2ZVPX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and p-nitrophenol
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
LDVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 110
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvpX00
1QVRA 1SVIA 2GRJA 4W5WA 4K46A 1NG1A 4HAWA 1G3QA 4HAXA 4PQYA 2ZEJA 1W0JA 1XFAA 2F9LA 4Z1MA 4JLNA 5AUOB 2NIPA 4LSGA 1OIXA 5JLJA 2WVJA 4EPWA 3BIFA 2VL7A 4LJ6A 3HR7A 4GMDA 3I62A 3P4YA 3CX7A 3CX8A 2QE7D 3BD9A 3ICQB 4MUAA 5HZHA 2C5LA 2QORA 1EWRA 2WWWA 4EDHA 4IFBA 4UNQA 1FL9A 5KU1A 3NIBA 4BZQA 3AUYA 3P32A 2IYUA 1U0HC 1DELA 3MWKA 1B0UA 1KK0A 2YOHA 1ZCBA 4L9SA 3SHWA 3KJEA 4G5QA 4E09A 2ZRGA 1JJVA 2MMGA 4EPYA 3L8ZA 4S35A 3WP1B 2ZR7A 2AK2A 4ARZA 1E79D 3I5YA 2OLKA 3K09C 2OAP1 4XH9B 1E2QA 3QE0A 4LK2A 2FU5C 4G01B 4M1MA 4BFYA 4BASA 3SBEA 3GEHA 4GT1A 1OV4A 4DUGD 2V9PA 1ZM7A 3SOPA 4PSVA 1ZVQA 2QP9X 2D06A 3NXSA 5FI0B 5B2ZA 4DRZA 2ORVA 4DHEA 3WBKA 5CK4A 1OIVA 4DLSA 1DVRA 3BB4A 2HDNB 4DUGA 4EPRA 1N6RA 1RKBA 3PFIA 1CJMA 2VQSA 1D2MA 2YYZA 3K0EA 4A2QA 3FGNA 5CJPA 1IHUA 2VHQA 2UZ3A 2GAAA 2EVWX 1Z28A 4MDFA 1T4GA 4KHZA 3TIFA 4AYTA 3AB3A 2FOLA 3U3RA 4JYBA 1VCIA 4DLVA 2VF7A 3GJXC 1UEJA 5DHAA 1M74A 2ORWA 4HAVA 3U6BA 2WJYA 3RS0A 4PR0A 4QGHA 4US0R 1QRAA 3RS2A 2OLJA 2WWFA 1CR4A 1TU3A 4A0FA 4LYHA 1XF9A 1G8GA 4XTCS 5TARA 2JDIA 2W2XA 1YJ5A 2QP3A 3MCAA 3VQTA 4QL3A 1Z63A 4V0NA 3MG9A 4HI0E 3TE6A 1XEFA 4DCNA 3IILA 4M8NE 5JSZA 4G5OA 4WZ6A 4WAUA 2P67A 5DH9A 4QFMA 1NKTA 3X1ZA 2RGGA 2XNSA 3THXB 5FR2A 3I72A 4II7A 2VSFA 1Z22A 1ZM9A 2W2VA 4OBEA 2GJAA 2R6DA 3PQCA 2AFHE 4PC2A 1XCGB 1O87A 3KQHA 2CE7A 4X8LA 5EE5B 4L16A 1AZTA 2QMOA 4WIAA 3B85A 5B57C 4Q9IA 2BMFA 1OFIA 6Q21A 4NYJR 3QXHA 4ZCIA 1G4UR 3THXA 1JQJC 1U2RA 3A4LA 2QROA 4XIGS 5KO2A 2G0TA 2BWJA 4URVR 3KJHA 2RGNA 4Z54A 3N5CA 3G82C 1BYIA 1XEXA 1FMJA 3QI2A 2D2FA 1Q1QA 1SVLA 4MUBA 4EFMA 2AN9A 3QBVA 4ACBA 3AV0B 1Z0DA 2FDCA 2QG6A 3DZDA 2WTUA 4R71A 1GP2A 4PHHA 1GNPA 4DIDA 2YC2C 2IS6A 2Z6VA 2V54A 1U99A 3P27A 5FL3A 3R9WA 5KPDA 3E70C 5FPTA 1DAHA 1VDZA 2GXUA 2J45A 4IVPA 4Q21A 4QM7A 2WSSD 4AI6A 1VPLA 3L82B 2DFNA 4M1YA 1MOZA 4OYHA 1SKYE 1VYTA 1E2MA 4OI1A 4Q9HA 1KMQA 1VMAA 1Q3HA 1E4YA 4Q1AA 2QBYA 4RZ3A 2XTMA 2GVDC 2ZJ8A 1P2SA 3QKTA 4HB4A 1NBMA 4OHXA 4XOIA 2CDNA 3DZ8A 2QENA 2OG2A 2GJSA 1COWD 4M1WA 5HCIA 2I3BA 1M7BA 5J4YA 4HLQB 4B3FX 1FP6A 1ODFA 2IYWA 3UWKA 3OEHA 2QPOA 1ZM2A 3VFDA 4TYWA 2HJVA 1M7HA 2ZYVX 4D0NA 2ZREA 2QBYB 4AG5A 4CVNA 4D4MA 3ZLJA 1U94A 5G41A 1NVXQ 4PTLA 1DS6A 3IBYA 3Q7PA 4P31A 3LBIA 4YDHB 4QOSA 4RD1A 3TMKA 2V1XA 1Z2CA 3GCGA 1NN5A 4KITB 2BCJQ 1PLJA 3X1XA 4DCSA 1XTIA 2FZ4A 1E9FA 2B21A 2YINC 1UBGA 1YVDA 4HB3A 4NE2A 4QBGB 4DSUA 2Q3HA 1OLOA 2RGXA 2C8VA 3UANA 1SULA 4QJ5A 2O8CA 3Q3JB 2FV8A 1TQ6A 1HV8A 1XD2A 2Z83A 3PV0A 2IW3A 2FSFA 4LWZA 5JSZB 3GLHA 1LTQA 1VIAA 5KSPA 3BJIC 1DG1G 2FE4A 1UBEA 2NGRA 4IDHA 4UJ5A 4EJSC 3GLGA 3ZD6A 2ERXA 1L7VC 2OCAA 3LFUA 5AUNB 3RRZA 1G7CA 1E9BA 3RNLA 2ZI3A 1VG9B 1ZUNB 4D25A 4Q1EA 2WAYA 4G1UC 2ZI4A 1DG3A 1T6NA 4BFTA 5JFGA 5HPYB 3A6PC 4C7OB 1L4YA 1F48A 3ZZ0A 2CNWA 3U7HB 4A15A 1Z07A 1GAJA 3TR5A 1EESA 2IEYA 3EZFA 2XOKA 4CIDA 1Z83A 2BKEA 4LHXA 4PPGA 2YWGA 3FKQA 4MKGA 2OBMA 3K0CC 4ZDIA 3NDPA 4RFSA 1NN0A 2F43B 3ZIAA 4P32A 1RYHA 2BMDA 1E79A 3U44A 4US2R 1XB2A 2G9NA 1N6NA 1T5LA 2DHRA 4MITA 3FMPB 4A92A 4B3GA 1SVSA 1N2CE 3ADCA 2B8WA 1PZNA 3CRMA 4BFVA 3W90A 4WZBE 2NZ8A 2C9CA 4CEIA 2J0VA 5FUXA 2I1VB 1KTVA 2J1LA 4L5BA 3VR6A 4X8MA 4V02A 3UMRA 2GF9A 4G5GA 2EWWA 1S8FA 4JKIA 4ZV4A 5CB6A 5D3MA 1XXHB 1R2QA 4LGMA 3HPRA 5FPHA 1P62B 2FZLA 3KTAB 4AKGA 2PZFA 1CXZA 4Q1BA 5J5CA 3VR3A 1FP7A 1YZTA 2OEPA 2QA5A 3MWJA 5FTKA 4PC3A 4RKFA 4M9XA 2Q0HA 2F9MA 1KZGB 5ANRB 4B3DA 2IL1A 4JIMA 2JCSA 1KDTA 1P6XA 2ZJOA 3U3JA 1PLKA 4DB4A 2OSBA 2ZJ2A 1WB9A 5FTNA 2XX3A 3TSOA 1W0KD 4G5RA 4CEIB 1N5JA 1NI3A 2DPXA 2H18A 2JGNA 3WXMA 4Q48A 1LF0A 2PEZA 1OKKD 4LBZA 1MABB 1HH4A 2GJKA 2CL0X 5A4JA 3D31A 4JLKA 4JKYA 2KI5A 5J4VA 1KI9A 2KBEA 1G16A 3U44B 4GNKA 2DWOA 2QL6A 3ZVMA 1E9SA 2OFWA 2WJHA 1U8YA 5FOSA 1TAGA 5CITA 3C41J 1G1MA 2LKCA 1FFHA 1YR7A 1Q1BA 3DO6A 1NP6A 3CRQA 1UF9A 2JJ2A 4NCKA 3TSZA 2VHUA 2WIAA 4FCVA 3LX5A 5HTKA 4DDWA 3NBZC 1E0SA 1HY3A 4B76A 3MSXA 4BLSA 3ECCA 4IVRA 4L15A 1P5ZB 5CLQA 4M9QA 3TBKA 4D26A 3G0HA 1Z6TA 1G41A 2WJIA 1OB2A 1W44A 3SZRA 1S4QA 1DAEA 5G53C 1OIWA 3GEIA 3QQ5A 1JR6A 3KFVA 5FOWA 1MRSA 4B73A 1XTJA 2FFQA 2OM2A 1LS6A 1N0WA 4QHTA 2GHIA 3FMOB 2FEMA 2YWFA 4KSBA 2GXSA 1ZU5A 4TSFA 2J46A 4MGKR 2XXAB 2O52A 5AJWA 4B71A 2FSIA 3LVQE 2GNOA 4LHWA 1Z5ZA 2QTVB 1EFUA 1A5TA 5GJBA 1KDRA 3MD0A 2F43A 2IS1A 2ZRAA 3D3QA 3U61B 4HDOB 4MRSA 1U0JA 1A82A 2YV5A 3GQBA 4WA7A 3M4YA 1VHTA 3VX3A 2WJGA 1JPJA 3HP1A 3M1IA 4Q47A 4ON9A 4Q4AB 2R6AA 4FN5A 1W46A 3AF1A 3ETLA 1E2JA 3NEJA 2YOGA 3ZDQA 2R6FA 1XEWX 5DIFA 5F3WB 2RHMA 5DHFA 4EFLA 2F1JA 1OSNA 4MYHA 1F5NA 3QF4B 4P4UA 3K53A 1YZLA 1V43A 3U3KA 3GJ3A 1IN5A 3K9NA 4JSTA 5KOYA 4N3NA 2XNDA 1NLZA 3FKSD 5AUPB 2DB3A 3TLXA 1SXJB 3KXKA 1UKYA 2O0KA 2JAQA 4UKDA 3SU8A 2ZS9A 4JLBA 2ZETA 4HZUB 1EFRD 1KO4A 3VKWA 1J70A 2JJ8A 3ZH9B 1KAGA 1F2UA 4M21A 4AG6A 2GAOA 