2ZVPX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and p-nitrophenol
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
b'LDVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
molecule tags Transferase
source organism Mus musculus
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
total genus 110
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvpX00
4II7A 4XD7D 3SN6A 4LX0A 4ZCIA 4D6PA 1BIFA 4O2LA 2PLFA 5JCPA 3FKQA 4C0HA 3I32A 3EXAA 4C0BA 1IJEA 5KNCA 1XZPA 4DC9A 3GEHA 1N5IA 4EPVA 1SKYE 1QVAA 4QKQA 4QOSA 2FGKA 3WMFA 2QN6A 4RKEA 4PPGA 3K0EA 4M21A 2H18A 4E03A 1DO0A 1KJYA 3RABA 2ERXA 1MO6A 2XTNA 1JXMA 4HB3A 2ZAOA 4AWXA 1S0UA 1ZD9A 4JVMA 3GP8A 2RHMA 4PHGA 3LDAA 3NXSA 3SYKA 1NRJB 2CLCX 3L2OB 1G5PA 4KFTA 3KL4A 1HQYE 4D4MA 4TL9A 5BXQC 2VP9A 3GLHB 4XVRA 4OI0A 2C8VA 1FP7A 1JALA 5J5CA 3L43A 2W2TA 4W5HA 3TNFA 3K0CC 4PZYA 4G3XA 1J99A 1NKSA 3C41J 4XVQA 4W9MC 4IVRA 2ZRBA 4DCNA 5JEEA 4D4JA 2VHUA 3FTQA 1G18A 3CUEF 4P4SB 3ZVNA 2ZI7A 2N42A 2ZJBA 4TYNA 2G9NA 5J47A 4PQRA 1X86B 3VR6A 4M1KA 4AG6A 4TYPA 1H8EA 4MYCA 3U61B 1RYHA 1NJFA 3W9YA 1N3BA 1Z0FA 1I2DA 3OIYA 4HLUC 1YRAA 4LYHA 1WE2A 1Q0UA 4QBGB 2YHSA 4RCYA 4G5GA 1Z6XA 1U0JA 3UIEA 3AVQA 4B74A 4D81A 1HA3A 3KXKA 2B21A 5A0FA 3U5ZB 2QNRA 3BBPA 4GI7A 4QHTA 2X77A 5E7JA 3FHOA 1JR6A 2X2EA 2FDCA 4BFYA 5EP3A 5FBVB 1DARA 5FUVA 3I5YA 5AUOB 2GK7A 3KDSE 3QY0A 2BBOA 2PCLA 4NZYA 3VHXA 4DB4A 2AWNA 1Z29A 1MO4A 2A30A 2XB2A 1YR7A 1KY3A 2O0HA 4JLDA 2D2EA 3DOFA 3KKPA 5IHPA 1OKKA 1OXSC 2D7DA 1G8HA 1XCMA 4D26A 1JB1A 2C03A 4GSYA 5FPTA 1W5TA 1UADA 5L3SA 4C7OA 4FCVA 4B3DA 3AEZA 3WYGA 2ZSBA 1II8A 3OE7A 1OYYA 3FHTA 1UM8A 3FE2A 1T0HB 3S1AA 5CK4A 4RFSB 1NVVR 1DPFA 3WMGA 4A9AA 1E2IA 1CXZA 4RD0A 3BD9A 2BVNA 4L9SA 5CITA 4UKDA 3R8CA 3AVTA 2QI9C 1XEFA 3GD7A 3M4YA 4PO9A 3HJNA 4FMBB 2XGJA 1NLYA 4JLMA 1Y63A 2ZVPX 4NYIR 1BMFD 4C3ZA 2ZM5A 2KBFA 3LQQA 1JPJA 3CPJB 4FMDB 3QIAA 4A0HA 3EZ7A 2Y8EA 4MKFA 2ZS9A 4OQFA 1GL9B 3IILA 4LK2A 1ZBDA 4ZKDA 3VFDA 2CHVA 1E9SA 1QDEA 1ZUIA 1FPMA 3BFXA 2YOGA 3CF6R 5H8WA 3BERA 4LJ7A 1ANKA 1NSFA 5B30A 4FWTA 4ZDKA 1ZM7A 1M7HA 2J59A 4L9WA 2RB4A 2WWFA 2AFHE 3A37A 3UMRA 1W7AA 1OH7A 5J4HA 2GDJA 3GLIA 5AUNB 3W8RA 2IS6A 2QPAA 1A4RA 3L82B 1ZNZA 4HLQB 5AJXA 3KXLA 4F4CA 1US8B 3AH8A 4TN1A 2J0QA 1W4AA 3QPVA 4TMVA 4QBIA 4B2IA 4V0OA 4Q4AA 4JJZA 4D25A 2WWIA 3MSXA 5EP4A 4D80A 2VPPA 1E96A 1Q1QA 4Q1FA 2F3RA 2GJ8A 2D7CA 1Y3AA 2W0SA 1O3YA 3I72A 5KO2A 3H86A 1Z0JA 2FE4A 1GUAA 4Q7MB 5AJVB 3Q85A 2C98A 2GXSA 1PLJA 2O8CA 1WMSA 2WWWA 1D6JA 4EUNA 3SI7A 2EFCB 4RKFA 2QORA 4U02A 1ZINA 4OI2A 2BM0A 5JHGB 5DI3B 3QPWA 5LD2B 2OT3B 4URUR 4I1SA 2W58A 2D4HA 2HV8A 3K70B 5EE9A 1ZIOA 3GCGA 1EXMA 3THWA 4WAUA 4QNRA 2WSMA 2XB4A 2GXUA 4KBGA 1T8UA 2D06A 4MKGA 3TAUA 2YC2C 4OL0A 4P4TA 5P21A 4KO8A 1G1MA 2O8BA 4P33A 4CEIA 1NP6A 1JI0A 2NG1A 2PX3A 5HCIA 4IVQA 4PZLA 3I92A 4HZUA 1LB1B 2BIFA 1ZP6A 1QRAA 1XEXB 3QKRB 4F4IA 2LWIA 2MMCA 1WCV1 1VCNA 4GP6A 4QM6A 3MMPA 4TQUS 1G7TA 4CEHB 3CO5A 2FZ4A 1ZUNB 1VCIA 3BH0A 2GA8A 4RFVA 4OI4A 3SDZA 3SJAA 1E2FA 2QG6A 2F9MA 4QRHA 3AP3A 3IBGA 2AKYA 4HDCA 4MUAA 2IYQA 4JSYA 4W5JA 5EE0A 1SXJD 4HUQB 4BE7B 1WA5A 2CJWB 1KI6A 2ZSAA 1AZSC 1COWD 4BFUA 4MUBA 4X8OA 3PUYA 4AC9A 2C96A 4F92B 1E9AA 3ZVLA 1T6NA 1G19A 1G3IA 3SJBA 4DLSA 1IJFA 3PITA 2EVWX 2GVZC 3T35A 1KDTA 2FJUA 2RCNA 4DB2A 2BEKA 3R9IA 2ZI3A 2VBCA 4UNNA 4UNPA 1T5LA 5DNYB 5KPDA 1OXVA 1U9IC 4QL3A 2BHRA 3KJIA 4PHTA 1RRFA 5FTJA 3BB3A 3FFBA 2ZYUX 1DBSA 3LX8A 5C2JB 4PC2A 4Q03A 4ZDIA 2C9OA 4P31A 2YJTD 1L2TA 1W0JA 3TRFA 5EZ5A 2AFIE 1W5SA 5FR1A 4LUCA 1KDPA 3T1VA 3SR0A 4A0FA 4DLYA 5B64A 3MD0A 1ZNYA 4D82A 3K8YA 3ASYA 3AKYA 2PT7A 2QP4A 2QAGB 3T61A 5KU1A 2QBYB 3QKSB 3EZ6A 4LJYA 1IXSB 2DFLA 2GNOA 5HR5A 2FWRA 1S1MA 2A5DA 4KODA 1Q1BA 3N5CA 1NLFA 2B8TA 2RHDA 3RS7A 3HR8A 5DHAA 3DMDA 2H92A 1CR2A 2YNMA 4GMDA 2ZIAA 4TLCA 1P2SA 1KI3A 4KSBA 3X1XA 1E2QA 2AD5A 2Q9AA 421PA 1XDBA 2DB3A 1NKTA 1HH4A 1AN0A 2GXAA 1BKDR 2RMKA 4DJTA 4W5WA 2ONJA 1ZCBA 3QNUA 4P4UA 3WYAA 3DKVA 3HR7A 1FTNA 3CWQA 1CBUA 3OAAD 1N6OA 2W6ID 4ZCMA 3AKCA 2IL1A 2XJ9A 1KSFX 1JJVA 4PC1A 4CF7A 2OFOA 1SKQA 4KXFB 3W8NA 2XXAB 2BOVA 5F98A 4RD4A 3AM1A 1E2EA 3N70A 4F38A 2PH1A 3ZH9B 3DZDA 3B9QA 3U7GA 1OYWA 2JJ2A 3RANA 4GRAA 1GVNB 3TLXA 1VECA 2P3SA 2P5TB 5JJLA 3VNUA 2F3TA 3IQXA 4CT4B 2HUPA 4TSFD 5TARA 1GNPA 4DLWA 5KDDA 3R8FA 1LS6A 1COWA 1ZD1A 4E5UA 3T1TA 1AA9A 3WHLA 4HB2A 3NDPA 2WJYA 2YWFA 4FINA 4LJ9A 5FTLA 4E07A 2ZJ8A 1A2BA 2ZE6A 3ZGXA 3AKDA 1P9WA 2J41A 4Q21A 5AJYA 1ZU4A 1XCGB 1VYTA 1WF3A 1UKYA 3CB4A 4FD2A 4KAXA 2FPMA 2OM2A 5L8VA 2OEPA 1OH8A 1SQ5A 4UJ5A 3ZS8A 1AQUA 4A82A 1QHXA 2O52A 2RGXA 3CR8A 2C77A 2C95A 4LHZA 2HF9A 4US1R 2GF9A 1NJGA 2ZSFA 2QPTA 4BLSA 5H1YA 3MFYA 1CJTC 2IYWA 1Q3HA 2XSZA 3DOEA 4BFVA 1Z5ZA 4Q48A 4LZZA 2E87A 1GIAA 1NMZA 2D3WA 2BEJA 2CE7A 1ZM9A 2ECKA 4L4UA 4ZIRA 1NG9A 3ZD7A 4Q7KA 1NSTA 2I1QA 1DAEA 1AM4D 1PLKA 1G4UR 1UEJA 2Q3MA 1E2GA 3FB4A 1GNQA 1ZNXA 5FTNA 3VU9A 3QVVA 1CEEA 5BN3A 3VMFA 4AG5A 3PEUA 4PX9A 1NF3A 3B1YA 4BLRA 4LRWA 4PO8A 5JFGA 3OFNA 2J3EA 1NBMA 4A2QA 4EPXA 1AS3A 1YJ5A 2IUUA 4K81B 4XJXA 5CB6A 