2ZVQX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and alpha-naphthol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 106
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvqX00
2VHTA 2JJ1D 2WIBA 4W9MC 2XXAB 3Q9LA 2O8DA 4C2TA 2WJIA 4X8LA 3E2IA 4HLUC 4RJLA 4E03A 1SKQA 2YZ2A 3WHKA 2QTHA 3S1AA 3KQUA 1AM4D 1D2EA 3U7FB 2XNDD 3U6BA 3P4XA 5C2JB 1ZC3A 3T1OA 1EK0A 1KO1A 1XEWY 1M74A 4V0LA 5DHAA 1JXOA 1GAJA 2RMKA 4D4JA 4R2HA 5DLQC 4DIEA 2FGJA 1XBTA 621PA 2JJ8A 1W36B 4DLVA 1CJVC 2YKGA 4MRNA 3FHOA 5A0FA 3T1TA 3CBQA 4M1MA 1P5ZB 4A0FA 4LPSA 4QGAA 1LS6A 4NCKA 3MJHA 2WSSD 4YMSA 4C3ZA 3IEVA 4JT2A 3KTAB 2QTVB 1G8YA 1T4GA 1G5PA 3ZVRA 3NHBA 5BXQC 3GFPA 4G5SA 1XCMA 1NP6A 1FP6A 3AVOA 4JLMA 3NH9A 4ZDWA 4F91B 3KX2A 1XTRA 1JJVA 221PA 4Q1DA 2P6RA 3CRQA 3T1VA 3PEWA 3EIHA 4BLSA 3FYHA 1Q3TA 2W00A 5KPDA 4PQYA 4RFVA 3FOZA 2UKDA 1HQCA 3T1QA 2O8FA 2Y8EA 2G1JA 1ESNA 5HCNA 4YXWA 1P2UA 3BWDD 4OBEA 1ZIPA 1T5IA 1X3SA 1QF9A 2D3WA 3GD7A 3GJ7A 4I1UA 4JYBA 4JLOA 2PH1A 3KKPA 3B82A 2FEOA 1U9IC 2IXFA 3IHLA 4EPWA 2X19A 5E4FA 4JLVA 1DO0A 1EG7A 1CR1A 4D26A 2CHQA 5L3RA 5TARA 1FL9A 2AD5A 2ZRGA 1VDZA 3RS2A 5FBRB 5FI0B 2GXAA 4FMBB 4Q1CA 1GKYA 4ZDIA 1R8QA 2IUSA 4G1UC 3VU9B 1LNZA 4GMXA 2V6JA 2O5VA 3AKYA 1QZXA 4HDCA 4C9BA 5SZKB 1L4UA 1NN5A 4BLOA 1C9KA 1TX4B 3A36A 4RZUA 2H5EA 2R44A 4TSFA 4C0SA 2F55A 2QAGC 5L3QA 1HQYE 1X8JA 4CRWB 5JS8A 2CLDX 2B92A 3A4MA 2W58A 3EC1A 1F2TA 4Q21A 4QGFA 2HEIA 1NKTA 2GJ8A 1KJWA 3EZ6A 5B2ZA 4R2IA 1Q12A 3WHLA 1ODFA 2ZI6A 3D31A 4DUGA 4Q4AB 2ZU6A 5E7MA 2JJ2A 3BAFA 1NRJB 2FH5B 4QJ3A 2IBMA 3ZJYA 1TTTA 1SVMA 1NLFA 4LJ7A 4HDOB 2W6IA 3RRZA 2RGEA 5K8IA 5FOVA 4FMDF 421PA 3K9LA 1KDRA 1D6JA 4TYQA 3KKQA 1E2KA 1Z22A 5JJIA 1G7CA 1CJUC 1VTKA 2A5YB 3DEFA 3I72A 1Z6TA 2UZ3A 4QBIA 2O8CA 1UBGA 2W2VA 3CNNA 3A1VA 4IXNA 1R8SA 4A2PA 2ZXUA 2XGJA 2GHIA 3OIUA 3TR0A 2QG6A 1PUIA 4W5JA 1OH7A 3Q3JB 4US0R 4BASA 1QG4A 1NLZA 5IRCD 2JLXA 2PEZA 3GFTA 3ZDQA 1SXJA 4PSVA 4OHZA 3GFOA 2R6AA 5BN5A 5JZVA 4QNRA 1GL7A 1COWD 3VR1A 1BOFA 1CJMA 3GLGA 4LY6A 4PPGA 