4HLUC 2G88A 3THOA 4M1OA 3SDZA 5GVSA 3PIRA 1XJ0A 1X1RA 1XTKA 3Q85A 3QJYA 4U7DA 4Q4JA 3AVWA 4IDNA 1T91A 4D0LB 3AF3A 4I81A 2WM9B 5DE3A 421PA 2X2EA 2WZQA 4HZUA 1CU1A 4A8JB 4C0LA 2ZVPX 1Y63A 2ZANA 5DI3A 3S1AA 4C2UA 2EFEB 1SXJA 3IQWA 5DO9A 4C4PA 4HDCA 4H9GA 3O8CA 2QSZA 1UBCA 1IJFA 3DL0A 1ETUA 4IDQA 1JPNA 1DO2A 3L0SA 4TLDA 3RS5A 2L0XA 2F3RA 5DLQC 4B48A 4P3YA 1SQ5A 3H2YA 1YZQA 2QRNA 4LYFA 3CWZA 3MMPA 3TAHA 3W6PA 3EC2A 4XWOA 3CRW1 1EFTA 3RLFA 3ZZTA 2F1HA 4B33A 4PXAA 3GFTA 2Q9AA 4PZZA 5LBIA 4LBWA 5IF9A 5BW8A 3FFAA 4RD4A 2IS2A 3OEEA 1BS1A 3SE0A 3T1VA 1LNZA 1TQ4A 3GEEA 5SZKB 5KDOA 1JALA 4ZKDA 4FMCF 3LXRA 4P4SB 3GLGE 2JATA 1S3SA 4RCZA 2ZSFA 1HQYE 2PT7A 4ASUD 2OCBA 5CM9C 2O8DA 4GOXA 2XB4A 3UIEA 1KMHB 4BLPA 1GL6A 4C0SA 2GCPA 2VIIA 1NJGA 3LW7A 4CZ2A 1D2EA 1TF2A 4PO8A 4EIWA 3T35A 1EWQA 2ZSDA 3DMDA 1ZBDA 3KXLA 5EXXA 4YC7A 2REOA 3LVRE 3TUIC 3A58B 4WOPA 5LB2A 4A0GA 3UKDA 4Q1CA 3BB1A 3BS4A 1VHLA 2VH5R 4JYCA 5G3ZA 1FPMA 3RC3A 5FFMA 4TLBA 3E1SA 1E99A 4DJTA 4NYJQ 3VU9A 4D82A 1CJKC 2GJ9A 5EXPA 2ZUBA 3IEUA 2RGEA 1R5NA 2IUUA 4CEJA 1AJEA 1WE2A 4Q66C 4DEXA 4JLAA 1N6PA 2KBFA 2ODEA 4TMVA 3QNUA 1E2IA 3QPUA 4JS0A 1NLFA 3P4XA 4DSNA 4RKEA 1FQKA 4JT2A 3MAAC 1TL7C 4V0MA 4MYCA 1MV5A 5CIQA 3TRFA 3SI7A 3ZGXA 3KKMA 3CNOA 1KIMA 1L2TA 2GXQA 3SJZA 4B3XA 2EFGA 1SXJE 2RMKA 1S1MA 2NO7A 1VG8A 2AD1A 4DDUA 1KK1A 5CLLA 1G6OA 4FMDB 1NRJB 5FTMA 1U98A 3K0FA 1NF3A 1E96A 4JBWA 1MO3A 1E98A 3NEYA 2OCPA 4QBIA 5E4FA 4QNMA 1X3SA 4PC1A 5JCZA 1CEEA 4S2EA 4HLCA 2H5EA 4JL8A 4IOJA 1QHXA 4UNSA 1YZKA 1OFHA 2XSZA 4KJZA 3ZQJA 3CLVA 5FBLB 3QUSA 3EWSA 4RSGA 1G3RA 1VCOA 1XBTA 2C96A 4BFXA 1OPXA 3LLUA 1N0UA 3K8YA 4RY2A 2W83A 1BKDR 2ZI9A 1IN4A 3T5GA 1SXJC 2XGJA 1KSJA 3CH5A 4NTZA 1KSGA 1UADA 4ZIRA 3ASYA 1H65A 1TUIA 1OB5A 1UBFA 5A0FA 3X2SA 3LQQA 1ZINA 4LUCA 1QHNA 2RH5A 5GJWC 1W4AA 4M1KA 3WHLA 2E87A 4A0RA 3Q7QA 4PAQA 5BQ5A 3WY9A 3UMSA 4EQ6B 4M53A 821PA 2B8TA 2A3RA 1UJ2A 3A1WA 3TQCA 3QXJA 2QMUA 1ZM3A 4KYIB 1E1QA 2V1UA 4JL5A 5EP3A 4LJ5A 3GJ0A 4L9WA 2ZE8A 3QF7A 1NVVR 3U4QB 1KDPA 4M2LA 2JJ2D 2HXYA 2OESA 4PHFA 3HU2A 5DYGA 1TX4B 1I2DA 3O8BA 2ZSAA 5GADl 2QNRA 5IHPA 4OQXA 1DPFA 1E2GA 1IAQA 2VP5A 5EP1A 1NSFA 1DAKA 1NY6A 2OV2A 2ZYUX 3DHWC 1R5OA 3U7GA 5J4KA 2YJTD 4Q01A 5E7JA 1DBSA 4NCIA 2WAXA 4MRNA 2CBZA 3AVPA 4U02A 4O0MA 4TMWA 4D2IA 2CVHA 3ADDA 1GKUB 4QHSA 1F60A 1T3SA 1E2HA 3A36A 2QAGB 1U81A 5EE9A 2IHBA 1RYFA 1XTSA 4BEJA 2FA9A 1IXSB 5CDFA 2JLSA 2GEDA 3L2OB 4OL0A 4BFWA 4ESVA 1NG9A 2J7PA 3AP1A 5FOUA 5IDVA 2WMNB 4I1UA 4FWIB 2NMVA 4CF7A 3OIYA 3GJ5A 4F4IA 2ZRBA 4AIIA 1ESMA 1XEXB 4Y0AA 4UNPA 4DVGA 1O3YA 1IN7A 1YHNA 3C5CA 2FF7A 1U90A 1X8LA 3C8UA 2P2LA 4B74A 1OFUX 1KI4A 2HLDA 4V0ME 5FBWB 2DWQA 2SHKA 4AYWA 4XWAA 2H16A 2IF0A 4TYPA 3GPLA 1KO8A 1P9NA 1S1CA 2LWIA 5FUVA 3HDTA 3U5ZB 1GM5A 4EKDA 2HCJB 1CULC 4EJSA 2GCNA 5L3SB 4LHZA 3N2EA 2PCLA 2GZHA 3WP0A 3K0SA 1YR9A 3F5FA 2IYXA 3NHAA 3QKSA 1VYVA 1P2TA 3TVDA 1E9CA 4Z51A 4EPXA 3HWSA 1DAMA 4Q00A 5CM8B 2JEOA 4US1R 2ZS8A 3EPKA 2WWIA 3R9IA 2BEKA 5KNDA 1PUJA 4JSYA 1ZP6A 1FX0B 1L8QA 5K8UA 2VHJA 4D4KA 4BFZA 4FD2A 1IN8A 3FWYA 2Z5FA 3OIWA 2AX4A 2H92A 4UXJA 5LPNA 1SGWA 4M4SA 2PBRA 4Q1DA 4MRVA 1NN3A 1XD2B 4I99A 1NVWQ 2OFXA 4TL6A 1GG2A 4KFSA 3C7KA 4TQAA 4NHOA 2BBOA 1KY3A 2OFOA 3CR8A 3KTAA 2Q21A 4GBMA 4Q1FA 4XSGA 1UKZA 4IDOA 3ZS9A 4C0KA 2EW1A 4ZO4A 1TU4A 2CXXA 2ZSBA 2ZRDA 1XD9A 1NKSA 2HT6A 2ONJA 1XRJA 2GJ8A 2WWXA 3EIEA 1G8HA 4PSAA 3H4MA 3IKJA 1KI8A 3T5DA 2FFHA 2PLRA 3PEWA 1XEWY 3AVYA 1TEVA 1GL9B 1KO1A 2I1QA 4V0OA 3T61A 1DE0A 3X1YA 2VTKA 4M1TA 3CBQA 1CJTC 5JJLA 3JZMA 2ZQ5A 3AP3A 4ZIRB 3GLFA 4QG7A 4YMVA 2CCGA 3NHBA 1N25A 5JCPA 3U3OA 3KJIA 3CPJB 1XU4A 2CL6X 1OXXK 5JRZA 3A37A 3CB4A 2QM7A 1ZMXA 5JBQA 1YZNA 4R9UC 1Z6AA 3LA6A 1GUAA 4TL7A 4NYMR 1E0KA 2IA5A 1T3LA 1PVOA 3L0OA 4I1VA 5FH9A 5AR1A 5IRCD 1YQTA 2H7VA 2IYTA 1XNJA 1GNQA 1JNYA 2AFIE 2HV8A 2C77A 3CIOA 1OXSC 1U0LA 4U5XA 1RC8A 4TMTA 2OZEA 4LV5B 2QGNA 2RGNC 3NC1C 1R10A 3SBDA 3K0CA 4I4LA 4MGYR 3RWOA 5J4HA 1BMFA 4YMSA 1DAGA 1P9WA 1K6MA 2X1VA 1G5RA 2ZPTX 4WBSA 4TT3D 1U8AA 3WMEA 1UDWA 1KI6B 3EIHA 3IO5A 1N3BA 5GJCA 5EE3A 2BBWA 2VA8A 3EA0A 4NL4H 3MUFA 2ASEA 4TWZA 4X8OA 1P9RA 3WBJA 1N6IA 2KJQA 3DKPA 3SJCA 3ZJYA 2J0UA 2LCFA 2VP2A 3MWYW 1HT1E 2EFDB 4KV9A 3LV8A 5AUQA 4JVMA 3WRYC 4IDPA 1X8JA 1E1RA 2AWOA 1PJRA 2IUTA 4HB0A 2QRZA 1JB1A 1FOEB 3CO5A 2JLUA 5A5GA 4Q03A 4PFSA 3K0AB 5EUQB 1A2BA 3J81k 3QXSA 2NO9A 4IOLA 3T34A 4Q18A 4HSEA 4DDVA 1ZNXA 2Q9CA 1NBME 1T9HA 5H8WA 1JR3E 1HUQA 5AJZA 1ZJ6A 1H8HD 2P0EA 2A5GA 5P21A 1ZW6A 1IBRA 2HUPA 3KXIA 4LHVA 3AKEA 3NDBB 4C30A 3NVAA 4IHQA 4B2IA 3SN6A 1J90A 1ZRHA 3BAFA 3MRSA 3QKRB 5HKKD 3DMNA 5C18A 2IT1A 4PANA 5HR5A 4OHZA 3CF0A 3WHKA 3K70C 2CL7X 3EPLA 2Z4SA 2QAJA 5EZ6B 2J5XA 3CPHA 2W6JD 3BB3A 3QXCA 1E2EA 2JIZD 4JLMA 2GEUA 4ASUA 1ZD8A 3SYLA 2YNMA 2ATVA 1AGPA 1W5TA 4TMKA 5HE9A 1KO7A 4FIDA 4TYYA 2B92A 3FHCB 3OEED 3GLFB 1FTNA 1G7SA 4NPHA 2NQ2C 1WQ1R 3A1UA 4W5JA 5M04A 1P3JA 3K09A 3MJHA 4KVAA 2C99A 4E03A 4LPKA 1HURA 2ONKA 1W0KA 2CHQA 3AF0A 2IWRA 1G6HA 4BWYA 4CT4B 5FOTA 4KYUA 3W34A 4AC9A 2Z4RA 4GP6A 1Q1EA 