2V3CC 1I4TD 4R7ZA 2ODNA 1FP6A 2ZROA 1TUEA 3GJ5A 1K8RA 4QC2A 3V9PA 3RS5A 2NZJA 3HPQA 2QE7D 2CMKA 4JLOA 2VH5R 4NBSA 1KAOA 1DAGA 5JS7A 3RS0A 4PXAA 5FOUA 1I4DD 3QXXA 1E69A 1V5WA 1E2LA 1IXRC 3PUXA 4EIWA 1E4VA 2DWOA 4TMKA 1SXJA 1VG8A 1KI8A 3TUZC 1KZ7B 2WMOB 1CKEA 2PL3A 4KJZA 3TSWA 1VTKA 4NYJR 1WQ1R 1QHGA 4A36A 1KGDA 1XU4A 1KI1A 1P7CA 4Z54A 5KHOC 2IWHA 2MSEB 1FZQA 4ZPXA 3RAPR 1M74A 3OIWA 3MLEA 4F93B 2QT0A 1Z6YA 4MQBA 4EAQA 5EZ6B 4LJ4A 3GLFA 1SVLA 821PA 4Z8XA 2JJ1A 2EYQA 3LRPA 4URZR 4B2LA 1XP8A 1SZPA 4BZPA 4P3YA 1FX0B 3R7WA 1JQLB 1TMKA 1CIPA 4AYTA 2JLXA 2ZU0C 3FFAA 4KBFA 1BO6A 2XSZD 1DAIA 1T5IA 3HU1A 1G7SA 4R9UC 2I3BA 3TUIC 2O5VA 2FOLA 2OLKA 3BRWD 3RNLA 4AYXA 4Q00A 4MDFA 3CX8A 4RZ3A 2AL7A 1ZM3A 1E9CA 2NPIA 3B7GA 4DDWA 3R20A 4TTPA 3ZQJA 3FKSD 1N25A 1G3QA 2UKDA 4LBZA 4V02A 5IRCD 4CEIB 1CRPA 3TW8B 2IX3A 3GFTA 1GNRA 3FYHA 1S9HA 3LX5A 1QZXA 1U0LA 4M9ZA 2WWXA 3QEJA 4M9SA 1FUUA 4B48A 2CNWA 1ZD8A 2FFAA 1RFLA 2H1LA 3GJ7A 3AVVA 1Z47A 3T5DA 3WY9A 2MSCB 5CK5A 3GLGE 5BN4A 4C0LA 3K0AB 3GJ4A 2JLYA 4RZ2A 1YR6A 3K0AA 1RJ9B 2BKEA 1SHKA 2ZE8A 4D2IA 1Z3IX 2ZRLA 3H0KA 3LWNA 4UQOA 1XMSA 3ZLJA 1S96A 3P27A 2FX3A 1GOTA 4PC3A 3ETLA 3BB4A 4HAWA 3QSYA 2YVUA 2VSFA 3LVQE 3HWSA 2NIPA 5FBQB 4KV9A 1OXTA 2AK3A 3CONA 2G88A 2RKOA 4LBVA 4NP6A 3NDBB 5JMTA 4KLNA 2HT1A 4HUTA 4CZ2A 5SZIA 5TB5A 1W47A 5FFMA 1F2TA 3IIMA 3R9XA 2R9VA 1Q21A 4DKXA 1BMFA 1SVWA 3H2YA 1AS0A 2Z5FA 5C1BA 3AF3A 5FTMA 3VR3A 1Q20A 2JEOA 4IW3B 4S2EA 3DKPA 4C0KA 1N6KA 1ZVQA 4ZI3A 1BS1A 1NLZA 1PV4A 4G0NA 1SXJE 1D2EA 1MO5A 2JLQA 121PA 2V6IA 4H1UA 4D0GA 5KNBA 1KKMA 2Q9CA 1OFHA 1GP2A 2ZRGA 3FMIA 3HDTA 2IF2A 3VR1A 2RAPA 4DCVA 1YE8A 4PZZA 3SC3A 1VHLA 3K0SA 2OG2A 1C1YA 1W36D 2ZITA 2QROA 2G1KA 1KSJA 1KJWA 3SQXA 2LCFA 4US2R 1L8QA 4DRZA 4UXHA 1HT1E 4AKIA 5DIFA 1UAAA 5C46F 1X3SA 4PQYA 1YZLA 1R0YA 3U3OA 1E2PA 3K0FA 3LW7A 2IWRA 3IHLA 1VDZA 4D0LB 5C18A 4QJ4A 2IHYA 3ND8A 4M0LA 4LYAA 4EJSC 4XH9B 4IRUB 1LV7A 4TYYA 1F2TB 3V4FA 5J4LA 2QBYA 3TBKA 3ADKA 3PEVA 5JSZA 2WICA 5JZVA 2GJSA 1G8GA 1NG1A 1P62B 3EA5A 1CLUA 4ZCLA 3VKHA 5E7IA 1T3SA 2GZDA 2ZANA 2JJ8A 2ZRJA 2A5YB 3FWYA 4DZZA 2ZS7A 1VYUA 2A78A 4BRUA 2D74A 4ILEA 4C0SA 3AVXA 2GJKA 3C4JA 2OO7A 1XMVA 2HJGA 4QGFA 4JL6A 4CVNA 4TT3D 2CNWD 2ZE5A 2ZRFA 3OZXA 2FFHA 2P6NA 2XTMA 1F3OA 4FMDF 5B58C 3IDQA 3BS4A 5FBWB 2YKGA 1CTQA 3LXRA 2XNSA 1LF5A 3KFVA 4JLVA 3CNNA 3I1FA 1F48A 1RRGA 2J0UB 4OQMA 2HEIA 2HYIC 4B3XA 3SBDA 1MH1A 4LV5B 1S3SA 2WZQA 3BC1A 4HUQA 1OLOA 1W48A 2ZETA 1ELOA 1G16A 1XJ0A 1P2TA 3GLHA 3MAAC 1QHIA 3THXB 2FH5B 2QM7A 2KB0A 4LPSA 4LYJA 2W6JA 2ZI4A 4Q1EA 5E3HA 3K1JA 3R7WB 3RC8A 2OAP1 3M0EA 2ASEA 3EIHA 3WRYC 5FPYA 3SQWA 1KNXA 2BBTA 1W1WA 2NZ8A 2CCGA 4P32A 1NVVQ 1BYIA 5JCZA 1L4YA 1XWIA 1E1RD 3ADBA 2PJRA 3C7KA 1N2CE 3NIBA 3VX4A 1B23P 4MKIA 3I5XA 1AKYA 5F3WB 2IYZA 3PXGA 1NI3A 3H4MA 2IC5A 1R6BX 2LKCA 1DTSA 4JBYA 3ASZA 2ZAMA 4NL4H 3NEYA 3MGCA 3DZ8A 4V0MA 4JBXA 5D3QA 1RZ3A 1AKEA 4OK3A 4V0KA 1P75A 2N46A 3IKJA 1G7CA 2FV8A 4Q9KA 1W46A 2J7PD 4BFXA 3W5JA 5E4FA 2JLVA 4FCWA 2F1RA 1EK0A 4XTRA 1EX6A 1OT3A 1P3JA 2PZEA 4Q47A 3UATA 4U00A 4ZDWA 1AGPA 1XTKA 3K0CA 4NYJQ 3ZVMA 1E3MA 1NN1A 3K09A 2DCUA 2PMDA 1D8TA 1OFTA 2D62A 4POAA 1Z0DA 2GZHA 3B8HA 5AK0A 1TQ6A 5DYGA 4GDFA 3N2EA 4NU0A 1MABA 1OXUA 2W83A 3KJGA 2IXEA 2Z6VA 4MA4A 4ZIRB 4K46A 1ZW6A 3LBNA 3KUCA 1GRRA 4JT2A 4MYHA 5LB4A 1UDXA 2WAXA 1DAHA 1JQJC 2F1HA 2GHIA 2PEYA 3EZFA 1RW4A 5HKKD 3CNLA 5JWOA 3CWZA 1GM5A 4IVPA 2R6FA 3OE7D 4KFRA 1GKYA 4JLBA 4R2HA 3D6TB 3X1ZA 1EWRA 4QJ5A 3EPLA 2FEMA 2R6CA 5FUYA 1KKLA 3Q5DA 3ICEA 3E2IA 1GKUB 1D9ZA 1PLLA 5JLJA 2WVJA 5FH9A 4M1WA 1UPTA 3QI2A 2EQBA 2NO6A 4RVCA 4M22A 4RD2A 1U98A 4TLBA 2LKDA 1AGRA 5J40A 3DO6A 4FWIB 5E95A 4A92A 1F2UA 1M34E 4GFDA 4X8HA 4B44A 2BCGY 3ZZTA 3ZD6A 3D7MA 1E1QA 3DL0A 4M1YA 1JPNA 3GLGB 2IXGA 3EC1A 3FHCB 4DLUA 2Z0MA 3I61A 1KMQA 4C2UA 5K8LA 2FNAA 2V4ZA 4EJSB 2OBLA 1TU3A 1XCPA 2OESA 3BK7A 3OAAA 5EXXA 4YMUA 2V1UA 4AIIA 1KDRA 3KQLA 2XZLA 1FW6A 2CK3D 3RS4A 4H9GA 4B35A 4IDPA 4NYMQ 5EXSA 2WM9B 2CCJA 2GVDC 5CM9C 3HYTA 4V0ME 2A5FA 3L8ZA 3OF5A 2GJAA 3Q9LA 1Q44A 3W3AA 1KOFA 2GXQA 2OE2A 4JKYA 4S35A 3WP0A 4GBMA 3AF4A 3T1OA 3VX3A 4MKHA 1FTSA 3I3SR 4N0DA 4DLTA 1S8FA 1A2KC 2IUSA 2ZJAA 1IXZA 3AGQA 1DEKA 1YKSA 5FL3A 4WW0A 1NY6A 5EUMA 1VIYA 3F0TA 3NBYC 4FCTA 4DCTA 5IK2A 2C5LA 2VQSA 4OK5A 3RSOA 1HY3A 3QG1A 2AWOA 4D4LA 1XMIA 2FMXA 1Q12A 2PBRA 4JYCA 3LH5A 1NIPA 2XITA 4URXR 3LXXA 4L8GA 3WMEA 4LBYA 3B6EA 5FOXA 3IO3A 1W0JD 2WJGA 3D31A 2QM8A 5EXPA 2OCYC 1N6LA 2FF7A 4JSTA 3B78A 4PPFA 5G53C 3KX2A 3AKEA 4LJ5A 5JWRA 4ZDJA 4YMWA 2BMJA 3PEYA 2MSDB 3MG9A 1QHNA 1FX0A 2IK8A 1R0XA 3MRSA 4NHOA 5BWMA 4DSUA 4A2PA 1WBBA 3O47A 3SZRA 1G21E 1R5NA 4I81A 1Z28A 3FMFA 3QENA 2WJVA 2CCKA 4XOIA 1CU1A 3AB3A 3LQRA 5B2ZA 3U6BA 2V8OA 1D9XA 4PSKA 2GZAA 1LS1A 2BMFA 2G0NA 2ZVQX 1Z2CA 4CEJA 2VP5A 3ZVRA 1VPLA 5UKDA 2ORVA 1RRPA 1JECA 2QENA 1X6VA 1KO8A 1YR9A 4MDEA 3IPYA 2R6DA 1XBTA 4CT5A 4O2RA 1I4LD 1UKEA 2HT6A 1J70A 3RHFA 3UG6A 1P61B 3T12A 2XX3A 3BB1A 1UBEA 4J0QA 1VCOA 3LY5A 3KTAB 4IHQA 2RGNA 2RGEA 2CE2X 4HAXA 4R2IA 3GPLA 1W0KA 1IONA 621PA 4TQ9A 