1WCWA 4V02A 1FTNA 1T5BA 5DULA 3W3AA 3HYRA 4CL2A 4CMCA 4PS1A 1JHYA 1AMNA 3PFCA 4PGMA 1BE1A 4KMOA 1ZK3A 3TAUA 1T6NA 2FI1A 4HDKA 3FZNA 4HRAA 2NW6A 1SPXA 3LLVA 3C0KA 3HCNA 1LVGA 1RBYA 4HRXA 4Q1FA 5ILGA 1XDGA 1FYEA 4W9MC 4UJ3A 4EAQA 3C14C 3IO3A 4QJ4A 1IMOA 3ULKA 1YA8A 2AFIB 3T3NA 4TUYB 5K20A 1BXRB 5LYJB 1XF9A 1M1NA 4FLMA 1POWA 4K46A 1KETA 4S0ZA 3DTTA 4EB6A 1ZISA 3PF9A 4B80A 4L9WA 3WA7A 4FD3A 5L7WA 1FJGB 4QT4A 1I4LD 3ESXA 5GADl 1JR3A 4IIGA 2J31A 1JDJA 1FS6A 1O6BA 3HN6A 1LU9A 2G1KA 3V4OA 2D7JA 2JJ2A 2QPTA 4P84A 1XCPA 4JCOA 5F9HA 1U0NA 1XUOA 2Q5HA 4QD3A 3KETA 2GPBA 1T2UA 1X13A 2IC5A 4ILEA 3R8CA 1NDHA 3Q0IA 4EUKA 1RMYA 3ENQA 5JWRA 2C5LA 4XWYA 1P73A 1XU9A 5JAOA 1UWCA 3KT3A 3LY5A 4NZOA 3NIDB 4LRSB 2WJVA 3RANA 4TYPA 4Q12A 1TIBA 3KJHA 3DMFA 3NV9A 3PS9A 4R2MA 4HT3B 3DG9A 2CUNA 1RHMA 2AFIE 1FFEA 2QE6A 1SBIA 3AF3A 3Q6MA 3W4JA 1DT3A 2HRBA 1RBQA 2R44A 5D84A 3KWLA 2ZIUB 3LWDA 1TCCA 2P79A 3AUTA 2I71A 2GDJA 2VZEA 2QBYA 3ET5A 3RVBA 1E7SA 3LM8A 1N78A 1HE4A 3TDNA 1X70A 4P4SB 2VDKB 2ATXA 2P8JA 3BJRA 3GJSA 2XWJI 4U8HA 5FTWA 3V4PB 1AV7A 4DUYB 1M3SA 3KCNA 5L7YA 5MHTA 4EQZA 4P5DA 1JXAA 2FSVA 3PKJA 1DJOA 1YUBA 3GBPA 3WS7A 4QRIA 1MNQA 4G5XA 4MVXA 3HH8A 2XB2A 1QH0A 1SVWA 2IYYA 1QV7A 3ROEA 5KYWB 3AQ4A 1U1CA 1Y7IA 3AV3A 3ZHZA 1NMZA 2ZUDA 3S1LA 4U2DA 2PYIA 4RLHA 1GPNA 1A76A 1JNYA 4DEYA 1HLDA 2WM8A 3F46A 3SVLA 2XYPA 3KAKA 3O7MA 5FQOA 3BD7A 5LJIA 4M0PA 1OLXA 5EKSA 4DSTA 3HACA 5A7HA 2IKQA 4WK6A 2FVYA 3UW3A 1IJBA 3DYVA 1KMCA 4C07A 1K5HA 3C3EA 4LHZA 5DBIA 4ECEA 4TQ9A 1JRLA 3OTOB 3I3SR