3PITA 3QSYA 1J99A 1QG4A 1VG1A 2BV3A 4ZCLA 2J0SA 4JVLA 3N2IA 1XPOA 3NBFA 3KUCA 4O25A 5FR1A 4B47A 3X1DA 3IIKA 2QQ0A 4ZDJA 1ANKA 2PX0A 3C14C 1KO5A 1NIJA 3BRWD 2VHTA 4FINA 3B5JA 2OUKA 2X19A 4TTRA 2R8RA 3I73A 3SFZA 1IJEA 3HYTA 1OH5A 4OJQA 1G5TA 1R0WA 2FSHA 3SNHA 1RE0A 4EPTA 1KNXA 2ZJZA 2O0HA 1GRQA 1A4RA 2HLDD 5CIWA 1E0AA 2O8DB 5FBRB 3K9HA 1N5KA 2P65A 1CS4C 4K81B 4HUQB 621PA 5G40A 2HF9A 3VTKA 3W5IA 4WZAE 4O3MA 4R2IA 1ZIPA 1DARA 3OHMA 1YZGA 4LBVA 2GBLA 1RPZA 2EU8A 3JZAA 1W36C 1R4AA 1T8UA 5KYKA 3LWNA 4QM6A 5F9FA 2ZRKA 1JBKA 4KFRA 1Z0KA 2QPTA 1G17A 2OBNA 2XOKD 2ZRLA 3B13B 2DWPA 3LX8A 4QGFA 5FTJA 2CVFA 2GEVA 5H68A 3TAUA 1XTQA 1XCMA 4YQFA 3CR7A 5B30A 2GK7A 3QIAA 3G5UA 1H8HA 1R8QA 3SC3A 4F38A 1R0XA 3K70B 2FWRA 3QEOA 4FMBB 1E69A 2BC9A 4PAMA 4Q9KA 3VHLB 1LB1B 5DN6D 5KHOC 4OK5A 2AL7A 1WCV1 2QT0A 2AKYA 1EFRA 1VTKA 3HU3A 1ZC3A 3L0PA 4Q4HA 3GJ7A 3D6TB 2N46A 2ZYTX 1E1RD 4G3XA 4C0QC 3TQFA 3B1WA 3EZ9A 3AKDA 1Z0IA 3UG6A 5KDDA 5BN3A 3AVXA 1JEEA 3FHOA 3K0FB 4LPSA 1S9DA 4LZZA 1Z08A 3DPUA 2BDTA 3EZ7A 3IO3A 5FUWA 2BM0A 1ZC4A 5FPKA 1PUIA 3EZ2A 4E22A 4FCTA 1RRGA 3HU1A 4OJKA 1NVVQ 2RKOA 4ZDWA 4IEEA 3THWA 2TMKA 1T3HA 3BWDD 3I92A 4WW0A 4ZKEA 4DXAA 1Q12A 4DC9A 1W4BA 1WP9A 2QEQA 4WXRA 2ZVQX 2WOJA 3QY0A 4IOKA 5CK5A 3A8TA 4RZ2A 4P0TA 4PO1A 1II8A 5SZHB 1KI6A 5L3QA 1R0YA 3AKCA 3CRVA 3I4LA 2XSZD 3A1SA 2P6UA 5TB5A 2VP4A 4BGDA 4PZLA 1FNMA 2D2EA 1P61B 4L8GA 2ZJBA 1HYQA 3AVVA 3BC1A 4BFUA 3R7WA 3EXAA 5J47A 2FNAA 4M9ZA 2G6BA 4YLGA 4DBLC 2ZE6A 2ZTSA 3NH6A 2R6GA 2ZYWX 3TUZC 3EPHA 1M34E 4JVNA 3BFKA 1T8TA 4CW7A 4OK3A 4JLOA 2ZSEA 2OCYC 4IJMA 3GLIE 2GKSA 1P4SA 4DLRA 2WKPA 1ZAKA 1NL3A 2ZJ5A 4DSTA 5LD2B 1GOTA 3KQUA 2C9OA 4AKIA 3GMTA 4GOJA 1XWIA 1JXMA 1OFTA 1YZUA 1CR1A 1UKEA 2CLDX 1LFDB 5H70A 2H57A 1Q3TA 3VR5A 2IS4A 1GKYA 4G5SA 2YZ2A 1OKKA 1RFLA 3KKQA 4LI0A 4E07A 3GLFE 4BUJA 5FL7A 3PEVA 1OXUA 4QKQA 3B8HA 3L43A 1AA9A 1J8YF 3CNNA 4YDSA 3T1OA 5L3QB 1EFCA 2QGZA 2WMOB 3KFXA 1W1WA 4HLUA 3S1AB 1EX6A 4LRWA 1YKSA 1OXVA 2V8OA 3WMFA 2C03A 3ZIAD 4CEHA 1YRBA 3R9XA 3ZD7A 2WWHA 5TVKA 1SXJD 3OIVA 1UKVY 2O5VA 2O8EB 3JVVA 4YXWD 1AS2A 4C0JA 5BN4A 1E3MA 5FPSA 3CM0A 2Z43A 4BZPA 5JS7A 1AM4D 1D9XA 2BMJA 2A5DA 5IK2D 4O2LA 1Z6YA 2D3WA 4JLPA 5EUMA 1II0A 4ZCMA 2VBCA 4JMPA 2ZRPA 4HDQB 4DDTA 1M1YE 1MH1A 2BCGY 1MO6A 3B1VA 1E9RA 1C4OA 1AQYA 2QMHA 5IT5A 4JT4A 2D7DA 2OAQ1 4NYIQ 5LB4A 2QQEA 5EP4A 1GITA 1AIPA 3EG5A 1W2GA 3LO5A 3PUYA 2Q3MA 1SKQA 3MJRA 3OFNA 4B43A 3DDCA 3BK7A 3AVTA 4MGZR 3B82A 1U9IC 1ZCAA 4Q4HB 3QF4A 3CKLA 2FGKA 5DNYB 2PCJA 3OZXA 3QG1A 4LJAA 4BLRA 2W00A 3PENA 2CLSA 4C9BA 2ZRNA 4PZYA 3CNLA 1IXZA 2RB4A 1JAIA 4EPVA 2A5JA 3CH4B 4A1FA 4W5HA 2IBMA 1WBDA 1J8MF 4IXNA 1FUUA 1HQCA 2E1RA 3CUEF 4P4TA 2D7CA 1KAOA 2KE5A 2VSXA 3EC1A 4L4UA 1FTSA 4NYMQ 1JECA 1TNDA 1XJCA 1ZD9A 1LS1A 3PR1A 4MYTA 4ZDKA 4LJ4A 4POAA 3U2QA 2WKRA 4F91B 1U8ZA 4H1VA 3LQRA 4GZMA 3T15A 4A6PA 4DKXA 4HAZA 2P3SA 2R65A 2JLZA 2HF8A 3KL4A 2ZE5A 2QAGC 4TYNA 1KKMA 2IK8A 4XTRA 1NMYA 1R7RA 3D8BA 1KHTA 4GMXA 2OXRA 5KNCA 2QP4A 4HATA 4N1AA 5L3SA 1XCPA 3K1JA 4AKHA 2J3EA 2CJWA 2F7SA 1Z47A 1E1QD 2BIFA 5EXTA 2H17A 3VKGA 4Z8YA 4BE7B 2QE7A 3B78A 3CX6A 2VRWA 5KNBA 3DVLA 2N1BA 5BN5A 1E32A 2PX3A 4C0HA 4NMMA 4FXPA 721PA 2F3TA 1RRCA 3VKHA 1EFHA 5GVRA 3AGQA 2BVNA 2W58A 5E7IA 1E9DA 3VX4A 5JI3E 1FW6A 2ZR9A 3REFA 1CBUA 5KDLA 2CHVA 4KODA 2ODNA 4U00A 5EP2A 2H8KA 4JJZA 1W2HA 4TTQA 3TR0A 1BO6A 1DO0A 1OH8A 3CPEA 4YMWA 3FHTA 2ZUDA 2VHCA 3DOEA 4KI0A 2C2HA 4RJLA 3U7FB 2IXGA 1GDDA 3H84A 4TSFD 3I5XA 4JL6A 3PUZA 1EGAA 4A4DA 3RDPA 3RC8A 1G3UA 2O8BA 1R8SA 5JWHA 2F1IA 1Z8FA 1G4AE 2CE2X 1BYUA 4FW9A 3ZZUA 2W0SA 1P72A 1S3GA 3B1XA 4M22A 2NO6A 2ANBA 3A4NA 4ESHA 3NG1A 2NG1A 3AUXA 2XZOA 4G0NA 3TKLA 2GF0A 1HA3A 3WNDA 4UQOA 4DT1A 5JMTA 2R9VA 1B23P 1RIFA 2GILA 2BJVA 1M7GA 1M8PA 4RZXA 3RABA 2CJWB 2GBLC 3C4JA 1G291 4CEHB 3EARA 3TK1A 4PC7A 3GLIB 1SHKA 4TL9A 1Z29A 1W4CA 4PPFA 4DCUA 4PQFA 1ELOA 2ERYA 1G5PA 2JDID 4FI3C 2PT5A 5TXGA 4ABYA 3NKVA 4M9SA 3KKPA 2WBLC 1GIAA 1HEIA 2FH5B 4QRHA 3UPUA 3GLHB 1Z6XA 2DFLA 2ZRMA 2WKQA 1ZYUA 1LW7A 1EG7A 2VF8A 2YVUA 1KJWA 1K8RA 4B3BA 2NO1A 2O8CB 4GOKA 1GTVA 1GZSA 1TPZA 3IHLA 4I1OA 2AXNA 1RVDA 4O2RA 3IIJA 4MH0R 3V4FA 4ZI3A 1CR0A 121PA 2YC4C 1QBKC 4PHTA 1DTSA 4TQUS 1E9EA 3WYGA 3SYKA 2ZAOA 3BFVA 3DM5A 5JEDA 2IHYA 4B75A 4DLWA 2VP6A 3BERA 3UMFA 3BXZA 3FB4A 2ECKA 4B2PA 3HJNA 3CF2A 1H8ED 3KKOA 1MKYA 4C0BA 2ZIAA 1VKJA 4R2HA 4A36A 3DKVA 4ARZB 5B58C 3ZS8A 3LW8A 1Q20A 4OKSA 3RSLA 2WHXA 2FPLA 1XZQA 5DSZA 2HJGA 4IFEA 1CF4A 2JLWA 3FMIA 3GJ6A 4YXWA 1S96A 4TL8A 2QUZA 1XP8A 2J59A 1R5BA 1I2MA 2FJUA 2XAUA 2ZE7A 4QC2A 4CDGA 3PJRA 5SZJA 4OHWA 2PEYA 2ZRIA 2X8AA 3K9LA 2HEIA 2GESA 5L3RA 2QN6A 2CK3A 3PEUA 4AWXA 3V4RA 3ZVNA 2ORIA 3PCRB 1TMKA 2HCBA 4JJKA 3KX2A 3PUXA 4GRAA 5FL7D 3U4QA 5JECA 3IEVA 2EWVA 3IGFA 1KSHA 4DIEA 1F2TB 2F1RA 4MRRA 4BEBA 5EJEA 4OI0A 1QF9A 3EASA 4GPTA 1CIPA 5IK2A 3AP2A 4BLQA 2KSQA 5AJVB 1FZQA 4DLTA 1J7KA 1Z0FA 2W6JA 3C16C 2XTNA 1D6JA 1G7TA 2OILA 4D6PA 4ZPXA 1RRPA 2WICA 2W6ID 3E2IA 2G83A 4DCTA 2YHSA 3NBXX 2FFAA 1A7JA 2VPPA 5DI9A 2QTFA 2EFHB 