1WP9A 2EFEB 3GFOA 4JBWA 5J4KA 1IN8A 2ORIA 3ICQB 1GTVA 1UBGA 3FGNA 2XTZA 4N3NA 2UVQA 2VP4A 5BYKA 1TX4B 4QBHA 1GL6A 2JAQA 1G3RA 3EIQA 2Z43A 3JVVA 4LYFA 1TEXA 1KJZA 4QBFA 4Q4AB 2IS2A 1QF9A 3SU8A 2FZLA 2IYUA 1XEWY 1E2HA 4HEJA 4HLDA 4BWYA 4NYMR 3U4QB 2ZI6A 2R62A 4JT4A 1Z0KA 4OHXA 1KIMA 2A5GA 2AXNA 3RWMB 1WBDA 2YOFA 2J46A 4EFLA 4PQFA 2XZOA 1KK0A 4GMXA 5JJKA 3CRVA 2JA1A 1Q1ZA 5FI1B 5FTKA 1Z63A 4BLQA 2BJVA 4M1MA 3THWB 1ZRHA 5LD2C 1DG3A 1N6HA 4JYBA 1EG7A 5D3MB 2CVFA 1G8YA 4BLTA 5DI3A 1UDWA 3CKLA 3LW8A 2QY9A 4OHWA 3B82A 4HB4A 3W6OA 2REXB 3GQBA 3O8BA 2OUKA 8OHMA 4DUGA 1PJRA 5DN6A 1OJLA 2W00A 1TQDA 4EDHA 1K5DA 4RD3A 1CP2A 2WKPA 4BZQA 2RGDA 1XJQA 2QGNA 2F7SA 4NCHA 3AF2A 3C16C 4Z51A 4WA7A 4WZ6A 3PR1A 3GJXC 4DLVA 1RE0A 1TF5A 2FGJA 1BOFA 2JDIA 4GP7A 3VTKA 1II8B 1XNJA 3J81k 1OSNA 3W6NA 2IXFA 2WPDA 4B34A 5KTYA 1JEDA 3TVTA 4A4DA 1GITA 2PEZA 2DR3A 2ZR0A 4MRVA 4JIMA 5CLQA 3VR2A 6Q21A 3C15C 1E94E 2IS1A 2Q9BA 3IQWA 1IN4A 4C0JA 3A1SA 1EX7A 4PSAA 2GBLC 1XXHB 2GBLA 1GILA 2KJQA 1TADA 4JVNA 4M1OA 5EP1A 5G41A 1S3GA 2V7QA 5EUQB 4CEHA 2BM1A 4UNRA 2ATXA 1OFUX 1R0ZA 3LLMA 4M9XA 1NMYA 3K9HA 5DISB 1W4RA 1GG2A 2HJVA 1KY2A 2ODWA 3RC3A 1Z8FA 4LHXA 2QMHA 4IOMA 4L15A 4UXJA 4EFNA 4LCBA 1G6HA 2OXCA 2EWVA 2IBMA 3WNDA 3CIOA 1E0JA 1W36C 2KSQA 1VYVA 1GRNA 2JJ1D 2JLRA 3S1AB 2AX4A 1T0JB 3SS8A 4B6EA 5IT5A 1C9KA 1XB2A 4KLZA 1YR8A 4HATA 4LHVA 2RGAA 3BE4A 3ZIAD 4HLUA 4MGIR 2WSSD 2ZUBA 1U81A 4YQFA 2JGNA 1T8TA 2GCNA 1JAIA 1E99A 1G20E 3A58B 2F1JA 2ODBA 4EQ6A 4MGYR 1Z07A 3T15A 3I62A 3W5IA 4DDTA 2GJ9A 1KI4A 5DHFA 3OEHD 1FMLA 4QFMA 4YDSA 2BDTA 5HZHA 2NO7A 2CBZA 3KJHA 5GJBA 1CR0A 1GWNA 1VIAA 2WV9A 3A36A 2OXRA 1HT2E 1P60A 3MJRA 3K9NA 2ZI9A 3OFND 1IN5A 1S2MA 2PCJA 1F2UB 2IYRA 4DWJA 2J0SA 2V7QD 4IDHA 3BWDD 3W34A 5JWHA 2ZU6A 2VP2A 2VP6A 3U3MA 5SZHB 1PUIA 2RGNC 1ZCAA 3EWSA 3TQCA 1XPUA 4GL2A 1EWQA 1OHHA 2JASA 5HPYB 5CB8A 1UEIA 2RGGA 4LHWA 1N0VC 1X8LA 2C04A 1EFUA 4G5RA 3SYLA 3X1WA 1SVOA 1MV5A 1SXJB 3CRQA 2ZI5A 3CR7A 3GFPA 1R5OA 1A82A 3GEEA 4A0GA 4LHYA 3KJEA 1T3LA 3CBQA 4UNQA 3THYB 5JBQA 4N0EA 4B3GA 2P67A 5AJZA 1H65A 1KSHA 3RRMA 3V00A 4EPTA 2DPXA 1WB9A 4NCIA 2I4IA 2V6JA 4Q1CA 2NMVA 1ZC4A 2RH5A 3SHFA 1G291 2D2FA 4B6FA 1EFHA 3CH5A 2F9LA 4BQSA 4JLAA 2DWQA 4BFZA 3U4QA 4KVAA 1OPXA 1U8AA 4B3BA 1OH5A 1IOZA 2DWPA 2HLDD 2RGCA 4A6PA 2VSXA 4MRRA 1M1YE 1F6BA 2ZJYA 2C9CA 3NVAA 3P26A 2P5SA 2WWYA 3NBXX 4F91B 1QHHB 2IYYA 2DBYA 2EFDB 3FKSA 2VTKA 4Q4JB 3A1UA 3RVBA 2EU8A 4TL7A 4GOJA 5A5GA 1XTIA 4HSEA 4D0NA 1M7BA 2VHTA 2ZTSA 4B33A 4DEXA 2QPOA 1KTVA 1IY1A 1R0WA 3A1WA 2IEZA 2VYFA 3REGA 3NTUA 1OB2A 1CR1A 2DFTA 2NTYC 2R65A 2QA5A 4OKSA 1RPZA 3AV0B 5K8UA 3IEVA 1O87A 4DIEA 5DH9A 4G5OA 4IOLA 5FBLB 1T3HA 5F9HA 3P1JA 3LD9A 3MJHA 1UJ2A 1XTQA 4URYR 2NOAA 5SZKB 1OFIA 3QOFA 2W6IA 2ZSEA 3A4MA 4Y0AA 3EWAA 1OIWA 2WOOA 4A8JB 1EFTA 2GETA 1DAFA 1LVGA 4P4SA 2AKAB 3B85A 4Q4HA 1YZGA 3AVPA 3LBIA 3BOSA 3MWLA 4GNKA 4TTRA 2ZYTX 3A4LA 2ZYWX 1TUIA 5IDVA 3B9PA 1PZNA 2YWEA 1X1RA 1R8SA 2CDNA 4MYUA 3KB2A 2H17A 4TMTA 4GOKA 1Q22A 4MYTA 5LBIA 3EASA 2GCOB 3THXA 3QUSA 3P32A 4WXPA 5L3RA 3LAWA 3IIJA 4OQXA 1FUKA 2H5EA 1XEXA 2XXAA 4YLGA 1JXOA 4XWKA 5GJWC 3OESA 5LB2A 1NBMD 4LC1A 2ZRHA 4DIDA 2QUZA 4QGHA 1SXJC 2WIAA 4W7SA 3X1DA 2WKRA 3TSZA 1XD2B 4AY2A 1N6RA 5K8IA 2GF0A 1TPZA 4QGGA 4C4PA 1ZIPA 4V0LA 4ESVA 2ZJZA 3AP2A 2IYLD 4URVR 5GJCA 4PPNA 1GFIA 2QAGC 3QF4A 1KO5A 2Q21A 4CIDA 4DLZA 4WVFA 5L3SB 5E7MA 4IEIA 1M7GA 5KDOA 2YV5A 2O8FB 1UBCA 5HTKA 3P4YA 4A1FA 2VIIA 4OHVA 3T34A 4NCKA 3TQFA 2FEOA 2J7KA 2XEXA 2QZ4A 4YXWA 2Z83A 1H8HD 1V43A 5DI9A 3RRZA 2FFQA 1E79A 1P4SA 1U0HC 3BJIC 3TE6A 1UBFA 5CM8B 3L0IB 3QPUA 4TLDA 4U5XA 4UNSA 2GESA 3P20A 3K09C 1NMXA 1DS6A 1W2GA 2VLIA 2WAYA 4TMZA 4PANA 4D4KA 5HKKA 2K5UA 1FNNA 3GLGA 1N0UA 1LNZA 1U90A 2O8DA 2ERYA 4NKRA 4OYHA 1FNMA 1IQPA 3UWOA 1KYIA 1CF4A 4WZBE 3TUJC 2HDNB 4AURA 3TVDA 1ONBA 4DXAA 2CLSA 4M53A 2IYXA 1X8JA 3T5GA 1W36B 3WXMA 5ELXA 4OI1A 3CH4B 1W49A 2QGZA 2DHRA 2VA8A 2REBA 5KNDA 3K53A 2J1LA 2UZIR 4FIDA 1S4QA 2IUTA 2BBWA 2X19A 1XX6A 2PZGA 4XWAA 4B71A 1FOEB 2XZPA 1DADA 1NN5A 1CULC 2CL6X 4B47A 5FPKA 4XIGS 4ESHA 3SEAA 4OJQA 4JS0A 4NYIQ 1N6IA 1OIVA 3AQ4A 5CIWA 1TNDA 1ZJ6A 2QSZA 2GRJA 2V9PA 5DGXA 2VHCA 4C7OB 1TEVA 2JLWA 4JLKA 4DSTA 4YDHB 2JLUA 4Q1DA 2B7BA 3ADDA 2R6AA 5EQTA 5BN5A 4DLXA 1Z2AA 5KSZA 4HYYA 2AR7A 3EARA 3QKRA 2WKQA 5FOVA 1W4BA 4PC6A 3WRXC 4M2LA 1OHHD 4B75A 1E9BA 3K70C 1YZQA 4C30A 2J9RA 3OIUA 2GCPA 4HAZA 1Q3TA 1Z08A 4PAMA 2ZRNA 1E0KA 3DEFA 4AKEA 2VHJA 4RY2A 4BRWA 4Z1MA 4PO1A 1KO1A 2WJIA 3DMNA 3H84A 5FPSA 4MRNA 1GKIA 2QT1A 2VP0A 4HB0A 3X1YA 2X8AA 4ABYA 2WTUA 4YMTA 3KTAA 1W4CA 3DHWC 3HYRA 4DDVA 4ASUA 3K70D 1E2JA 2V55B 4LWZA 4TYQA 4XVUA 3U7FB 1M6NA 2OCBA 4PHHA 3SFVA 2ZRCA 3EZ9A 1XJCA 2WMNB 2J7PA 5IF9A 3E70C 1IAQA 4MGZR 3QF4B 1I2MA 5SZJA 3AGPA 1IBRA 4KCGA 2ZREA 3ZDQA 3TGPA 2OCPA 4FMCB 3DPUA 1TU4A 4DEYA 4KSCA 2WJJA 4NMMA 4Q9IA 1KK2A 3B13B 2FU5C 3FDIA 1J8MF 1KK1A 2G3YA 4QHYA 1EFRD 3GJ8A 4DDUA 1VMAA 2P6RA 1XD2A 1MOZA 4GZLA 2DY1A 3PENA 4M8NE 1U2RA 2BCJQ 1EGAA 3CX6A 5B57C 3KUDA 4NPHA 3VNVA 3TR0A 2NPFA 2I1VB 1TTTA 3GMTA 1VG0B 3C5CA 3PQCA 3VR4A 4KYUA 5IK2D 3FOZA 2EW1A 4RSGA 1D2NA 4PPQA 2VF8A 1TL7C 4IEEA 1Z22A 4ARZB 3PFIA 2A9KA 1HE1C 2PMKA 221PA 1AQYA 3UANA 1KZGB 4JZKA 4G01B 4KHZA 1E9RA 2ZEJA 1EFCA 2QTFA 1U8YA 3NWJA 2X1VA 5CYOA 2O8BB 3QXCA 1KI2A 2XNDA 1IN7A 2J5XA 4JLJA 2PZFA 2VEDA 3I8SA 3NEJA 2SHKA 1HV8A 4MH0R 3RS2A 3ZQ6A 1E2NA 2OBMA 4KVGA 3GLIE 4PAOA 4RFSA 1R5BA 3U44B 4ASUD 3ECCA 3N2IA 5CIQA 1JR3D 1UKZA 1G8FA 1FFHA 1YVDA 4TLAA 3ZZ0A 4XSGA 1X8KA 2KBEA 1E4YA 4GOXA 2O8CB 2JDID 3GJ6A 2GAAA 1G64A 1G41A 2DFKB 4ITRC 4E09A 2FPLA 3QKSA 5FI0B 3SE0A 4CGZA 3H1TA 4NH0A 2H8KA 1QG4A 1T4GA 1QHYA 2BWJA 5CDFA 3ADCA 4C0QC 2AD1A 5JEDA 5JI2E 4AK9A 3A6PC 3ND9A 2E1RA 2NO1A 3PUWA 4M1SA 1N0WA 5BYJA 3RRYA 1CJVC 5JSZB 1GSIA 4A8JC 1ZUHA 2HCJB 1A7JA 4AKGA 1Z06A 1DG1G 2XJ4A 3B1ZA 3VKWA 4IDQA 3KKOA 4V0NA 3ZYCA 4IDNA 4Q7LA 4Q66C 1GRQA 1KMHB 3NBFA 5HCNA 1TF7A 2H57A 2IYVA 3GJ3A 4IXMA 4YMSA 1E1RA 1HQCA 3KZ1E 4Q18A 3CPEA 1G7RA 1R10A 1DE0A 4IJMA 3AUXA 4AI6A 3QKUA 2QSYA 5DN6D 2XOKA 3NG1A 1G3MA 4IKEA 3KKNA 1UFQA 4QJ3A 2BBSA 2QTVB 2HXSA 4Q01A 2GTPA 5J4VA 2OFWA 1SGWA 4US0R 2XOKD 5KSYA 2J87A 3CW2A 4GPTA 2ZR7A 2AK2A 2C78A 1SVMA 2VF7A 4UJ3A 3X2SA 1KI6B 1S1CA 1XMJA 3MWYW 4BECA 4ACBA 2Q3FA 2BMEA 1F5NA 5DSZA 4DCUA 2OHFA 4NTZA 2CHQA 3QQ5A 3RLFA 1CRQA 2F43A 2H7VA 2VRWA 5KUTA 1DAKA 1W0KD 3GEIA 1W2HA 5G3ZA 1P9RA 4PC7A 1NVXQ 2JLZA 2IT1A 4JL8A 4JVSB 3TK1A 1K6MA 1ZC3A 3BXZA 3U7HB 3F8TA 3GLIB 1FL9A 1RRCA 3B60A 4BEJA 5KSOA 2ZYVX 3L8YA 4RZUA 1J2JA 4WBSA 1KMHA 3FMOB 4MGKR 1E2MA 2O8DB 2VL7A 3LFUA 2KE5A 4QGAA 2ZR9A 4M9QA 1XD8A 3QF7A 4EPYA 4G1UC 721PA 1XEWX 1RYFA 2A5JA 1L4UA 1JNYA 1OKKD 3Q7PA 3HU2A 4QM7A 3E5HA 5TV2A 4BEBA 1GDDA 2GEVA 2IYTA 2QMEA 4FW9A 3WNBA 3GJ0A 1SHZA 5F9FA 3NBZC 3UWKA 1T9HA 1NVUQ 2GWHA 4A6XA 1XXHE 3P4XA 4HI0E 3K9GA 4LJ8A 4YONB 4EQ6B 1RJ9A 1LF0A 5JRZA 1ESNA 4AKHA 2ZJ5A 3KKQA 5FUXA 1IY0A 1HEIA 2ANBA 4Q4LA 1E32A 3NC1C 2VSOA 4XSHA 1XFAA 2QU8A 4U7DA 3BH6A 4I1UA 4LJAA 4DVGA 3RRNA 3EW9A 3QVUA 4TZ6A 1DVRA 1ZNWA 5BQ5A 1E98A 2R44A 3UXMA 1ZAKA 2QRNA 3FMPB 3LLUA 4X8LA 5DO9A 3PIRA 3TSOA 2YOHA 5DLQC 3PEWA 5FL7A 4WOPA 5KOYA 1E0SA 2FPKA 1US8A 1H8ED 5GVSA 2B6HA 2HXYA 3TMKA 1KNQA 5CYPA 2CL0X 4B32A 3LVRE 4Q7JB 4C0AC 3QXSA 1RKBA 4R71A 2ZRIA 2FSIA 2GKSA 5EE3A 4B3CA 4CRWB 1A5TA 1VHTA 2Q6TA 2ZSDA 1XTRA 3A1TA 1D5CA 2QE7A 5EJEA 2BKUA 1PUJA 3LV8A 4TMWA 2OAQ1 3RDPA 2ZXUA 1SVIA 1MT0A 1LTQA 5JS8A 4B43A 4DT1B 4TL6A 2OILA 2REOA 4O25A 2IHBA 3NH9A 5KPJA 2GCOA 1GZSA 2WOJA 4KU4A 2FSHA 5EE5B 2CK3A 1G3UA 1IN6A 1OIXA 1MRNA 3KQKA 4AD8A 1Z0IA 3TR5A 4TYWA 1VG1A 1WDTA 3WP1B 4QG7A 2F6RA 3CM0A 4TZ0A 1Q1EA 4Q4HB 1WRBA 5KDLA 3AVOA 1E1QD 4NONA 3SFZA 4JMPA 1JJ7A 3EX7C 1MR3F 1U8ZA 1XRJA 3WHKA 1NL3A 2IS4A 5AUPB 3KQNA 4OJKA 4PR0A 4DHEA 3L0SA 4ZKEA 4HAVA 2QEQA 5CDFE 4TL8A 4JLNA 1VG9B 5KSPA 4Q1AA 3ZZUA 1QG2A 5AUQA 1J7KA 2QQ0A 4PTLA 2BJWA 1OH6A 2HLDA 2ATVA 1QVRA 4QNMA 5TVKA 2P6UA 3D3QA 1YHNA 521PA 5BW8A 3UMFA 2PJZA 3VU9B 1G9XA 1R2QA 3IPXA 3QG5A 3MUFA 2CL7X 1QHHA 1JBKA 2ZQ5A 2ONKA 1II0A 1YQTA 2XAUA 3PJRA 3EPHA 2QMOA 2QMUA 3E1SA 3F3YA 2OLJA 3SJCA 4ACAA 1E9DA 5JI3E 3K0FB 4CW7A 1G17A 5AR1A 4OHZA 4YC7A 2L0XA 3RYTC 2G0TA 3BGWA 2X2FA 2HYDA 2ZJOA 4UXIA 2QQEA 2JCSA 2E9SA 2YC4C 5L3QA 4B2PA 1W44A 2NGRA 4X8MA 3QXHA 1NBME 3Q7QA 3LNCA 3JVUA 1JEEA 4BLPA 5L3VA 4BGDA 4PHFA 3SHWA 1U94A 3KXIA 5J4YA 3VHLB 5GADl 1N6PA 1K5GA 3KKMA 1Z6TA 1YZKA 2HCBA 2WIBA 3CLVA 4JKIA 5F2EA 1A1VA 4BFWA 3U44A 1OV4A 3EAQA 4KITB 1N5KA 4A0RA 3KQHA 2BV3A 1CJMA 1KK3A 4EPWA 2B92A 3F5FA 1XPOA 2CXXA 2G6BA 5C4MA 3NHAA 1HYQA 2R6GA 2WPDD 2B7CA 2IW3A 5HE9A 4YXWD 4ARZA 4OK6A 4TSFA 3CPHA 2AN9A 3GLFE 2JIZA 4F7WA 4L5BA 4C2TA 2B8WA 4XTCS 1T91A 3L0OA 5TXGA 1LW7A 3U3KA 2JJ2D 1U9IA 1Z6GA 3FVQA 3W6PA 1NVWQ 2W0MA 2YZ2A 2WWHA 4LY6A 1E2KA 4L16A 3IGFA 3CZQA 1QHSA 4OQLA 2W6JD 5FUWA 3TH5A 4NCNA 3SOPA 4LJ6A 4M4SA 3UMSA 4JLPA 4YMVA 1TQ4A 3VQTA 1RIFA 3BFVA 3HP1A 4LV6A 3VKGA 4IXNA 1NIJA 3SJZA 2F1IA 3PUZA 3GLHE 2A3RA 3BIFA 1HE8B 1CJUC 1ZM4A 5FR2A 1OE0A 4FI3C 1ESMA 5AJWA 4A15A 3EPJA 4HLCA 4G5SA 3B1WA 3MWJA 1ZU5A 2Q3HA 5HZKA 2P2LA 2C9YA 4CYMA 2GEDA 2J0VA 1NNEA 4OHYA 4JJKA 1Z6AA 3BH7A 4RJLA 5G3YA 3TW4A 1OXXK 1MRSA 2ZUDA 4Q5IA 4K8OA 5CLLA 1HTWA 4NCJA 3RWOA 3EC2A 3A8TA 4Y0VA 4RD6A 4EPRA 1XTJA 1IHUA 1YU9A 4EFMA 1AZTA 4IOKA 4EJSA 3GLFB 1MKYA 4TMXA 2NQ2C 4I99A 2YYZA 3CF2A 2YWGA 4IFBA 3ZIAA 2TMKA 1C4OA 3OEED 1D2MA 2ZE7A 1XTSA 3BAFA 3Q72A 1XPRA 3A4NA 1JAHA 5K8TA 2XNDD 4MITA 1ETUA 1YZTA 4BUJA 4TT3A 1TF2A 1PVOA 1E9FA 2WBLC 4RZXA 2F43B 1KHTA 2R2AA 3PCRB 1Z0AA 4ZO4A 4Q1BA 4A8JA 2CJWA 3OIVA 1BYUA 2GILA 2PX0A 2QP3A 5LPNA 5TMPA 2R8RA 2DFNA 1HUQA 2Z4RA 5CJPA 2OBNA 3B1XA 1AK2A 3CZPA 2O0JA 1R4AA 3IUYA 3AUYA 5KYKA 3TAHA 4PSVA 4TTQA 1N5LA 4OBEA 4HDQB 5CJ2A 4LBWA 1BH2A 2EFHB 4TQAA 1OF1A 3WNCA 2FSGA 4LC0A 1KSGA 2EYUA 2IF0A 4LDJA 1EFRA 2ODEA 2ANCA 3LO5A 1CJKC 4Q02A 3OEEA 5TY0A 4B76A 4EKDA 4DSNA 3EIEA 2O8EA 2GEUA 5FOWA 1P9NA 3QKTA 3Q3JB 4BFSA 1SULA 3CF0A 5EP2A 2CVHA 2FA9A 1DAMA 1MABB 1P5ZB 2PLRA 4DSOA 2NO0A 1M2OB 5DE3A 4XWOA 3I8XA 3TKLA 1HURA 3HPRA 2ZRPA 2EFGA 1G6OA 3PUVA 3SYNA 5AWFC 4V03A 1P6XA 2QRZA 