4F4JA 4K8OA 3CONA 1IONA 1OXTA 3Q8XB 3IQXA 4LC0A 5JHGB 2XNDD 3FKSA 3P1JA 2WPDD 1OH7A 1D2NA 2QAGA 4OHVA 1N6KA 4A9AA 3SHFA 3IPXA 1TADA 1X86B 1NBMD 1S0UA 3KQLA 2AR7A 1AN0A 2MSDB 1TTTA 5BXQC 1NIPA 3TSWA 4IOMA 1M2OB 2V6JA 3EW9A 4URUR 2GCOA 3AVUA 3DEFA 4LJ9A 3ZYCA 4BLTA 4DCVA 3QVUA 2JIZA 2AK3A 3B1YA 5C4GB 3O8RA 4BECA 3B1ZA 1GWNA 2IEZA 3RRNA 4EAQA 1S9HA 1P2VA 2ZRHA 4URZR 3BE4A 1E6CA 4MRPA 2O8BB 1MO4A 3B7GA 3KUDA 2QPAA 1G18A 4TQ9A 5FBVB 3ZQ6A 2YKGA 4MYUA 4NBSA 3IHWA 2J9RA 2REBA 2GZAA 1JAHA 1WA5A 4IXMA 3CW2A 1DAFA 1ZNWA 4JBXA 4JLVA 4TZ6A 2EQBA 1OHHD 1ZD1A 1MRNA 2P6NA 2H1LA 1F2TA 2IXFA 5JI2E 4DSOA 4HEJA 4EQ6A 1OF1A 1EXMA 4RFVA 1E4VA 3QG5A 2DFKB 2WWYA 2JLYA 2IUSA 4CYMA 3KZ1E 3CRRA 2JLVA 1N6HA 2D4HA 2ZU6A 3Q72A 1TF7A 4TMZA 4TZ0A 1QHHB 1AZSC 1LF5A 4RD6A 2IYVA 2HYDA 2XTZA 4A2WA 3ADBA 4YONB 3KJGA 5UKDA 5HZKA 4A82A 4XJXA 5AK0A 2PH1A 1X6VA 3W8NA 4RD3A 4IRUB 2UKDA 4QJ4A 4NCHA 3UG7A 2GCOB 5FPYA 1Z6GA 2RGDA 4XD7D 4B34A 2CCJA 2LKDA 2QSYA 1PV4A 5JJKA 3LXXA 4Z8XA 1G8PA 5EXSA 1VG0B 1G8YA 1E94E 1WDTA 1KZ7B 4HYYA 1VCMA 4ILEA 4CT5A 1SHZA 1KI1A 1KK2A 1JR3A 1RZ3A 1ZNYA 3GLHE 4B2LA 2JASA 4TLEA 1TF5A 4W9MC 3QPVA 4TMXA 4W7SA 3BORA 5JEEA 2VEDA 1G21E 4GL2A 1E2PA 3SYNA 4B3CA 1XDBA 3E5HA 3SR0A 1TQDA 5C4MA 5DI3B 4X8HA 1OYYA 4AY2A 4MKFA 4LY6A 4RCYA 1CR2A 2OO7A 1OW3B 5BYKA 1FMLA 1Z2AA 1Q0UA 5L3VA 1G7RA 2J7KA 3H86A 3KQNA 2OE2A 1QHYA 1NY5A 3O8DA 3EIQA 2EYUA 4GZLA 1E2LA 5JWOA 1TQ2A 3GLGB 3VAAA 3VMFA 5K8LA 2A5YB 3F3YA 2UZIR 5HCNA 3CZQA 1WXQA 1SVWA 1AS3A 3IPYA 1LVGA 1KGDA 3IDQA 4C3ZA 4KO8A 3LD9A 3HPQA 2ZS7A 1QHHA 3LRPA 4IW3B 1Q1ZA 1RRFA 2QZ4A 4HAYA 3KKNA 4GI7A 3OE7D 5F9HA 3OFND 2O8FA 2ZRJA 3I1FA 1AGRA 2IYSA 1T0JB 2IYQA 3A1VA 3KB1A 1N6OA 2CCKA 1IOZA 5D3QA 3U3MA 1P7CA 2V4ZA 2JA1A 2IYLD 3PUWA 1NJFA 3M0EA 2BMEA 4KXFB 1X8KA 2A2ZA 3T1TA 1MABA 4GP7A 2B7CA 2CNWD 2ZITA 3NBYC 4BQSA 5C2JB 2MSEB 4OQNA 5G3YA 1U9IA 3MWLA 5CYPA 1Q21A 5BWMA 3SFVA 4DLZA 5B64A 2YWEA 2CMKA 1QHIA 2WV9A 4NU0A 1VCNA 1HTWA 2AD5A 4AYXA 2MMCA 1SZPA 2ZRCA 2GXAA 3ICEA 3LBNA 3CF6R 3VHXA 1KJZA 4CGZA 3NWJA 2BEJA 3F8TA 2NPFA 3RYTC 5J4LA 3W6OA 4C2TA 5FOVA 4QBHA 1R0ZA 3X1WA 2DY1A 1YE8A 1TEXA 2VO1A 4R7ZA 5D3MB 1XD8A 4TTPA 1XZPA 4D80A 5FTLA 3C5HA 1SKYB 5FUYA 4GSYA 4AK9A 4RZUA 4BZXA 2AXPA 2JLQA 4P33A 4LC1A 1NVUQ 2ZAMA 1T5IA 1YU9A 2P6RA 1E2NA 2J7PD 4LOAA 2QMEA 4LX0A 3ZVLA 2G77B 4AKEA 4ERNA 3K0AA 1YR6A 2FX3A 1UDXA 4D4JA 3BOSA 2DFTA 2C04A 4Z1MD 5TMPA 2PJRA 4MA4A 2O8FB 4N0EA 4RFSB 4FMDF 5BYJA 4YMUA 1JXOA 1L4UA 4JBYA 2WWGA 4Q02A 1MT0A 2G1KA 4QJ3A 1KYIA 1II8B 3TUJC 3THYB 1AQUA 4HUTA 5AJXA 3WRXC 1FQJA 2BBTA 3WYFA 4BRWA 4URWR 1XXHA 5FOXA 4ZI2A 4Q19A 2ZXUA 2IX3A 3THYA 2D62A 4LCBA 2W2TA 3THWB 4XVRA 2PL3A 3TVTA 3AKYA 2A9KA 2J0UB 2FPKA 2P5SA 1G8FA 5C1BA 2WSSA 2HXSA 2VLIA 2VYFA 2GDJA 3TNFA 4LJ7A 4B35A 2FG5A 3VU9B 2JLRA 1GRRA 1TUEA 4V03A 2REXB 3RAPR 3V00A 1ZU4A 2I4IA 4PX9A 5EE1A 3AQ4A 1OH6A 2ZI5A 4A2PA 1US8B 2G0NA 2OXCA 4PQRA 1IY1A 3B6EA 3QPWA 1Y3AA 4EUNA 1MR3F 4KAXA 221PA 1GL7A 2C78A 2ZR0A 1DOAA 1IXRC 2GK6A 1K5GA 4XWKA 4URXR 4JVSB 1CJUC 5JHHB 1QZXA 2JJ1D 3K9GA 1E2FA 1W36B 3QXXA 1BMFD 1PLLA 1KK3A 3QOFA 1KY2A 4WVFA 3W3AA 4B32A 3BFXA 3BBPA 4FMCB 4QXAA 5JRJA 1IN6A 1G20E 1CRQA 4QGAA 5TDHA 4QGGA 5FI1B 1JQLB 1OYWA 3SQWA 3NC0C 3VR2A 2IF2A 3CZPA 4LJYA 2ZM5A 1W36D 2PJZA 1UAAA 4D0GA 3GFPA 5CYOA 3SQXA 3T12A 1GFIA 2QTHA 2Z0MA 2OHFA 2IC5A 4MKHA 2R6CA 1NN1A 3OESA 4KFTA 4A8JA 3AF4A 1G9XA 2WPDA 2ANCA 3IBGA 2A7QA 1D8TA 3AVQA 1SVKA 1NSTA 1CKEA 1GVNB 1XXHE 3RRMA 4DLXA 2QM8A 4NP6A 2W6IA 4PHGA 1CRPA 3EA5A 2PMKA 3PG5A 3DOFA 3K70D 2XJ9A 3KDSE 3FDIA 2V55B 3R20A 3R7WB 3H0KA 1US8A 1FX0A 1QG2A 2A5FA 4QNRA 3RSOA 1KKLA 3CWQA 4AURA 3I3SR 1QHGA 3W9YA 3A1TA 1VIYA 3C15C 2GTPA 4IVQA 2N42A 5SZIA 4HAUA 1DAIA 2V6IA 4KFUA 4NZYA 4Q4LA 1KMHA 3SEAA 4PPQA 3UWOA 2FFBA 2G3YA 4NH0A 1W47A 3M6AA 3OE7A 3AM1A 1CTQA 2PZEA 3KQKA 1A1VA 2FN4A 1KOFA 1E2DA 3UK6A 4OI4A 1AKEA 1FNNA 4EJSB 5K8TA 3LBHA 4RVCA 4OI2A 1IQPA 4QHYA 2WOOA 2R62A 2RAPA 4Y0VA 3LNCA 4KVGA 2FMXA 2GWHA 2ZI7A 5TY0A 3RHFA 2CLCX 2F6RA 4LYJA 1DADA 2B6HA 2NOAA 4DWJA 1H8EA 1XPRA 3OAAA 2XITA 4AD8A 5KSYA 3LLMA 8OHMA 5JZVA 4ACAA 1WMSA 2Q9BA 3T1QA 5KTYA 1A2KC 4OQMA 1P2UA 5H1YA 4A0HA 5L8VA 3QKSB 4EFNA 2NZJA 1XMIA 4LV8B 3RWMB 3Q5DA 5DGXA 3WYAA 1OT3A 3LY5A 1UEIA 1YR8A 1FUKA 5LD2C 3FFBA 1QVAA 2GETA 3UATA 3ONWA 1R6BX 4UXHA 4WXPA 1N5IA 4M0LA 4RD2A 3MLEA 4MKIA 2DCUA 2A78A 4Q7JB 3IUYA 2R44A 4DT1B 2IWHA 3EZ6A 2JJ1A 3IIMA 1MO5A 3D7MA 4PSKA 1C9KA 4Q9LA 5JS8A 2VSOA 3L8YA 2YOFA 4KLNA 4URYR 4F92B 1JEDA 2RGAA 3EAQA 3V9PA 3ND8A 3P20A 4TT3A 1ESNA 4MGIR 2EYQA 1OE0A 3FE2A 1IM2A 2FEOA 1LV7A 4KCGA 2O8EA 4JZKA 1IY0A 2JLXA 4FCWA 1YRAA 3A4MA 3FYHA 4BFSA 2RCNA 4Q5IA 1F6BA 2HYIC 3SJAA 1QDEA 1W49A 1WF3A 4OHYA 4HZIA 5EQTA 2HT1A 3Q9LA 4UNNA 4OQLA 4MQBA 1COWA 3LH5A 3W3ZB 3SS8A 3I32A 3WNCA 2D74A 2RGCA 2QY9A 2DBYA 2NTYC 2W0MA 5E7MA 1KI2A 1KJYA 3PEYA 4NONA 1IY2A 1XTRA 3O47A 4LJ8A 2IYRA 1KDOA 1Z06A 2OT3B 4DLUA 4TLAA 2VP0A 1HE1C 4JLDA 4MDEA 4F7WA 3EX7C 1BH2A 2ATXA 2PZGA 2ODWA 4HB2A 3OF5A 4Q7LA 2VP9A 1AKYA 1XMSA 2IYYA 4PPNA 1N0VC 1EK0A 