2FN4A 3G0HA 1JR3A 1WXQA 3WYFA 1NN0A 3U7EB 3ZS9A 4DUGD 4OQNA 1KI7A 4BZXA 4Z1MD 3T06B 4DLRA 3IIKA 2CLDX 3QEOA 3U3JA 3B1VA 4IDOA 2O8FA 4CDGA 3DM9B 3O8DA 4FN5A 1E2DA 2MMGA 4KFSA 2YINC 3THYA 3T1QA 4TLEA 4BLOA 2GAOA 3REFA 2IEYA 2OSBA 1U99A 2IYSA 2NO9A 4I4LA 2QL6A 3W90A 2V54A 4H1VA 1ODFA 2OV2A 3A1VA 1CR4A 3G5UA 1MO3A 2W2VA 1E9EA 3IO5A 1KI9A 3PV0A 4IFEA 3O8RA 1DELA 3CX7A 1B0UA 2J45A 3NKVA 3QXJA 3OEHA 4WIAA 3I73A 3WBKA 1N5JA 4CEJB 1VCMA 2ZRKA 3UG7A 1G5RA 3BFKA 1IY2A 3QBVA 2O8EB 1SKYB 2VHQA 1E6CA 5H68A 2G83A 4O3MA 4C9BA 3G82C 1TQ2A 4DCSA 2O0KA 3TJZA 2F55A 2WSSA 1VKJA 1G4AE 3FPAA 3EZ2A 2UZ3A 1S9DA 4LGMA 2OCAA 1FMJA 1L7VC 5FOTA 2JIZD 4O0MA 3QBTA 2ZJ2A 1LY1A 5TDHA 1RVDA 2Z4SA 3AF1A 1J8YF 3ONWA 1YZNA 2V1XA 1XF9A 2ZUCA 2OZEA 2QAJA 3Q8XB 4FXPA 1II9A 1YRBA 2IA5A 4I1OA 3IBYA 5FPHA 3TIFA 1AJEA 1P2VA 5EXTA 4HAYA 2ZPTX 5DYIA 3O8CA 3Q5EA 4LSGA 3C5HA 1ZYUA 5JJIA 2BMDA 3AVUA 3OHMA 1SVKA 4Q9HA 4TWZA 3B2EA 4KYIB 1G5TA 4HZIA 2WHXA 2J0UA 3K9LA 3KB1A 3CRRA 3D8BA 5L3QB 5GVRA 1YZUA 1QBKC 5FBRB 3DM5A 4F4JA 1DOAA 2QAGA 3NH6A 4Q9LA 3UKDA 4RCZA 2GK6A 1KO4A 4MRPA 1ZMXA 3I4LA 4M1TA 4HAUA 1H8HA 4NE2A 1OW3B 2P0EA 4KFUA 1UF9A 2FG5A 3VAAA 3M1IA 1LFDB 1KO7A 2N1BA 3IHWA 4JL5A 1N6NA 4DBLC 3AVWA 1GAJA 4PFSA 3U6KA 3WBJA 5A4JA 2HF8A 4FMCF 5FOSA 5LDDC 3RSLA 3L0PA 3PG5A 2KI5A 2AHOA 5GJVC 1R7RA 1JR3E 2FSFA 4GT1A 1M8PA 3AVYA 1X1SA 2A7QA 2CEAA 4JVLA 1XXHA 2Q0HA 3MWKA 5JRJA 3SBEA 3U3RA 4RD1A 5C4GB 3LA6A 4E22A 4Q9JA 3SNHA 3UK6A 1XD9A 4A2WA 2CHGA 4B73A 3BORA 5M04A 3V4RA 5JECA 1DO2A 3CRMA 3IEUA 4G5QA 3CNOA 4MRSA 3R9WA 4P0TA 1TAGA 1P72A 4QXAA 1IM2A 2ORWA 3NC0C 3NHBA 3JZAA 3EA0A 2QP9X 2JATA 4WZAE 1Z83A 3LBHA 1AIPA 5H70A 3MCAA 3U2QA 2ZRAA 4URWR 4WXRA 3AP1A 2EWWA 2DYKA 3KFXA 4XD7A 5JHHB 2VO1A 4AYWA 4BFTA 3B5JA 4B3FX 1GL7A 1F60A 2ZRDA 4GZMA 4HDOB 4Q19A 3HU3A 1NY5A 1R8QA 5G40A 4N1AA 3C8UA 3EG5A 2C99A 4Z8YA 1P73A 1OB5A 1XZQA 5D3MA 2W2XA 4ERNA 1P2UA 3C14C 2JLSA 4NDZA 3RS3A 4LI0A 3EPKA 3UPUA 4DT1A 2G1JA 2G77B 3AF0A 3JZMA 5ANRB 3VR5A 1EESA 5EE1A 3DDCA 3THOA 4Q4JA 4HZUB 4IOJA 1G8PA 1Q57A 2A2ZA 3ZJYA 1E79D 2FFBA 4PAQA 2RGBA 1KAGA 2P65A 3M6AA 4I1VA 4LOAA 4ZV4A 2QTHA 1FQKA 2H16A 3PVSA 2WJHA 3W3ZB 4KI0A 2KWIA 4LPKA 4R98A 2OFXA 4BASA 1E0AA 3CRW1 4LV8B 4ON9A 3DVLA 1FQJA 1RC8A 1SVSA 4ZI2A 2AXPA 2ZS8A 1ZM2A 3QE0A 2C2HA 2BC9A 1NN3A 2YWHA 3QJYA 2PT5A 3KQUA 1UKVY 2ZRMA 4BPBA 5HE8A 1KDOA 2WWGA 5FL7D 1AS2A 4QHSA 1J90A 1CS4C 3U60B
chains in the Genus database with same CATH superfamily
3QBDA 1HQDA 4XD7D 4R05A 1NQOA 3IKLA 3P9QA 4FYIA 4LX0A 4RDCA 2IPXA 3V4LA 1BIFA 4UARA 2PLFA 1C0KA 4LVCA 3SC2B 4IH1A 3TPZA 2OCXA 4L5AA 4WK0B 4CF5A 4CMEC 2A0WA 2QRMA 3IHTA 4M7WA 4P84A 3U9TA 1Q0RA 4JLSA 1XZPA 2CJXA 2GBIA 2JARA 1U02A 2VC2B 1BGVA 4II2A 1IHYA 4R2XA 3DDHA 1U31A 1TRHA 4I2VA 4ZZ3A 4J3FA 5B3AA 2V4MA 2JKZA 1DO0A 4L72A 2F1KA 5FLXA 3HU5A 3VBCA 2P11A 4N7BA 3RROA 4RLQA 4FE4A 4KYVA 4BNMA 4PYOA 4CG0A 3LDAA 4OGGA 1K66A 2A33A 2FWAA 2P2SA 1H6AA 4GBED 1U8CB 4NFHA 4KFTA 3UJ6A 1R4MA 3WTBA 5CA1F 1BN7A 4YRCA 4TL9A 1Z7EA 3K6SB 3IDOA 1OROA 2UUAB 1A4XA 3IT2A 2E5WA 2SBTA 4J9UE 4G3XA 1J99A 1QM5A 3BL8A 3C41J 2AN3A 3CCCA 3IDAA 4IVRA 5DHPA 5FQNA 5JEEA 1X14A 3IMEA 1VYHA 4ZO9A 5HQ3A 1H0SA 3CUEF 3ZVNA 3SYRA 3D3EA 2JFPA 4FZVA 5AVTA 1BQ4A 2GZ3A 4D42A 3K6JA 5DGIA 3X44A 4EG0A 4XQ0A 3CGWA 4LG1A 2HRRA 3O7WA 1H8EA 4RJ2A 3W9YA 1XVTA 1E6LA 1PZGA 2HD4A 2HLHA 4FWBA 4F6CA 5L6LB 3OIYA 2FSSA 3JALB 3H3XA 4LVNA 2UVDA 3RTCA 3W1EA 1A98A 1E8DA 1SNYA 3L7DA 4G5GA 4RU1A 2AOTB 3RYFB 4B74A 3DUFA 4FKZA 1RXVA 4PBTA 3W0LB 2FR1A 3KJXA 4MV1A 1N1DA 1RCUA 3PPVA 1A96A 5DSTA 5A0FA 1GPWB 1NLMA 5ESRA 2DQYA 3QHQA 1H22A 2QGFA 2X2EA 2A58A 3MINB 1VBMA 1VFPA 4P38A 3SZUA 4BNLA 4DQXA 4IICA 1NGSA 2FDCA 5FBVB 2O54A 3LT0A 1ARZA 1PT9A 1ZGBA 3QY0A 2BBOA 2PCLA 2UXDB 1M1UA 2GJ4A 1Y3BE 2A30A 2LIPA 3JAMA 1YK0A 5TF0A 4HY3A 4IKOA 2F3PA 3O1JC 4CTJA 3ZI0A 3H5OA 2R87A 1OKKA 1QGED 1USKA 3NHRA 3LQYA 1VKNA 5G02A 5HKBA 4D26A 1TB4A 1JB1A 2C03A 2QKYA 2YJNA 3AOGA 3HCRA 5CP8A 4NR0A 3U1BA 1UADA 2P3QA 1I6LA 3AEZA 2EV9A 1Q1AA 1WUKS 1KMNA 3A6ZA 4NLLA 4RE6A 3BAZA 5GP1A 1IU9A 4BJHB 2FMFA 3FE2A 1JHMA 5A3RA 2XUPA 1E7SA 2ZIWB 4IIFA 5FO0A 1PEAA 4XYLA 4LX8A 4RFSB 3UT5A 3J81A 1BC5A 2H4HA 5KIAA 4QPDA 1CXZA 3ACBA 4L9SA 4CTNA 3AL0C 1PNRA 4Q6BA 4P36A 2J30A 2FI1A 4XM2A 1XEFA 4HXYA 2NUTB 5LQMA 1U2ZA 3PP8A 4FMBB 1NLYA 4JLMA 4L7QA 5E1BA 1OUMA 4ZVOA 1HFWA 3RE1A 2BTQB 4PG4A 4NYIR 1BMFD 1OTHA 5JVDF 1Z4OA 4BTVA 3LQQA 1JPJA 3E7DA 3PI7A 2EQ5A 5IS2A 4A0HA 4ZKDA 2RD2A 4OQFA 2ZS9A 1GXSB 4UM5A 3IILA 1ZBDA 3VFDA 4FJ2A 1ZUIA 3BFXA 3CF6R 3HJGA 4RQTA 5GY7A 5A6SA 2VQFB 1JUDA 1JVNA 4D7AA 5ICGA 2IYAA 3TKAA 1ZM7A 2WRZA 3D6NB 2AFHE 4RGQA 5B5SA 1CQZA 3LWDA 3LOUA 1QV7A 4Y1EA 1DRWA 3W8RA 4LKRA 4FHGA 4CMCA 3L82B 1U8XX 1KH1A 3C3JA 5M3BA 2AZ4A 1CF9A 3VRHA 4IGFA 2ZZMA 2QG4A 2PIAA 4W9NC 4JJZA 5AKYA 5EP4A 4AM8A 3PD7A 4U7FA 1Q1QA 3RI3A 5CB4A 3T3EA 1V6SA 2QX9A 1ND6A 4C1NA 9LDBA 1RPJA 4NAUA 4MRMB 1E7YA 2WE7A 4WKNA 2I3GA 3MSCA 5ED0A 5IF3A 3I72A 3NHWA 3W8FA 5KO2A 3VNQA 2E1PA 4KWTA 3OU7A 3P0JA 3L1KA 5DTMA 3ZHTA 3UPTA 2C98A 2NZVG 4LDRA 2O8CA 2OG1A 