3W5JA 4CEJB 3BH7A 2C95A 5EE0A 3ASZA 3U60B 1ONBA 1XMVA 1Z3IX 2ZJAA 5EZ5A 4BPBA 2WJVA 4V0LA 3VR4A 4BRUA 3MGCA 1ZM4A 4B6EA 3W6NA 3GD7A 4H1UA 1GNRA 3AH8A 2ODBA 3RS4A 4FWTA 4Q7MB 1I4DD 1AS0A 2BBSA 1HT2E 2IXEA 2R2AA 3EWAA 2RHDA 1SVOA 2QT1A 1N6LA 2PLFA 1X1SA 1XX6A 3BGWA 4GFDA 5E95A 2MSCB 5DN6A 4D81A 5TV2A 4DZZA 3FVQA 4R98A 3QENA 2XZPA 1W7AA 2CEAA 1CJVC 3LAWA 2K5UA 3OAAD 1OHHA 3MFYA 2PMDA 1KI3A 3FOZA 5E3HA 4KBGA 2GA8A 5CDFE 2KB0A 1XMJA 1ZUHA 1RJ9B 2NPIA 3F0TA 2Y8EA 2FPMA 4IKEA 1OJLA 1XJQA 2J41A 4TLCA 3L0IB 5F2EA 4C0AC 1VECA 3RS7A 4XVUA 4J0QA 3W8RA 2ZUCA 1G64A 3N70A 2WIBA 4DLYA 1J2JA 3B9PA 4UXIA 2XZLA 5DYIA 4B44A 3TW8B 3LDAA 1ZUIA 3GFOA 4LV6A 1Z0JA 2GVZC 4KLZA 1E2KA 1W48A 2WSMA 2ZU0C 1P75A 2DYKA 3KB2A 4ITRC 3VNUA 4KBFA 3RANA 4KSCA 2C9YA 2ZRFA 4NKRA 5AWFC 4BLOA 2QU8A 2XJ4A 4Q7KA 2XB2A 1WRBA 3B60A 1QHSA 4A8JC 2F55A 1D9ZA 2AHOA 4B6FA 2J87A 4M1SA 2DR3A 3GP8A 2CK3D 2XEXA 4IEIA 2BKUA 3HYRA 1I4LD 4KU4A 3H1TA 4JLJA 4DEYA 1II9A 1XPUA 1AK2A 1D5CA 5F98A 4NCNA 3WMGA 2AWNA 1M6NA 2CHGA 2ZI6A 2WJJA 3AVOA 4LDJA 1G19A 3VNVA 1F3OA 3QKUA 5JJIA 1CLUA 1HE8B 3HR8A 2A30A 5JWRA 2E9SA 3TGPA 5K8IA 1GKIA 2ZROA 2RGBA 2IYZA 1G3IA 3P26A 1KNQA 2UVQA 3GJ4A 4A6XA 3RVBA 1ZIOA 4XSHA 3AEZA 3QBTA 3B9QA 3OIUA 4GDFA 3BH6A 5FBQB 3Q5EA 1BIFA 3QVVA 1S2MA 1VYUA 3DM9B 3GLIA 4I1SA 4C7OA 2BOVA 5DISB 5CB8A 2J0QA 1F2UB 1GILA 3PUVA 3AF2A 1T0HB 3ADKA 4UJ3A 4RD0A 3QEJA 3QKRA 2FSGA 3PXGA 1Q22A 4F93B 1BOFA 5GJVC 2KWIA 3WNBA 5HKKA 5KSOA 3BH0A 2V3CC 3TH5A 4TN1A 2X2FA 2BHRA 1EX7A 1K5DA 2ZJYA 521PA 3FTQA 2NO0A 3FMFA 3NH9A 5KPJA 5AJYA 1Q44A 4XD7A 2QI9C 4CRWB 1CP2A 4V0KA 3I8SA 3R8FA 4TYQA 3EPJA 1W5SA 2OBLA 3ND9A 4HLDA 4NDZA 4OK6A 1E9AA 3TW4A 2O0JA 2BM1A 1I4TD 4E5UA 3TJZA 1P73A 1W0JD 1RJ9A 1C1YA 2EFCB 1NLYA 3OEHD 4LBYA 1V5WA 4Q4JB 4LHYA 4P4SA 3REGA 1LY1A 3ZVRA 2Q6TA 2X77A 4NYIR 2BJWA 2B7BA 3AGPA 4Q4AA 1JR3D 4Q9JA 1N5LA 1RW4A 1NMXA 4YMTA 3U6KA 3RS3A 3T06B 1JI0A 3UXMA 3R8CA 3I8XA 3I61A 1UFQA 1W4RA 1UM8A 4OQFA 4PO9A 4F4CA 3NTUA 2V7QA 3RRYA 1P60A 1NNEA 4LYAA 2Q3FA 2XXAA 1GRNA 2C98A 3JVUA 5KUTA 4N0DA 4PC6A 1KSFX 1ZNZA 3FPAA 1G3MA 1DEKA 2AKAB 3B2EA 2V7QD 4HUQA 1WBBA 2FGJA 3GJ8A 5C46F 4QBFA 5KSZA 4DB2A 5LDDC 5J40A 5CJ2A 2G1JA 4UNRA 3U7EB 2P5TB 4NCJA 4PAOA 4D4LA 1Q57A 3SJBA 1GSIA 1JJ7A 1UPTA 3PVSA 4XVQA 2GZDA 1NMZA 2YWHA 3VR1A 5ELXA 5HE8A 1KI7A 1E0JA 1Z0AA 1SVMA
chains in the Genus database with same CATH superfamily
1Z15A 3TCKA 1QVRA 1SVIA 2QVBA 4CHTA 4K46A 1GV1A 1NYTA 2WT9A 4HAXA 3TTXA 4BVJA 1CS0B 5ICMA 4TRJA 4U8HA 4R4JA 4DTCA 1ZAYA 3C4QA 3NHFA 1JKIA 2N1MA 3A7EA 3RUDA 3ZWNA 1TYAE 5K3AA 1U2GC 3GIWA 4A1OA 3DMRA 2H7CA 1OIXA 1W75A 3LT5A 4CV0A 4EKGA 2WVJA 3D5EA 1W4ZA 4AT1A 5JQGB 3HR7A 3I62A 2MJLA 3SS9X 4AP5A 4CG2A 3KQYA 5E4YA 2QE7D 3AHCA 2HMUA 4FHZA 1O89A 1X80A 1EWRA 4IKOA 1CY4A 2WWWA 5I7FA 3RYCA 4DR1B 1WXFA 3NIBA 3DKKA 5E9JA 2C94A 2IYUA 4GW3A 1ULSA 1YOVB 1KK0A 4XXHA 3BSYA 1PAUA 3AQIA 1UMCA 2F8LA 2GO7A 3KJEA 3GH3A 4G5QA 4IWNA 2AZTA 2AUTA 4KDFA 1BKSB 1JJVA 2MMGA 4Q7EA 2G5GX 2CDBA 2WU1A 4PS1A 5I47A 3WP1B 3D4IA 1RPTA 2ZR7A 4YUWA 3JAMA 2AK2A 5KQLA 1E79D 4DDHA 1XKQA 4IDGA 3D4LA 3SC2A 2OAP1 4I9FA 1AXRA 3QE0A 4I08A 3ZLUA 1MJNA 4M1MA 2A94A 2IEDA 3ESXA 1BGVA 2P2YA 3LF2A 3N6XA 4NNPA 3UWPA 5ALHA 1DUSA 1N4DA 1QS0A 2G36A 4GT1A 4AXBA 4WY8A 4BASA 2V9PA 1ZUD1 2XUJA 1EQUA 4Z6KA 4ZTZB 1MA3A 3HDQA 1W8DA 3H9BA 3QFTA 1DV1A 1E5XA 4X24A 4KPFC 2K6GA 2R84A 4IINA 4WQMA 2X8BA 3GT7A 4RK0A 1Z68A 2IOQA 3A31A 2BFBB 3EGEA 4ND8B 1RXYA 2FUNB 5DLYA 4DLSA 4MQUA 4FZJA 4MI3A 1BWRA 3KVRA 2EKLA 3PFIA 1YA6A 1XL1A 1IHUA 1T43A 3I9LA 1A04A 2VHQA 3RUCA 3UZUA 3W0LB 3MWEA 1ENZA 1PWXA 1YB7A 3EVDA 3I6IA 3IBSA 1Z45A 2Z9DA 3TIFA 4M87A 4E88A 1X7ZB 1B6TA 2FOLA 3X2EA 7AT1A 4PYIA 4ESOA 5CVDA 4TRRA 4M0KA 3OX2A 3ETJA 4GYJA 4GOLD 3RHZA 2M6LA 1OVGA 2VF7A 1U7DA 5A3QA 2HUNA 3D6FA 5IDXA 2QHXA 5K03A 3U6BA 3KKLA 2I0FA 2WJYA 1SZCA 5JJ5A 1VFNA 5DCLA 3WGTA 4CMKA 13PKA 5AVJA 4QGHA 1QRAA 2DT8A 3OF3A 5AM0A 2OLJA 2WWFA 3QU9A 1QIMA 1NNUA 2J6CA 3ETGA 1G66A 1G8GA 1H5QA 2YFYA 3F6PA 2JDIA 4WKPA 4XTCS 1CEYA 3FH0A 5GZ6A 3VQTA 1MG5A 4QL3A 1JPVA 4JN6B 1Z63A 3HRIA 3MG9A 3OP4A 3TE6A 5TR9A 2QTTA 1EWKA 2OHXA 3IILA 1XZAA 2Z2YA 3NNNA 5JANA 5ALKA 5JXJA 2H4WA 2P6MA 1NKTA 3X1ZA 2CBGA 5FR2A 2PZKA 3B1KA 3REQB 3FNEA 5E1OA 2GJAA 2O1EA 2R6DA 5GY7A 4HQRA 5GQSA 5EVJA 5KB3A 2RJ3A 4ZRMA 1P0CA 4PZUA 4HGRA 4TWJA 1AZTA 4WIAA 1P45A 1ONNA 3BMOA 2VUUA 4RWEA 3MCTA 1W6UA 3NTQA 5B57C 2VPQA 1OFIA 4QICA 6Q21A 3BXPA 2AKEA 1U2RA 3A4LA 1SU4A 3EEBA 2O3UA 4GC9A 2P0AA 4XIGS 4ZI7F 1Q7CA 4IG4A 2PVCA 5C7LO 1Y1TA 4RPIA 2Q1TA 3CWCA 3P9CA 3G82C 4MVYA 4G5YA 2WG2A 1XEXA 4TUYF 2FUG1 1FFWA 3PHLA 3QI2A 4L73A 4MAMA 4N18A 4XJTA 2X8JA 3IQDB 3KB8A 4R01A 4JXXA 3E2MA 2I3DA 3D4PA 3NYWA 2HLPA 4GM0A 2AN9A 2VTEA 3LUKA 4NU8X 5TMBA 2QG6A 1ONPA 5D5HA 1F7VA 1NVKA 3PPYA 1WDKA 4UM7A 4L8FA 4B3HA 2IS6A 3CKKA 3HVUA 4MQ6A 3BHIA 2QXTA 2O2GA 3P27A 4KQ2A 3JXEA 1PI3A 3E70C 1QO0D 4GWLA 4HDNB 4R83A 4JEMA 5FPTA 5FT9A 4AO6A 3FSGA 1PYDA 3DUFA 3L82B 4HDSA 3RI3A 1G2PA 2HSDA 4RGQA 4RIEA 2H52A 1VYTA 4KC0A 4L4SA 5IBRA 1FLDA 