3X1JA 1VPVA 1J2YA 3E1GA 1B2LA 1UXOA 4EBBA 3V1NA 5LD2B 4I1SA 4ZC1A 1JTVA 4QOFA 4YYEA 1SH7A 3P0IA 1C4KA 4RDXA 4WAUA 3PFWO 5KBYA 1EHCA 2Y93A 2NXWA 2GXUA 5CDYA 2D06A 2HHAA 4MKGA 2GPAA 4I0WB 5JBIA 1A8HA 2GBPA 3NEAA 4HQLA 3S8YA 3QV2A 2BFBB 2IU0A 4E13A 3QPCA 3FOBA 4DAOA 3E8MA 5JARA 1JI0A 2PX3A 5JQWA 1EP9A 2LNDA 1T13A 3C6XA 3EMDA 3EUAA 4HZUA 2BIFA 1IWPB 2MMCA 3FCYA 4WN9B 1VCNA 5EIAA 1TKCA 3M2TA 3PSHA 3ZU2A 4DLKA 5B36A 1LI5A 3CO5A 5HA5A 2XRZA 1VKHA 2IY7A 2XQGA 4NS1A 3D0OA 4X61A 5FA5A 3TIVA 2EJWA 4R1MA 3IJEB 4OI4A 2IE0A 2YXEA 4PCAA 1UMBA 2PXCA 1L7DA 4RFVA 4GRDA 3EFOA 4ZT4A 1Z36A 2OCDA 1N2SA 1JLMA 1PN3A 3PNMA 4FYKA 4ZZ2A 4C89A 2QJFA 2PSHA 2B1QA 3OCWA 3AP3A 4PTYA 4QRHA 4XDHA 5DIZA 2OFFA 3VVLA 4UVDA 2IYQA 1RC0A 3VUEA 3QX9A 3SKYA 4NATA 1WAMA 1QFJA 3M5CA 4D6YA 1KI6A 3EAFA 1UXIA 2NUAA 3DWGA 1JLHA 1RZVA 1ISGA 2R8EA 3HEAA 3LYUA 4J90A 4KPUB 5DYNA 4BX8A 4AJEA 4HNUA 4F92B 4RM2A 1PGOA 4A8HA 1E9AA 3DE5X 3DT8A 3ZVLA 1K7XB 4TM8A 2VKQA 3MW8A 1IJFA 1R0BA 3PITA 4HRAA 4N18A 5FTWA 2JGRA 2FJUA 3IAM1 4L28A 1FU4A 1VZ3A 2BEKA 2YW9A 2ZI3A 1K3UB 1OX5A 1QQTA 1L1RA 1T5LA 2JD0A 2QWXA 4PR3A 2YTZA 4XW2A 4UM9B 5BSKA 1RR6A 2BHRA 3KJIA 4FZ3A 4MVJF 2ZT7A 1DBSA 5C2JB 1W8DA 1FS4A 2X2PA 4E7PA 2HSZA 2DUUA 1K27A 1WPGA 3SYMA 2X9QA 2EL7A 1VM6A 1IWBB 3PHJA 5EZ5A 2I6QA 2H63A 2OSVA 5AKHA 5HGXA 1M67A 1KDPA 1X7WB 1GN8A 3EPPA 1Z56C 3IH5A 3LKZA 5AM4A 2ODQA 3SR0A 5B64A 1NUSA 2WF5A 3R3WA 3LF2A 5A9RA 3I12A 4L51A 2X7HA 2X2OA 3ASYA 1N7HA 3AKYA 2PT7A 3DWIA 3TLBA 3UT0A 2O06A 3ETEA 3U5TA 2QAGB 2AN1A 2M2IA 2QBYB 3QKSB 2VVTA 4OSOA 4BRZA 2YFKA 4CMEA 5HR5A 5DM70 3WGLA 2FWRA 2R8BA 3N76A 4LSMA 2A5DA 4KODA 1DC3A 3EZNA 5K05A 1K63A 3WBBA 1T5HX 3B3FA 3I2HA 3LXUX 2D1SA 4AY5A 1HNZB 3RS7A 1ZVKA 3HR8A 1BN6A 1G9SA 1X1BA 1YRWA 3KTOA 2PS9A 3O31A 4ZYUA 3ZKAA 3V1UA 2Z8XA 3WNQA 3HP7A 4AS2A 1P2SA 2I8CA 2YY6A 421PA 1DC4A 1JHXA 3CVUA 3L49A 1YRQA 3UAOA 1CCWA 2JBAA 2Q2OA 3E9ZA 3F90A 2RMKA 3Q0IA 4M99A 4DJTA 1ZCBA 2CF6A 3QNUA 3WYAA 3EZLA 4MS4B 4BVFA 1J97A 3A6FA 1FTNA 3CWQA 5FAXA 1BWRA 4TWRA 1U7DA 1OZ0A 4ZCMA 4TV8B 5CBKA 4GGOA 4I66A 5LZ5A 4OVKA 4YB8A 5JCJD 2D59A 2W98A 2OFOA 4M6WA 3N7TA 2BKLA 2OHOA 2ON6A 4IHAA 3K16A 3GRYA 4WOCA 4X20B 4JP1A 4B84A 2B94A 2G4VA 4H3KB 4P3KA 5AMXA 3D7SA 3G02A 3JWJA 3MTDA 3GA5A 1F8XA 3PRHA 3ETCA 3QHPA 3UH1A 1BMTA 3HA7A 1KJNA 1TM4E 3SC6A 3AM1A 3HZOA 3ZNNA 1H5QA 2AQHA 3NBMA 2JGLA 4TX1A 2HTEA 2YWDA 4GWKA 3ESRA 3RANA 4GMHA 4YAKA 4EZBA 2PQ2A 4KXMA 1O0CA 3KYJB 2P3SA 3AHFA 3DNMA 3UMGA 3RUCA 5K7SA 4J1TA 3CZMA 2YQZA 4OQ4A 2D0OB 3SBXA 3IQXA 4EG3A 2P69A 2C82A 2H3EA 3IMFA 1C7QA 1SCUA 2FEKA 1ZWLA 3D43A 2N0SA 1FFSA 1IBSA 4S0ZA 3RUPA 2ZSIA 4LJ9A 1N8TA 1UJ4A 5FTLA 2C9DA 3IUBA 4E07A 1ZLXA 3OF3A 4RV9A 5K6AA 4PAWA 3EOAI 3AKDA 4K1XA 1KEZA 1P9WA 3K4HA 4YRLA 2FLKA 4F7DA 1ZU4A 3G2OA 1F4LA 4GH5A 4Z0TA 1EM6A 1WF3A 1UKYA 2OL4A 2PKYX 2XWQA 5PGMA 4JIGA 3VKUA 1UC4B 4ME6A 4FD2A 4KAXA 2BGUA 2OM2A 3VVMA 5L8VA 4AY6A 3PXDA 4H2DA 1OH8A 3N2KA 2QXTA 3ZS8A 4TYMA 3D8HA 4O02B 1QHXA 2O52A 5ARBA 1L7NA 2EZTA 4QU0A 1U0BB 2RGXA 1CUWA 3CR8A 1U2SA 3KOUA 1XTPA 4LS3A 4IUYA 4MARA 4RPKA 2GF9A 5CLJA 1NJGA 2ZSFA 2GZ2A 5DLPA 1I7SB 2RI0A 3QQPA 3BSYA 3BCSA 2AQ8A 3KWJA 4F9EA 2VBGA 4S1WA 2XSZA 4Y2VA 1Q0TA 1SCJA 1YA8A 3UQYS 3ENVA 2E87A 3QIVA 5K1ZA 1PE0A 3EGDA 2BEJA 2D3WA 3G2NA 3KLNA 4HQOA 4L4UA 4MWGA 5DX1A 5E6SB 5KI6A 4ZIRA 1JPUA 1FFXB 1AM4D 1DFGA 3MWEB 5BWNA 1OPRA 3EHDA 5LKAA 3TKYA 1G4UR 1TIPA 2Q3MA 1E2GA 1TK2A 5FTNA 5KYTA 1I0LA 3R1IA 1SU7A 3QVVA 3MHPA 2O7VA 3IOCA 4UVHA 5BN3A 4ER3A 3ZHQA 1Q74A 4YHHB 3ZWYA 1I7PA 2NU9B 3H0CA 4AG5A 4I2NA 3PEUA 4PX9A 5LM3A 4R2MA 1VMEA 1HDRA 2FF5A 1P74A 2ZB2A 3OFNA 5E6RA 4A2QA 4EPXA 2FN8A 3E7FA 3W2EA 2AS0A 1V4NA 3LIPA 4K81B 4NEHB 4XYEA 2IUUA 1I9GA 1KJIA 2ODNA 4UAGA 1FP6A 1EJ0A 3GJ5A 1U28A 3JZDA 2I3AA 2E5FA 3QNMA 1QJCA 1U7XA 2X7XA 3EISA 3NHSA 4GOMD 5ERGB 3ZU5A 1QDLB 3CE6A 4C3OB 4F96A 1ITZA 4PXAA 1OAAA 3QXXA 1E69A 4F21A 4AWAA 1E4VA 1U1EA 1LPPA 2FLWA 5C8YF 3U81A 3BA1A 4TMKA 4S3MA 2NP7A 1EFKA 4JEMA 5C8XA 1KZ7B 2WMOB 2YXLA 2PL3A 3MD9A 1JLRA 3SKXA 1KGDA 1XN4A 2C42A 1MDBA 1SC4A 2VZEA 1NWHA 2WB4A 2MSEB 1ZHFA 4WFQA 3LL4A 4OP2A 2OCIA 1M74A 1NMEA 2ABWA 4MPRA 3SSNA 3MLEA 4KWEA 4EL0A 3WGIA 3U7IA 4F93B 2QT0A 2AMFA 2Q29A 4UM8B 4MQBA 3V8PA 3WDLA 4ATNA 3HDQA 1LPOA 1SVLA 3GLFA 3VPHA 2DLDA 3SZGA 1Y8RA 3LRPA 4ZOBA 3I09A 1XP8A 1RYDA 1SZPA 2NO4A 4XX1A 4P3YA 1FX0B 3UGKA 1CZRA 1JQLB 1TMKA 3KM0A 4MW7A 1Z7BA 1VFNA 2FPUA 2XSZD 1DAIA 1C3JA 5EL0A 1L5OA 3ABQB 1GQQA 3HU1A 2BFWA 4JU8A 3QOXA 3SEQA 1CY7A 3TUIC 2ZYRA 2OLKA 2IQIA 2DQSA 3BRWD 2V74B 5FWAA 4RA6B 2POCA 2L2QA 2B37A 2AL7A 1ZM3A 3F7NA 1E9CA 3W77A 1TPYA 4JC0A 4DDWA 2QNBA 3ZQJA 2CEKA 3PICA 4LBZA 1G3QA 1KR2A 4O2BB 5EJ6A 5IZ4A 2Y6UA 4PLFA 4R8SA 1VJRA 1SN7A 1I13A 2GM5A 3D2CA 3GFTA 3LX5A 4JXKA 1QZXA 3I9V6 4FW8A 4ZU6X 5TS3A 1GO2A 3UOAB 3DLPX 2WWXA 3H3FA 3UHOA 3PNKA 5JMPA 3H17A 1RFLA 2QTBA 3GJ7A 3L7IA 3T5DA 3OX4A 3U39A 4KLAA 3UCFA 1O8BA 1HE2A 4TKZA 4YO8A 1H93A 2SICE 3JYQA 3GLGE 2J32A 2I03A 4UQLA 3O1IC 1X80B 4C0LA 3K0AB 3DP7A 1UZMA 2JLYA 3O4HA 2H2FA 1GFSA 4HDNB 3L8DA 4PPYA 3IPLA 1IM5A 