4Q9HA 5MN6A 2IKQA 1KBZA 1E4YA 3JQGB 3NATA 1J0XO 1QXSA 5KYXB 3HBAA 4G4JA 2QBYA 2XT0A 2ZYAA 1ND5A 2ATCA 3QKTA 1NBMA 1USKA 3DZ8A 4U2EA 1QR6A 3DEAA 3KFLA 3ROGA 5HCIA 5D5QA 2WA1A 5FAKA 3P71T 3IUBA 1G63A 4HLQB 3U4DA 5KVVA 4CQJA 1GPDG 1KGSA 1FP6A 1ODFA 2I7DA 2Z3VA 1OGJA 4KQKA 4PICA 5CYFA 3ZS8A 1ZM2A 3P9IA 1HORA 3VFDA 4JFAA 1Z16A 1QG0A 5DMHA 1M7HA 2ZYVX 4D0NA 1KFCB 3H18A 3QM1A 1BFUA 2QBYB 2A33A 4X7BA 3OCCA 5T57A 4AG5A 1ODIA 1U94A 1NVXQ 5G41A 1QYIA 3HSSA 2UDPA 4D4MA 4YV2A 1A97A 3IBYA 3OLYA 3Q7PA 4WXEA 3LBIA 1SKMA 3QJGA 4YDHB 4RD1A 4W8OA 3U09A 4IFTA 3EK2A 4E5NA 1YRLA 1XLVA 3KSRA 2VPWA 3TMKA 4CN8A 5BNWA 5CFPA 1PLJA 3OJ0A 3JD4A 4GQAA 1LV8A 3C6ZA 1T1JA 4OXYA 4RGYA 2CD7A 1UBGA 1YVDA 1P7WA 2Q3HA 1OLOA 2R25B 1N2EA 2RGXA 3B6KA 3NONA 2O8CA 5IG2A 3BGSA 2R68A 3T1NA 3IUJA 3FLEA 4G0QA 4R2KA 4E15A 3LLSA 3RVQA 2XAAA 4P4LA 3E5MA 2Q1SA 3I01M 1G5FA 1VIAA 2F3SA 5KSPA 5EIFA 1R0KA 1GRCA 3FG9A 2WHRA 1GAEO 4X85A 4EJSC 2UU9B 1L7BA 5JQGA 2OCAA 3DT8A 1QGED 3GP5A 2PT9A 1B73A 4HPXB 1KJIA 2EARA 2RHTA 2YQ5A 2QJFA 3QELA 4RETA 1DZIA 1E9BA 3RNLA 1CY6A 2P4HX 2H5LA 1XZGA 3C3EA 3ANTA 3K2IA 3ND6A 1QO7A 4RK7A 5EWLA 2I6XA 5CCEA 3T7CA 3JQ7B 5BRJA 5KC9A 1F4VA 2GT1A 3KPUA 4BFTA 5JFGA 2Y6VA 5HPYB 1I0IA 4RNDB 3ZZ0A 1EDBA 3SQNA 2IXBA 3ZU6A 4ZZ3A 4O4JB 5CFQA 1RAEA 2IEYA 3C24A 1ZH2A 2QWXA 3TPCA 4RLFA 2XOKA 3CGGA 3WKBA 4BQNA 4PIPA 4UHDA 2CYCA 4JYMA 3VZDA 4MKGA 5IXYA 4MR9A 4AF8A 4ZDIA 3NDPA 1T1EA 3I64A 4P32A 1SY7A 5ERXA 4ENVA 2BMDA 3U3XA 2VDKB 3JWPA 4YUAA 2C3PA 3U44A 4ZARA 5IN4A 2ZT7A 4H3VA 4ABTA 1N6NA 2ZJ6A 3T7JA 1R6DA 3NVMB 3DNFA 4FZ5A 4YR7A 1FU7A 4A92A 1SB8A 3EFBA 4GR5A 4B3GA 1BDIA 4FHEA 5JD3A 1FDSA 3K1YA 4BFVA 5DHTA 2PZJA 3TG2A 4WZBE 4BX2A 5GAJA 1MA0A 2GO1A 2C9CA 5H82A 1K7CA 1DJLA 1RKVA 4XX1A 4GEGA 5C80A 4JKIA 4JZYA 2EWWA 2Y6UA 2XHEA 1QOPB 1XXHB 1YA4A 2V5VA 3HPRA 1AG9A 3JY6A 1R15A 2RIPA 3PDUA 4EHHA 2FZLA 4AN0A 4U39A 2PZFA 3FYDA 3GEBA 4Q1BA 1F1BA 3VR3A 4B4UA 1YZTA 1H2FA 4COOA 4D9JA 4E12A 3TUIC 3COVA 4MW0A 4KOEC 3H19A 5AI4A 4D8WA 4M9XA 4QREA 2FY8A 2IEGA 3V3TA 4A10A 1HLPA 1Z25A 3A11A 1UBUS 3ABZA 5ANRB 3S40A 1RQ2A 2HK6A 4HD8A 4B3DA 1V1RA 1S8OA 2JCSA 3DBLA 3PKIA 3HDJA 2W7TA 1GY8A 2HDOA 3TQSA 4EW6A 2OGTA 2OOSA 5FTNA 1XMQB 1XZNA 4EHNA 4F3YA 5JS6A 1U8XX 4KGZA 2DPXA 2H18A 3P2KA 3G6KA 4KO1S 4Q48A 4AY6A 1LF0A 1NHGA 1SOWA 4LBZA 3L18A 3QPCA 1HH4A 2E21A 3HKEA 1YL7A 3VU1A 3SICE 3ZHCA 4DC0A 1V16B 3GLUA 2KI5A 3QOWA 4H31A 4M0UA 2KBEA 1F38A 3EH2A 1I2ZA 5AVRA 3U44B 1KZ1A 1YVRA 2W8BA 3FDJA 4GNKA 4IV0A 3ZVMA 1U8YA 3NAZA 3Q7SA 3VJLA 3VH2A 4RHCA 1G1MA 2LKCA 4LGCA 3V6MA 3O92A 1DC4A 3AJEA 1QAOA 4IBOA 4RMHA 1I24A 1P8AA 1NQAO 2H2FA 3CRQA 1UF9A 3NNDA 5K1ZA 1JILA 2VHUA 2WIAA 4QGSA 2G76A 3LX5A 2VAPA 5HTKA 1E0SA 1HY3A 2J5QA 2O1WA 4QYXA 4WY5A 4AJEA 4BLSA 5K8JB 4REQA 2QLBA 3E5NA 1P5ZB 4UMVA 3AX6A 2ST1A 4JU9A 4UD2A 4X7MA 1TAHA 4D26A 2GSDA 2XV1A 2B0CA 4RXTA 4R7TA 1L5KA 5AI0A 4KIWA 4F71A 3COSA 3JZFA 4XDGA 5G53C 3TFQA 7ADHA 2VNKA 3QQ5A 3U56A 2XUIA 1JR6A 3KFVA 5ULLA 1MRSA 4ZODA 1Z18A 2WNHA 1H2YA 4BJHB 4YCJA 1N0WA 4QHTA 1Z2EA 1Y4SA 2GHIA 3HCFA 2YWFA 4Y8VA 5AM4A 1YJCA 2H3HA 2W2LD 2I4LA 4K9MA 4TSFA 2NU8B 5TLSA 3QQPA 1UP6A 4MGKR 4QQNA 4L75A 1FB5A 4MS3B 4HNTA 1Q6YA 1AO3A 2Q0QA 5AJWA 3F96A 1DU4A 1RYNA 3LVQE 4BJ1A 3HZZA 1H66A 3VSCA 1Z5ZA 5DV9A 1JQ3A 2QTVB 4YV7A 2WNSA 1SIWA 3EAGA 3WQSB 3R7BA 4EZBA 2OCLA 4G86A 4IIVA 3WIVA 1TUGA 4DW8A 3D3QA 3LA8A 3RD5A 4HDOB 4MRSA 3JV7A 3GV0A 4WA7A 3DW1X 1DC3A 4XYGA 3PFBA 3FF1A 3H3JA 1JPJA 4Q47A 3QHAA 3WL3A 3NDJA 5HS6A 4G26A 2JGRA 2WUDA 1WETA 1W46A 1LI7A 4BVLA 4RORA 3NEJA 2I7VA 2YOGA 3L84A 3OU6A 4M0PA 3ZDQA 2MINB 5F3WB 2Q41A 3R0XA 5TMDA 1V4BA 2YXBA 2O8NA 4P0QB 2F1JA 4J9UE 1SRQA 4N6NA 3RBXA 3WGOA 2FW0A 4KGXA 5A5EA 5KVAA 1QH9A 1OLSA 2AMFA 2AQ8A 5SY9A 1BJRE 3I01A 1C0KA 4MUMA 3JQEA 3K9NA 1IWOA 2EBUA 1DWUA 1SVUA 1QKKA 3UJ9A 3RW9A 3LZCA 1VKRA 3EG9B 4OJTA 3SF8B 4ND1A 5B37A 5KKCA 1TLTA 3L93A 1PWHA 4UKDA 3SU8A 3OQVA 2ZS9A 1N8NA 3C3DA 1YDEA 1MH9A 2C7QA 3RHSA 4M3NA 4QAJA 1KAGA 1ZK3A 2A0UA 2C7GA 5TNXA 3SZMA 4DV6B 1J0BA 3CEHA 4MCIA 4OSOA 3AEKB 4CNBA 1YS6A 3KR1A 2I3ZA 5EZYB 4HDNA 1UK8A 5HG0A 2Q4RA 3Q85A 3O8QB 4Q4JA 3AVWA 3NGLA 1XHLA 4IDNA 5B1YA 4G36A 4L27A 4RLSA 2WM9B 1ISFA 3DZIA 1EFVA 2R5NA 4F3KA 4C0LA 4A8JB 3EYAA 4XKJA 2C88A 3PQDA 3ESBA 1Y63A 2ZANA 5H9WA 3QTLA 4YREA 4DANA 4JQCA 1DIHA 3LHSA 3PQ8A 3IQWA 4ZMBA 1YH3A 5DO9A 1RHMA 4HDCA 2X7XA 3ISVA 3M4XA 4H9GA 1P31A 4PO3X 1IJFA 2SCUB 2OOKA 1ETUA 3DL0A 5IKXA 5A5VA 4FQ7A 2EZUA 3L0SA 1NF8A 5MN4A 2L0XA 3PCTA 2BGTA 2JIQA 4O2AB 4TKUB 3H2YA 1PGJA 2QRNA 2K2WA 3CWZA 3IBFA 3OOEA 4YP0A 2VR1A 3W6PA 5K0GA 3DDWA 3CRW1 1IIRA 5CB0A 3FFWA 4B33A 1Z37A 2Q9AA 4LZJA 4PZZA 1K8QA 5JJIA 2IS2A 4RD4A 4ALIA 3SE0A 1BS1A 4CDRA 3T1VA 2ZVJA 3GEEA 2P5UA 3FPFA 3AOEC 1S2NA 3L5KA 3R6GA 2Y4OA 2IFTA 3AEUB 4ND6A 4EGSA 4ZKDA 4D3DA 3A7DA 2PS1A 3NM5A 3GLGE 4RCZA 1HQYE 2PT7A 1PZMA 3Q88A 3INYA 5JY6A 1WV1A 3H8WA 1ZXLA 3N2NA 3PNYA 3PE3A 4J7UA 1XQYA 3MTIA 1E2UA 2WD7A 4MCJA 1QV6A 1SIUA 4IF6A 4IH4A 1ZRNA 1D2EA 1TF2A 2C5BA 2Y67A 1ZLYA 4LE1A 5DW0A 1XQVA 3OFKA 3W5VA 3QYAA 4EY8A 