1EKXA 3AHEA 1SHKA 5J2UA 2VXBA 3PKIA 4D2IA 4EA6A 1BDBA 4EO9A 4QUDA 4UQOA 5DBFA 5KX5A 2HK6A 3K31A 2O3RA 4DCPA 5FWYA 1MF7A 2X5NA 5F5XA 3P19A 1BCRA 4KGZA 4BJ6A 4DARA 2VSFA 4CTOA 1RM3A 2VXOA 1ZGHA 5DM2A 3N58A 3FZYA 4YMHA 2X76A 2BFEA 5ILOA 4NULA 4IIUA 4UUMA 5JCOA 1FP1D 3HLKA 3PZRA 4XLTA 2G1PA 2HT1A 5G2OA 3UYKA 2QR3A 2HJRA 2IHTA 5H83A 5JE8A 2R9VA 3R9XA 1LSUA 1NR7A 1Q21A 2CY0A 4JOBA 2BGIA 1KQNA 1VKOA 4BMZA 3Q8LA 3Q7IA 3AF3A 4UHDA 2CJFA 5EIWA 5F3RA 3TMYA 1Q20A 3VR3A 2JEOA 4IW3B 4S2EA 5T4BA 3UEOA 3IRUA 2IODA 4ZI3A 2BFEB 2QUBA 3A6LA 3DMHA 1W94A 4CQMD 1ML3A 1CY2A 1SXJE 2W6OA 2Q28A 3AUAA 1D2EA 2BFMA 2NVBA 1V71A 3E03A 1HLPA 2HQ1A 2ONCA 121PA 2UYOA 2BFDA 2ZYIA 5F12A 4H1UA 4F56A 3VKFA 4G1BA 1XZHA 4LZPA 1ATZA 5HGJA 4N0QA 5KNBD 4FFMA 4G6ZA 4E6PA 3O95A 3CVYA 4DCVA 2WU8A 3S1SA 1YOVA 4UATA 1N2CA 1VHJA 2XDQA 2XYHA 3DBRA 4FDTA 4KVFA 2ZITA 3TF5A 2J09A 2ZLBA 1E1CB 4YP5A 4DRZA 1ZIXA 1T15A 3JPYA 4IIJF 4TSRA 3AB7A 4CKEA 5C46F 4YRFA 2QTTA 3BCRA 1DT5A 3RJTA 4YN3A 3DOCA 2A9FA 3LW7A 3U7RA 3WADA 1PJ3A 3IHLA 5KCMA 3HDJA 4WINA 4QYIA 4EJSC 4XH9B 3RKUA 2Q2NA 4JK3A 5EWLB 4L57A 2LCQA 1X77A 5FX2A 2JCYA 3ZHYA 1LV7A 3HXOA 5EIXA 2LD4A 1F2TB 3RVJA 3ADKA 3PUIA 1MX1A 4PYLA 1UMCB 2BP7B 2MSWA 3QVTA 3T7RA 1CV2A 4UM7A 3TDMA 3W06A 1P62B 1NC1A 4Y1GA 4C4ZA 3SVZA 4QOEA 5IM4A 1JEQB 3KKEA 4IXWA 1AF4A 5E7IA 1UL1X 2GZDA 4DIUA 4A5SA 1NBAA 1Z39A 3MGGA 4GI2A 2JJ8A 2ZRJA 3CNQS 2DLCX 3V5NA 3Q3IA 1VYUA 3USZA 4BRUA 4B3HA 4FC6A 1CVRA 5K9ZA 3L7YA 2HJGA 3R24A 2IYNA 2ZE5A 3OH8A 4D3DA 3JY6A 2IY9A 2E49A 3DKIA 2ODAA 2F48A 1UEXC 1YE5A 1XRPA 3ZXYA 2X1LA 3IDQA 5FBWB 3N2LA 2I2FA 1CTQA 1VJ0A 1LF5A 3KFVA 5F1OA 5JISA 1XNQB 3CNNA 4DA0A 1F48A 4YWJA 5KVQA 5LQUA 1VA5A 1JIKA 3UM9A 2HEIA 2P3OA 4UE6A 1M2GA 4EGAA 2XADA 3RLIA 4AWBA 4RAOA 4CLEA 3HCFA 2OP1A 1LPAB 2AC4A 1YDMA 4IIVA 4LYYA 4QARA 5K0FA 1YH3A 4YR9A 1QYDA 3FDJA 2PX4A 1X1QA 3QVWA 4PF1A 1UBOS 1I2CA 4X45A 4BKQA 2O2XA 1KYYA 3A04A 1UBKS 1ORHA 4G1VA 4JKOA 2GN4A 1TYBE 1DQPA 1VHQA 3MAAC 1QHIA 1SCUB 1KZHA 2UYHA 3PJEA 1T9KA 4BCBA 2V03A 3I01M 1FU8A 1OXBB 5GIPE 2YMLA 3OY2A 3DW3X 3OPNA 3BXPA 4II3A 4N0MA 5K0GA 4EARA 1M34A 1GG8A 4L07A 3M0EA 2IU4A 4MJXA 4DG5A 2NU9A 4QGSA 2CNOA 3BE8A 4LOLA 2EZ8A 3LYLA 2RAVA 1ZISA 1VPWA 2ZM6B 2ET6A 4MW6A 1E1RD 4N5MA 2A8YA 2GQ0A 4CM3A 1O5IA 3OKCA 4H16A 1QIJA 1NW8A 3NIBA 3VX4A 1VJGA 4E88A 4W99A 4D8VA 3UW1A 3EGDB 4BKRA 1UOOA 3PXGA 2OBXA 4L7VA 4JBLA 4N9WA 1CY4A 2IC5A 3AY6A 1AKQA 3TRKA 1EK2A 4LAFA 3ASZA 2ZAMA 2IOQA 2ZUSA 5KMGA 4MQ4A 1XA4A 3EMKA 3PL5A 1WBBA 1X7GA 5CVUA 1HPLA 3FCOA 3ZDYB 3LTNC 1UJ5A 1TECE 1DX4A 1U0RA 1DCMA 3S3TA 2H2WA 2D5BA 2F64A 3NNNA 5I4KA 2ATCA 4OK3A 2WHEA 3WHIA 1P75A 4HX9A 4Q9KA 3H1PA 1V1MB 2ZUFA 2J7PD 4AJPA 3W5JA 3U40A 2MDTA 1V5FA 2F1RA 4JJ8A 5LDGA 2UYYA 1BROA 3WL8A 3DULA 3LL7A 4HZGA 4Q47A 1J9EA 2VUIB 3TOXA 3EGWA 3HXKA 1QP4A 4U00A 1JDZA 1NXSA 1ZIDA 3D02A 2I3ZA 4RS3A 5H3CA 4P22A 4ZRNA 3WO0A 1RQLA 4FR2A 3QMMA 1H9AA 1R0KA 4DR4B 1Q5PA 3O74A 2DCUA 3QVGB 3AIMA 2EATA 2AXEA 5TPWB 2GZHA 1JT9A 1ZG3A 4BU1A 3N2EA 1C41A 1OXUA 2W83A 2X8BA 4M54A 1A50B 1ACLA 1L7AA 2IXEA 2X6RA 3OUTA 2Z6VA 3VJKA 3LFHA 4RGYA 3OTOB 3KUCA 2OHJA 2XKBA 4ND8B 4BEWA 4IUBS 1NULA 1XN1A 4RY8A 5BVGB 5IU6A 3BDVA 1MJGA 2WUVA 3DCJA 4KJXA 1JQJC 3NS7A 3OJWA 1Y5LA 1RW4A 3RC2A 5HKKD 3CXUA 5AXDA 3NASA 2Q6VA 2QQ5A 3RIEA 1NQAO 3ONNA 4KFRA 3CR3C 1MIHA 2H1RA 4MB6A 2LCIA 3B12A 3LPAA 4QIHA 1BA2A 4CBVA 3D6TB 3GRCA 1V26A 4FQ8A 3UENA 4NENB 2R6CA 1XIVA 3WISA 4AXBA 1IVNA 5KOJB 3ZDDA 4HNAB 2KMLA 3EVAA 3CSDA 3ZI4A 4WEQA 4ZCQA 4FLMA 4JR0A 3MQFA 3GP5A 3NV9A 1B00A 3L9XA 1AHHA 4NV0A 1IZYA 2X23A 2O2EA 5JLJA 2C2GA 3IA7A 4M1WA 4DL9A 3IQDB 1UPTA 3CKMA 3DJYA 1XQ1A 5K8JB 2YZGA 3JYNA 2Z8YM 5P8WA 1GQ2A 4MK4A 5TGZA 2R68A 2ZAYA 3LM8A 2XBMA 3U1VA 2QVXX 4JBNA 4P6VF 5J40A 3A1DA 4DDMA 1SKAA 4MR9B 1KVQA 1P3Y1 1SVNA 4NBKA 3NHZA 4CPDA 4C6TA 4FYVA 1IZ0A 3TTWA 2IKSA 2JFYA 3BXOA 4G4GA 3EC1A 4CQLB 2FSUA 1HFJA 3OSZA 1R66A 1OWMA 1SA0A 3BQNB 4KXLA 3INYA 4YAOA 3ETNA 2NPOA 3S1LA 4D4HA 5KC9A 4C2UA 2WHRA 5HIAA 2FNAA 2HNBA 2OBLA 1TU3A 1XQ6A 3HI6A 1P4RA 4KGXA 3CLRD 2NTNA 4MQEB 1T0BA 2PZJA 5ALDA 4AIIA 4V3BA 3T3OA 1CIVA 1RWXA 4AKTA 4X6XA 2HTFA 2QW0X 3EY9A 4H9GA 3C5WP 3O94A 1JKFA 2O1EA 3CQ9A 4KYIB 5AJTA 1CUSA 1T3ZA 4V0ME 1HZZA 5LZ7A 2IPOA 1CUFA 3Q9LA 5A1TA 1UMDA 1KOFA 2GXQA 3ML1A 2ZB3A 4JKYA 2ZUTA 1P0FA 2C9MA 3WP0A 3ZJUA 5A62A 3T1OA 1G4HA 2ISCA 1W1IA 1SK9A 5IAKA 4EYQA 2VYVA 1B3RA 4ZQCB 2CV1A 1NW3A 3RJ5A 4E2YA 3EVDA 3DA8A 3F97A 1YBFA 5DNDA 2QU7A 2B25A 2ZJAA 1IXZA 4P5DA 1DEKA 1NZDA 4D45A 8MHTA 4FCCA 4WW0A 1NY6A 2X0FA 4XEUA 3F0TA 2ZWOA 4FCTA 4HH0A 4L8WB 4AECA 2A6PA 1VI2A 4CM9D 2C5LA 3E3NA 1HY3A 1M6WA 1LK0A 1NOJA 2AWOA 2FMXA 1Q12A 1PWEA 2HGZA 1Y4SA 2HWWA 2PBRA 1J49A 3FVWA 3MB8A 4G2NA 4RIFA 3WVNA 2IV7A 4HVLA 1BVRA 3NWEA 2P4UA 2FW8A 3CISA 3KUUA 4URXR 3UBMA 4LGCA 1ADFA 1W0JD 4XA8A 5DZSA 3ZDCA 4S12A 1XROA 4YT2A 5ERYA 2P4EA 3RIGA 4Q24A 4J6EA 3B78A 5G53C 1W4ZA 4LVUA 4WFJA 4Q93A 1MLDA 5JWRA 3F2IA 5AM0A 3VNBA 4K9QA 4CG2A 2RBGA 4KQJA 4DYVA 5ELMA 5LA6B 2MSDB 4EKYA 3PEYA 1FX0A 2QD1A 3FNGA 3MRSA 1CUDA 5A9SB 4PG5A 4X3PA 3VPBA 3Q41A 3O47A 4I81A 3PPXA 1Z28A 3FMFA 2WP8J 1CU1A 3ZU6A 1UQTA 2H65A 2PRKA 1AGNA 4AX8A 4PSKA 2NM0A 1LS1A 2WC1A 3V1TC 1Z2CA 4CEJA 3HYSA 2VP5A 1ONSA 1P2GA 3HE3A 4IYRA 1SOVA 2WILA 1L4MA 3MWGA 4ARCA 2ORVA 1N2BA 1ZITA 1GFZA 3LC2O 3DE0X 1YR9A 5AHOA 1MW9X 4TXJA 4JOSA 1SOUA 1NPTO 2HT6A 5HM8A 2FYTA 3R09A 4DCOA 3PPIA 3NWOA 3BB1A 4K9NA 5J2UB 3CVOA 3HY4A 5KQGA 2ISSD 3KTAB 5HFAA 4WNIA 3VDRA 4FFSA 2WM3A 2P9YA 2RGNA 4KUGA 2CE2X 1T2AA 5D1NA 5D3ZA 2K2QB 3QOYA 1YB1A 4AZ0B 1AV6A 1QB7A 1XLWA 3HJCA 3NFRA 4JBWA 1IN8A 2ORIA 2V6FA 4G81A 2SCUB 1UBGA 2ZBDA 3WXBA 4FYMA 1QS0B 1XMOB 3G0CA 1I10A 2WM2A 4LTNA 2XTZA 5FFFA 4TKVB 4ZVVA 2MIIA 2VP4A 1EINA 1TX4B 3IQHX 3M1YA 4PYRA 4QBHA 1X13A 1G3RA 2HIMA 3EIQA 4LYFA 3HGMA 4Q4AB 1TEXA 3FAKA 1KEVA 2H4XA 3G89A 5BN3B 2XKKA 3SU8A 1P9OA 4HLDA 2WYUA 1E2HA 4J7XA 4HT3B 2R62A 3A14A 2DT5A 2PX8A 3TFQA 1ODSA 3RWMB 2QUAA 2YOFA 1C3OA 4EFLA 3AY7A 4HMQA 4GMXA 4KMRA 4BB0A 1F9AA 1Q1ZA 5FTKA 1W29A 4ESOA 1Z63A 3IURA 4MLDA 4RC9A 1J1IA 2BJVA 3M9WA 4ML3A 5LD2C 2BEUB 3GOHA 3HNOA 1XL0A 4MUFA 5I45A 4JROA 1CWUA 1EDZA 1G8YA 3UK2A 1UDWA 4LF8B 3D5QA 2MSLA 2NSDA 3ITKA 4LRXA 1JDVA 3JQ8B 2BHNA 4HB4A 1GA4A 3BMCB 2HIAA 2REXB 1P6QA 3O8BA 2HK8A 4D98A 5JANA 4YY3B 4DUGA 2AKEA 3CRZA 3K92A 2J6BA 5JC8A 1VE7A 3FIJA 5LXTB 3ZGZA 2QGNA 3AF2A 3C16C 4H27A 5K45A 3G8BA 4WZ6A 4CR8A 2NP6A 2WT9A 3GJXC 1CF2O 1RE0A 3LFTA 1F2DA 1TF5A 1WSBA 4HG2A 2FGJA 3GZJA 3SM3A 1U6IA 2HWKA 4MNTA 1FJ2A 2C9ZA 1IB0A 3W6NA 2WPDA 1XLTA 3BL6A 3NIDB 1NBIA 4HSGA 4YJGA 3KQYA 4PV7A 3KQQA 3VNSA 4MO2A 5CLQA 3EEYA 4JIMA 3VR2A 1H66A 1WSDA 2MOKA 3ESYA 1Z0ZA 4PSAA 2GBLC 1TADA 1MAVA 3DMTC 4JVNA 3WLRA 2XVZA 3VI3B 2R97A 2F4VB 4WNAA 5EMMA 4CEHA 4MS3B 5ALFA 1XYVA 4UNRA 2ATXA 3S29A 3U4DA 4Q82A 1N9GB 3NDRA 5LYJA 3NHPA 5I7AA 4XWTA 1GG2A 1HT3A 2HJVA 2JFNA 2V97A 2XUGA 3ECAA 3OIGA 4UAJA 4JFRA 2ODWA 5ECDA 3RC3A 1IQRA 3D7LA 1FFYA 1NONA 2V7PA 2WD7B 3G6WA 4RV4A 5KMGB 1Q7GA 1TCUA 4L15A 5AD1A 1SQSA 4WH0A 1V1MA 4DGQA 2IVFA 5FQOA 2EBWA 3RAEC 3R41A 4ZO8A 1SOAA 1E0JA 1DRUA 3D1LA 3Q3EA 1W36C 2QL5A 1GRNA 2JLRA 4MWDA 4RK0A 5KKAA 1E20A 4X1YA 3BUSA 3DOHA 4D9BA 2REQB 1XNGA 5HUHA 4B6EA 3OQHA 4ZV7A 2VPZA 4ZK6A 3JZIA 2WZBA 4KLZA 4WGGA 3UAYA 1UJMA 1ULZA 2L82A 2PBLA 2QVGA 1LBSA 2Z2XA 4IFTA 5KJCA 1FDVA 2R3SA 2R7KA 2H8GA 1BCSA 2XYVA 3LX4A 3ZIAD 3JRXA 4REMA 4MGIR 2YWCA 4W5NA 1U81A 3QMVA 2JGNA 3IDZA 5TMEA 1LBEA 4TS4A 2WG0A 4BAZA 2NO5A 2HMSA 4HCJA 3TQRA 1VL5A 2F1JA 4KDFA 5ER6A 3A26A 2C1XA 1T43A 4MVJA 4G8DA 5EIBD 1KI4A 2YN0A 5GM2A 3J80A 1FMLA 1O6FA 1U6KA 1XALA 1YQQA 3AXTA 2BDTA 4QFMA 2BL4A 3ER6A 3A28A 3B53X 4WNAB 5LQDA 4OI1A 4P0QB 4GUDA 5KYWB 4CHTA 2CBZA 1ZGAA 4NK5A 5GJBA 1K8QA 4F9FA 3D7NA 4F3CA 2OXRA 1UDRA 1P60A 3RVSA 5IVPA 3KPYA 2R11A 3H6GA 5DT2A 5M2QA 1F2UB 1G6KA 2AN5A 2IYRA 1BJTA 4LJLA 4XGRA 4TZTA 4R1UA 1RQ2A 2PRYA 2BDEA 4ZYLA 3N8HA 4GL2A 1PEDA 4OUDB 3RYCA 1T6BY 5JJCA 1UEIA 1TMYA 3BD6A 1N0VC 4B3RB 5BR4A 2PHZA 5JXIA 1U3CA 5AKKA 3X1WA 4RMNA 1TM2A 2QD3A 1YOVB 5KNBH 3FPEA 2H5JA 2ZI5A 3GFPA 1R5OA 3G9ZA 3M6LA 4QVKA 3CBQA 4UNQA 3DEAA 3T4UA 3THYB 3SJUA 1QGZA 1P17A 4EJ0A 3RRMA 1KSHA 4BNHA 3ZWCA 1QP8A 3RU7A 4L8LA 2XIJA 1MG0A 3G17A 2V7WA 5IMSA 5AI4A 4ERXA 2HF7A 4K6KA 3DEHA 3EQZA 3C6YA 3G8CA 3SHFA 5I9LA 2I3DA 3OT5A 1YQUA 5EERA 1FRVA 1EFHA 1VGQA 4K40A 4EWLA 3KEFA 1DQZA 4BP9A 3A05A 1E61A 1VL8A 5TE9A 2XE4A 3MJCA 3ABZA 3H16A 3GBSA 1BTOA 1QMGA 4DE5A 1OPXA 1U5AA 1WEKA 5J5AA 3GAMA 1FSFA 5I7FA 2FVYA 4J16A 1OBHA 2KS6A 1I2BA 3NVAA 3P26A 2P5SA 3R0ZA 2EX4A 1N2GA 3LJKA 1MD9A 1YACA 2NWQA 1QHHB 2IYYA 2C5FA 5T3YA 5BUQA 1HDGO 1ZBQA 4RQUA 3ZDEA 4RHXA 2VK2A 1THMA 1NYLA 2NZYA 3KXDA 1DWPA 2CFSA 4TL7A 1NBOA 2Z6UA 1XTIA 2B69A 2VHTA 4B33A 2PSSA 4IMPA 3A1WA 3R0VA 1ODIA 5TGDA 3ZUGA 2NYRA 6ADHA 2EG9A 4A10A 1OB2A 4UD6A 2HJHA 1OLXB 2FW7A 1BX1A 2R65A 3IEVA 1MUUA 1O87A 3UN1A 4DIEA 1VL1A 5LA6F 5F9HA 2F62A 1H2XA 1YFZA 3UH0A 3LD9A 4MVJH 1NQUA 1XTQA 3S55A 3ZD8A 2NOAA 3B89A 3QOFA 4WA8A 3VR4H 4B1FA 2VT6A 3D64A 1UH5A 3A4MA 4JEIA 3UHPA 2QLJA 1J0AA 4CMBA 3FJ1A 4LTDA 4BMYA 4F3YA 1DAFA 5M29A 3TTXA 1E2UA 4QATA 2PGDA 1BJRE 3OC6A 1V39A 2BMWA 2MR6A 2ONZA 2QQFA 3EQ7A 3H42B 2AG8A 4Q39A 4F8EA 1SUWA 3Q40A 4GNKA 4TTRA 5FNVF 3FROA 1Z5NA 2X9LA 2ZYWX 1TUIA 3DHVA 3P8ZA 4KIJA 4CU5A 2NU7A 3R5KA 5F2KA 4BMPB 2C4NA 4HN2A 2K2WA 4PZ9A 4M1ZA 3VDXA 3R2JA 1SU6A 3LC1O 4H35A 4MYTA 4TVOA 4GYYA 5LBIA 1R6AA 5A6SB 2Z30A 1R6XA 3THXA 2P9EA 3QUSA 4U8GA 5C34B 3P32A 2FDRA 4EGJA 1Y3CE 1FUKA 2H5EA 1R4ZA 4P98A 4TVSA 2NXNA 1ZMOA 3ZGOA 3GDHA 2JVJA 2XXAA 1D4ZA 4DJDC 5JNWA 5GJWC 2Q4DA 4QPNA 3MYYA 1YFLA 2C58A 5KJ6A 4QGHA 1SXJC 2FE1A 5THXA 1RS0A 1SK8A 5DNWA 3WL5A 1JN0A 1T9DA 2WKRA 1Z6ZA 1W30A 5IDWA 1O95C 2W6NA 5LP1A 1FTYA 2WUDA 2CD7A 3JWHA 4GBGA 4LJRA 2HJSA 4OJYA 3KSUA 2JGAA 5K8IA 2VHYA 1KFBB 1F3LA 4OM7A 2WABA 2QJRA 4DCMA 4J1TC 2G67A 1ZIPA 4W6ZA 4P7GA 3HKDA 4EJ6A 5C3MA 4J4HA 1DHTA 1LUAA 1YO6A 2ZT8A 1ABEA 1HOTA 5JS2A 1KPHA 1GFIA 1R5JA 2HQSA 4PPNA 3P97A 1UCFA 2R66A 1HTBA 4PO1A 1KAQA 2XWBF 1PT8A 1GHTA 3BJRA 4WVFA 5AHWA 3W5VA 3QX7A 4PRZA 4XJSA 1EK5A 3L1HA 3P5BA 3UV7A 3IVGA 3D6HA 3WK5A 3FGZA 2C4TA 3KHUA 3NBUA 4MIEA