1ZBDA 3LCCA 5EXXA 1AHNA 2BGIA 1O5OA 4YLYA 1X80B 3UUWA 1D0IA 2PX6A 4TX1A 3BS4A 1KVRA 3S2EA 2VH5R 3Q1KA 4JYCA 4HQFA 3SIRA 4MQEA 3T6KA 2FDXA 3FNGA 3VU9A 4JODA 2QRUA 1Q11A 2FZWA 1O9BA 3P2EA 4UFOA 4F8JA 3D6JA 1PT7A 2RGEA 3IEUA 4O8ZA 4R1TA 4EHJA 4CEJA 1FYVA 4C4YA 4GGOA 2PS9A 4DEXA 1OWPA 1WUJS 1SVNA 4B8WA 3PTAA 2KBFA 1JWBB 4UM8B 5T7BA 2OZLA 1RI2A 2X2PA 2IIBA 3V7WA 2CLEB 2Y9PB 3QPUA 4LAFA 4DQUA 4QU5A 2IY9A 4PR3A 4XASA 4QJBA 5JO9A 1V1RB 1C50A 5CT6A 1SOAA 1ECJA 1JQ5A 4V0MA 1EA5A 4LXTA 5ENVA 5CIQA 2VCEA 2OQIA 3ASVA 4C7VA 1D4ZA 3E8MA 2MDTA 5ALGA 3PI6A 1DKMA 3SJZA 4K9DA 1QRDA 5G2OA 3KXPA 4I1IA 3ZXXA 3FYUB 4G56A 3FFTA 4GYKA 3RU2A 3DOJA 1YS4A 4QE3A 3P9QA 3BK2A 4MV7A 1Z13A 4NV3A 3K0FA 1E96A 1RQNA 3BGDA 1MO3A 4JBWA 4JI6B 1ABEA 2OCPA 4WFKA 1L6IA 3L6RA 3NOVA 3RTAA 4EGAA 4QNMA 5AESA 4A73A 4ZGWA 2GVNA 5FUMA 1CEEA 3AR9A 3R41A 3O31A 1DBWA 2LP4Y 1S01A 5CA1B 2H5EA 3TOCA 3KVVA 5EINA 4YFYA 1UBHS 5L45A 2CSUA 1NPDA 4G0OA 1YE3A 2H2AA 1K3UB 3P97A 5J63A 2A0YA 3T5MA 4YRSA 4RSGA 4GICA 4Q7QA 4I1PA 3F5SA 2C96A 5HJEA 1VPEA 1QCZA 3I58A 2YY5A 3JALB 4WEOA 1OPXA 3BE8A 1NZJA 4BFXA 4G5HA 4J0IA 4J2HA 4RY2A 1BXGB 2W83A 4BMSA 1IN4A 1QJCA 3T5GA 3C1UA 5K0ZA 2BI7A 3CZRA 3O4GA 1TM5E 1V2HE 3MTJA 4FOTA 1LI4A 1H65A 1XLWA 3IURA 1DKRA 2P0YA 4JA2A 4O3FA 5AVSA 3TLYA 5IARA 3LQQA 4LUCA 2YIMA 3NHWA 1KRWA 2QJOA 3WHLA 3UBMA 4DCPA 3DDNA 2E87A 2XMDA 2YHUA 1XCBA 3OICA 5AVZA 3UJPA 4FS3A 1V8FA 1RXSA 2GJ4A 4H7FA 1DCMA 1GEEA 3CUKA 3LQYA 2A3RA 4M53A 5KNBH 4FZVA 4MULA 4FSDA 3TQCA 2Y27A 1ZM3A 2ZDHA 4KYIB 3MJEA 1YKFA 4C4TA 2I2AA 4LJ5A 3EXIA 4QWMA 4L9WA 1TZJA 2P9YA 2ZE8A 4R05A 2BEWB 3QF7A 2RARA 3U4QB 4OGWA 1KDPA 3TLAA 1AOXA 1ENYA 4M38A 3G9TA 4HNVA 1KAEA 4BU1A 2CZQA 1Y6FA 5L3ZA 1XV5A 3JS5A 1T4MA 5T4HA 4L8LA 1GN8A 1TX4B 3VO9A 2JI6A 5HJ2A 3WGZA 3GEDA 1TJ4A 2ZSAA 3EF3A 1TVKA 4MDYA 5IHPA 2ROQA 1XVIA 1CQPA 3K8ZA 2J6IA 4FFPA 1DPFA 1JAXA 4INPA 3D2BA 2JHFA 1D1TA 5EY5B 1Z39A 5EMLA 1H0SA 4PRKA 4S1OA 3DHWC 1K08A 1E1CB 1RE1A 4KK3A 3S99A 2PLAA 4F8YA 5J4KA 4YPFA 3GRAA 3VDMA 1EJ0A 2NZWA 1DBSA 1PSWA 3ZE9A 3D0RA 4MRNA 3AVPA 2HB6A 2CVQA 1VB5A 1PR1A 5IT9A 2NSJA 5CX1A 1KAHA 1X7YB 5BOSA 4JNCA 4OCZA 5LWHA 2WA2A 1O8BA 1RYEA 2R00C 3K5IA 4EY7A 4WESB 4YCDA 1U81A 3WK7A 2WYVA 4MPPA 2OK8A 2IHBA 3Q11A 5FBKA 1YGYA 3F90A 5E8JA 2D2IA 4MQMA 3OM8A 3W7AA 4ZEVA 4LF5B 2GEDA 3UJHA 1QC5A 4R2MA 4ZVQA 3WKCA 5JNWA 1C9JA 3CLUD 4DJEC 4CF7A 5HHTA 4AIIA 3A28A 4Y0AA 5CGZA 1L4EA 1O3YA 2LTAA 4WD3A 3CVJA 1J6UA 4JJ6A 1ZK0A 2XTJA 2QLNA 5JSHA 2FF7A 5JG7A 5IC5A 5ESRA 5AI8A 3DHVA 4GLOA 1KI4A 3SEQA 4V0ME 5FWAA 5JFTA 1UFOA 2DWQA 4MINA 3J7TA 3KV1A 4YNBA 3L04A 4AUKA 1G38A 3FRIA 3U5ZB 1XTUA 4EJSA 2GHQA 4RXMA 5FUQA 3ZCVA 3PKZA 4DCOA 3CMMA 3WP0A 4M1ZA 4MQLA 4MR7B 1ZUWA 1YR9A 3RJMA 3K0SA 2IYXA 2FMFA 1S5PA 5T4EA 2ZBQA 4Z51A 4WOKA 4CKEA 4Q00A 1DAMA 5CM8B 2L19A 2JEOA 1M1NA 2ZS8A 4Y2UA 4Z9YA 3JVIA 4BNJA 3R9IA 5ARBA 4NOKA 3EPKA 1RBZA 3TNFA 1C9NA 1NNSA 2XMPA 3RBAA 4UHHA 3W2IA 4RHTA 5IKEA 1HT0A 4MGEA 1IN8A 3FWYA 3C1TA 3U3DA 2Z5FA 2AX4A 1SEPA 2H92A 5IKPA 5LPNA 2C2ZA 3UMBA 1KEVA 1TE2A 2KW5A 3K05A 3WA7A 4I50B 2QRVB 4CTNA 4I99A 1ONSA 4JVOA 1Z0UA 1Q1AA 1M66A 4KFSA 2BBOA 3V8PA 1NBHA 3CX3A 1GZ3A 1I01A 1UP4A 3K1AB 4YO7A 3KTAA 1Y80A 2Q21A 3L92A 4GBMA 3D7LA 4BYGA 1XLUA 1CY8A 3USZA 4QPZA 4Q1FA 3IDOA 3R6DA 2ECQA 5AW9A 1L5NA 5J2TA 4C0KA 1TGYA 1YOBA 2MHCA 1KHHA 4C04A 4PLVA 1NC1A 3CLUC 3ZU3A 4BGIA 1DLJA 2BAGA 1XRJA 1TFUA 2WI8A 2GJ8A 3EIEA 4PSAA 3GBVA 3MRVA 3T5DA 1BHQ1 1POWA 2PLRA 3C3PA 5CAEB 2I1QA 4J2OA 3TQIA 3AJ8A 3X1YA 4UFPA 4CI9A 4M1TA 4Z4FA 1XLTC 4E2FA 1M0TA 2GBGA 3EA4A 3JZMA 2FPPA 2WUEA 4ZCPA 4KR7A 3AP3A 4ZIRB 3SZ3A 4YCMA 1Q19A 3GLFA 3TCXB 5J58A 4GBED 3NHBA 4HDKB 2OBXA 3V4PB 4AVYA 3U3OA 4KAJA 5I8WA 3DOIA 1VRVA 1F2VA 1XU4A 5AIAA 5ALZA 4N5HX 3UFXA 1MDFA 1OXXK 2ZBRA 4II3A 4KE6A 2H4JA 5TC4A 2I7CA 1EWTA 3AY7A 2ETVA 3SE7A 5JBQA 4BKOA 1OJ7A 1X8XA 4FFDA 2JK0A 1T3LA 4ZYZA 3RVPA 2I6FA 1JKFA 2L82A 5IAJA 1SK9A 1JE1A 1QK4A 3N8IA 5MDHA 1GNQA 1YQWA 2MSWA 5D5PA 4WKNA 5BUZA 4U5XA 3PC7A 5ITZB 1EK6A 4JJ8A 1RC8A 1EMDA 4XJSA 1KQGA 4FUQA 3K0CA 4PXYA 3SF8A 4JI5B 1B41A 1ZIYA 1JLMA 2PGXA 1BMFA 1EP1B 2TMDA 1DAGA 3C8HA 3ICOA 3QU5A 3R4CA 2OYRA 1K6MA 1YASA 3A4TA 3HM2A 3GGDA 1KWGA 1GPYA 2Q1UA 3FTCA 3G5LA 4B7AA 3EIOA 5JATA 1I3NA 2ZPTX 5FHQA 1V41E 2CJXA 4N3CA 4OHKA 4TT3D 3TDKA 3WMEA 5J2UA 2B3TA 4BO3A 1QKJA 3VPFA 2VBIA 4ZEWA 5BNIA 1HDIA 1TUBB 2GN4A 3DKPA 3M6FA 5F12A 4LQDA 4KQHA 3JATA 4U3JB 1HT1E 1U7TA 3D54D 2Y1FA 3LV8A 3V4SA 3R7AA 4IDPA 2FUG6 1TXGA 2REQB 4TS3A 5C3MA 2AFHA 2TS1A 4XFKA 4K6GA 4YQZA 1FOEB 3CO5A 2JLUA 1BWQA 1WCYA 3LX4A 3OQNA 4Q03A 2GPSA 3H2BA 3OE5A 1POXA 2F8SA 1JU3A 1BCSA 1NQWA 3ITKA 3K0AB 2NO9A 3QXSA 4MR8A 3T4UA 4GOOD 1YAJA 3TE7A 1ZNXA 3D8TA 3OJCA 4P1ZA 1JZSA 3OCUA 4R8LA 3UPTA 3HI6A 1Y1PA 3UXYA 1WJGA 2J3JA 3DLPX 4NEQA 4TVOA 1B16A 2ONCA 4W5TA 1HNWB 1UC9A 2MR6A 1E7QA 1H0RA 1ZVJA 3KJXA 3H5IA 4NF2A 4F84A 3IEIA 3KXIA 3RVSA 4C30A 3WYEA 1GG9A 2WSLA 1J90A 1U5AA 3QKRB 1E3JA 2IOYA 1VMIA 5C18A 4KH1A 5C1DA 4CR8A 3TD9A 3ABIA 5CT8A 4LSMA 5J9FA 1DEOA 3A9TA 5FAXA 5K6RA 4N7BA 2DPGA 5EZ6B 4NOLA 1I4OA 2W6JD 3QXCA 5TPZA 3UFBA 4H6WA 3STXA 5ESWA 3Q9UA 2AQIA 1DRVA 3GQBB 1RYMA 3UGKA 1NFRA 4EYKA 4Y2RA 4TMKA 4KWIA 5B2FA 2PJUA 3QBJA 1O4VA 2NQ2C 3RC9A 1WQ1R 2VT6A 1PL0A 4W5JA 4YBRA 2E7ZA 2C99A 4E03A 1W30A 1XE3A 4CMCA 1W0KA 2ONKA 5DWQA 4CN9A 1G6HA 2BN4A 1EPUA 3T7EA 5FOTA 4WA8A 4HX5A 1RACA 1T9BA 1XCJA 3RUHA 4AC9A 1GD1O 3G2JA 5G0TA 4MVJE 3DDOA 1M8JA 2KLHA 1J99A 3L77A 5HZMA 1GPKA 1YI0A 4OUDA 1XPOA 1JEQB 2AC7A 4BVHA 1QH8B 3AEKA 3KUCA 3M3HA 3KYIB 4B47A 3X1DA 4F46A 3LUFA 1XZ8A 4ZU6X 4Q6WA 4KP7A 3GD5A 2ZTUA 2PWAA 2Q6VA 4X95A 4RJKA 1BW9A 3RRFA 1YQXA 1P44A 2OUKA 3EXHB 3R77A 6CHYA 3ERCA 1Z6ZA 4NH4A 4CMIA 4QELA 4FXOA 2GN6A 2XUHA 3BRCA 3HYTA 3PQ5A 2PKYX 4KFCA 2HRCA 5JH7A 4HWOA 5DNWA 4HO1X 5CIWA 4F6LA 2AZ4A 5EL0A 3QGMA 4CDMA 1E0AA 5FBRB 1WHSB 2P7IA 3NYRA 1NW5A 5EXEA 5H81A 3AL0C 4YTEA 4A6EA 4HUQB 5AVOA 1U65A 2VWPA 5CA1A 3FZGA 1YQ9A 4IG9A 5GM2A 3GLKA 4P3XA 4R2IA 5I9TA 1T1GA 1QAMA 4ZT6A 1DARA 2GNPA 4FJ1A 2PD4A 4LBVA 2GBLA 4MHOA 5J2TF 1B8UA 3RTBA 4DCJA 4CXMA 1W36C 4RY0A 4PN7A 3CJRA 3DHEA 1WMEA 3QUCA 4FFSA 4QM6A 1C0LA 4MDHA 2B99A 1VRWA 4G4IA 4AZ0B 5GOTA 2OQRA 2QPTA 2OBNA 2XOKD 3AO0B 3WADA 1IEWA 2CVFA 2GEVA 1A76A 2CY0A 4PYRA 5AP9A 2AF4C 3X43A 1ZISA 4YQFA 3CR7A 1ISGA 3HN7A 5FKJA 3QIAA 4QBKA 1I3LA 1Y8QB 1MOPA 5CB4B 2LR0A 4OHFA 4CPDA 1KL7A 1Q1GA 3VR6H 1I1OA 2IDJA 3EOBI 5KNCH 5KHOC 2DMRA 3LWDA 4U2DA 5DXFA 4OK5A 3ROTA 4ARUA 3ZY5A 5K5EA 1P1FA 1ZC3A 3DAGA 2QJTA 5JE8A 5EWLB 3IT1A 5IYZB 2CNNA 1A5ZA 3GJ7A 3HY3A 4OXNA 4PEVA 1K86A 1OAOA 2D1YA 2N46A 2ZYTX 1TU0A 3BMXA 1VL0A 3NJ4A 4G3XA 4JJEA 3NIWA 4Z2YA 4RTQA 1Y82A 3B1WA 3MIIA 3K0BA 1UBLS 3WO0A 4E5VA 2QTBA 5T67A 4NBVA 2JAXA 2P40A 1KOLA 4HDKA 1Y7TA 3OLWA 4X6UA 1KIAA 4RM2A 4WXMA 5EAIA 3DC2A 2C3UA 3PQ4A 5EHGA 2HU7A 3AFGA 2FMUA 3FHOA 2VJKA 4GOMD 4QTXA 1TRHA 2YV2A 4DJ5X 3GUUA 2CKDA 2Y1XA 2AJTA 5EFOA 2BM0A 4JR0A 1ZC4A 4Y0NA 1YC2A 4BNVA 1ATZA 1PUIA 3BREA 3GVPA 1NXVA 2ZB7A 3PUIA 3R3ZA 1MC5A 2EJVA 2I03A 1SCQA 3RAEC 3HU1A 5H59A 3GDWA 2GLTA 2IODA 4RSRA 2RKOA 4MHTA 4ZDWA 2RFLA 4DA9A 4AZTA 1QYCA 4FT4A 1T3HA 3LQ1A 1Q12A 3TTUA 2FQWA 4DC9A 1W4BA 1WP9A 2QEQA 4U7TB 4XB1A 1ZHOA 2ZT6A 5TEWA 1V16A 3F2IA 2WDZA 2LE0A 3IIIA 3U3ZA 2QTGA 2VDPB 3CCFA 4PO1A 1II8A 2VN8A 3VSBA 1OYOA 4V39A 4ALMA 5KZMB 4DR7B 5L3QA 2SKEA 2WD9A 1R0YA 3CRVA 3D1VA 1XYGA 2WHQA 3BDVA 4IGFA 4P5PA 2ZCUA 2EKQA 5DPMA 2P6UA 1UBMS 4BGDA 4H4CA 4PZLA 4H7IA 5AW0A 4K9LA 4L57A 3COZA 2D2EA 3A70A 3PFNA 1YI1A 3GZJA 4L8GA 5LQCA 2B2CA 2ZXEA 3DT6A 4FTWA 2ZJBA 3QWFA 1GR1A 4PONA 4QX6A 3TZQA 1E20A 1HYQA 5EJFA 1TO1E 2FNAA 4UD6A 1KZ6A 2ACKA 2IUYA 1PE0A 2R6GA 2ZYWX 4DQDA 4P2BA 1NSYA 1FYXA 1OZAA 3UY4A 4LF6B 4DAEA 2GPBA 1RXVA 1J1UA 1EZ1A 2L69A 3BFKA 4ALJA 3L8DA 4ZJUA 3UXHA 1B6SA 4JLOA 5LQDA 4MUKA 3I2KA 1GDTA 5EGNA 1P4SA 2EKPA 2WKPA 5HOQA 1H5NA 2JI7A 3WSTA 4DSTA 4KRYA 3KQUA 2C9OA 1HYGA 2IHTA 2X4GA 5E1MA 3GMTA 1FFDA 2IPOA 3AFHA 2E5LB 4AKIA 1CB7A 2R4UA 3V2GA 2VTVA 2Y76A 1OFTA 1NHWA 1YZUA 1XDUA 3OD1A 4GGMX 4OXQA 1ODKA 3TSCA 3V8NA 3DEYX 4HKTA 2WE7A 4PBTA 1OKKA 2BFBA 4BUJA 5FL7A 3PEVA 3P9SA 3V4VB 3T99A 3ZHOA 4UPEA 1EUQA 1QONA 3GH1A 3H9QA 3DTYA 2YYAA 1AA9A 1J8YF 2CMHA 4O29A 2ILTA 4P6VF 4YDSA 2GFHA 2HTFA 3AC0A 4ALNA 4DMMA 1EFCA 5KVCA 5L3QB 4RTOA 1A9SA 4B2YA 1TYCA 2HO4A 2VJAA 1B42A 1RMQA 3KKEA 4MYDA 4OLFA 4JYZA 5EWMA 1L9KA 3KEFA 1PQUA 2OZPA 3ZIAD 4CEHA 4R1UA 5KMGB 5TVKA 2QTCA 2XNKA 3OIVA 1UKVY 3I6ZA 4K05A 2LIVA 4ZOCA 3UT5B 1E61A 3W4KA 4XLZA 1JIUA 1OAOC 1F20A 1RM3A 3ZWCA 4RJTA 5ALDA 5BN4A 1JVNA 3SIWA 1E3MA 3QFFA 3VOSA 4WXYB 3ZXSA 3NUZA 5I4KA 3MUOA 3WL6A 4GVLA 1NUUA 1V1MB 1JG3A 2O5RA 3FBGA 2D3WA 2GTHA 4O2LA 5LDHA 1GPJA 4ZCMA 2V74B 2EWMA 4HDQB 4L2IB 2Q5CA 3O2QB 1U7UA 4YIHA 5T6MA 1MZVA 4D3SA 4IICA 1R88A 1U5BA 2AMJA 3LPLA 2PBLA 4XYMA 5AOAA 2JFOA 2JD1A 5EP4A 3G7UA 3PQFA 2W9XA 3K73O 5CT5A 1AIPA 5JWHA 5C34B 1E58A 4JV5B 3WLMA 3GNLA 4NBTA 3BK7A 4KUHA 1OI7A 3OZVA 4D0RA 1JJBA 3B82A 4Q4HB 3QF4A 2B1RA 3EW7A 2I55A 3CKLA 2IKSA 3QG1A 4BLRA 4O5OA 3ZXUB 4EFKA 2CLSA 4C9BA 2ZRNA 1E3QA 1UMDA 2RB4A 3KDPA 2F3UA 5K45A 3SXJA 4H0FA 1U2DA 4YROA 3OO1A 1TZMA 1UQUA 3LFHA 2QDKA 4IXNA 1FUUA 1HQCA 2WVHA 2E1RA 1JHXA 3EUAA 2VCHA 4RO0A 3S2FA 1KAOA 4Z7NB 3O75A 5E0KB 2VSXA 1LBHA 2ZJ0A 2QTNA 3OCXA 2BH2A 4MYTA 1XJCA 1LS1A 4ZDKA 1X7XA 3ASUA 4LJ4A 3ECSA 4GMHA 2O54A 2XF2A 4KE9A 4K86A 2AOTA 5GZ1A 3FCUB 3HCEA 2OV8A 1D8AA 3LIIA 2VWGA 3PQEA 1T8RA 4FYXA 3OU7A 4A6PA 2O3RA 3I2YX 4TGLA 3DYVA 3USES 2CUTA 3BD7A 4HNGA 3SQLA 2VYVA 1ILEA 2WK1A 4EO9A 4TQGA 5AVVA 3QFSA 1NMYA 5FWYB 4BX9A 4RAOA 4DNOA 5KNCA 1LZLA 2QP4A 4N1AA 4QARA 5HA5A 1XCPA 1OA0A 4R1OA 5COQA 3UV7A 5L3SA 2JW5A 3QEBZ 4CFZA 1A7AA 3P2JA 1JJIA 2YXDA 4A8PA 4DUPA 2BIFA 3V8BA 4PSUA 5JJCA 5KYTA 4XDYA 4BE7B 5M7EA 1FFGA 3B78A 4JUFA 4YMIA 3AHGA 3G7NA 4JC0A 3VPHA 4C20A 4DRXB 5HFNA 5JD5A 4CKBA 3EXHA 5FO1A 3B52X 4EG1A 1GA1A 1OLUB 2X3FA 1YFKA 1MB2A 3DW3X 3NFYA 1E62A 3HYCA 1Z4JA 4OJNA 3QTBA 1LDBA 5GVRA 1NQVA 3EEIA 3LPAA 1UMDB 5E7IA 2J6BA 2ZDQA 3REFA 2H1VA 1CBUA 5KDLA 3HWX1 1S02A 4KODA 1HMYA 2ODNA 4J4TA 3T0FA 3UJ7A 2XUKA 5EP2A 2H8KA 5BUSA 2XWQA 4FBMA 3ZX4A 4DDKA