1DAEA 3CNOA 2EFEB 5FBLB 1A2KC 4LRWA 1G20E 1YR7A 4UXHA 4D80A 2UZIR 4MUBA 2WJYA 1KY3A 3CPHA 1XCPA 3A4LA 3B6EA 1Z06A 1I4DD 3H84A 1KJYA 3EWAA 4KU4A 2QP9X 1R0WA 1M7GA 2B8WA 4KVAA 1W0JA 2CJWA 1Z8FA 4TMXA 4Z8XA 2A3RA 3H86A 1N5KA 4IW3B 1AKYA 2JLSA 3LH5A 4X8MA 3RWMB 2EFHB 4MGYR 4Z8YA 4B6FA 1IJFA 1P62B 5AR1A 4AKHA 3IBYA 3AP2A 2ZYWX 5JJKA 4OI2A 2QMOA 1FX0B 3RC8A 5JBQA 4BFTA 2GA8A 2ZS8A 1AS0A 4L9WA 5F9HA 3RDPA 4JVSB 2ZRIA 3PG5A 5LPNA 3LY5A 1AQYA 4OJQA 3F8TA 2WOOA 2MMGA 4D2IA 1SXJB 4C0AC 3OIWA 2H92A 3LAWA 3N5CA 1LF5A 1VIYA 1VPLA 3IO5A 4DZZA 4CW7A 1FNNA 2XB4A 4LJ9A 2QGNA 4TTPA 4LBYA 4P33A 1JEEA 1FW6A 5BN4A 1DS6A 3L82B 1NSTA 3QBTA 4DT1A 4S35A 4JLJA 2QQEA 2GKSA 1E94E 2OHFA 2REBA 1OF1A 1CIPA 1IN6A 3SI7A 3LV8A 1XRJA 2IS4A 4P32A 5J5CA 2N42A 3TNFA 2BKEA 3R7WA 2QL6A 2DR3A 1UM8A 3BFKA 3KJEA 2IYWA 3VHLB 4AY2A 3PXGA 2C95A 4OHYA 3HYTA 1SULA 2W83A 5KNBA 3SE0A 5EE3A 1OIWA 1LF0A 4OK5A 3SC3A 3MD0A 2Q3FA 3RRMA 1W47A 3WYGA 1KDOA 4L8GA 2GZDA 4OYHA 3EW9A 3P26A 4EUNA 2OG2A 4DB4A 2GXSA 2VHUA 3N2IA 4A0GA 1NG9A 2FSGA 4JL5A 1G5TA 2ONJA 3RS4A 1YZLA 1P72A 5FBQB 4QNMA 2QORA 5F2EA 1NJGA 2DY1A 3U3RA 3UANA 1K6MA 3WY9A 2IHYA 4RZXA 2W2TA 1AK2A 1LY1A 3DZ8A 1OYWA 2HXSA 2JA1A 4C7OB 5P21A 1P2VA 5TB5A 2QPOA 2FX3A 5LB4A 2HCJB 5F98A 3VNVA 1RKBA 1KNXA 1QBKC 4A92A 3K9GA 2A78A 1E2HA 1YRBA 3KKMA 5G41A 3SHWA 4JYCA 3ADCA 4LUCA 3MJRA 1K8RA 4GZLA 4YMUA 5AWFC 4KITB 1S0UA 2CK3D 3TVDA 2O8EB 1CR0A 2ZI7A 2FPKA 1Z28A 2I4IA 4OJKA 5EP2A 2X8AA 3W34A 4LHVA 4B3BA 1VECA 4OHWA 1W49A 4L4UA 4PHFA 4Y0VA 3PFIA 1VG1A 3C8UA 1KIMA 1JR3D 2IYXA 4TTQA 6Q21A 1N5JA 1VHTA 3JVVA 1N6NA 4C7OA 3HP1A 3LBNA 1DOAA 4YMVA 4POAA 1XNJA 2GVDC 3FKSA 4IOLA 2G6BA 2EQBA 1E9SA 1BS1A 1DVRA 5E3HA 1GG2A 2O8FB 1OFTA 1CS4C 3TSZA 2WM9B 3ZYCA 4FWTA 3ZGXA 1NVVQ 3T5GA 1DPFA 3I92A 5FBWB 4F4IA 4C0KA 5KSYA 3R9IA 4LV5B 5EXXA 4ZPXA 4AURA 3AVXA 4KLZA 2ODEA 5EE9A 1MOZA 3ZZUA 2ZRKA 1M7HA 1SGWA 2RGNA 2P5TB 3FMIA 3W8NA 2WKRA 5E7JA 1W2HA 5EP3A 4HEJA 2QMHA 4TYPA 2OFXA 5H1YA 4M1WA 3AVWA 4BLQA 2GBLC 4Q1FA 1E0KA 4HLUA 3PR1A 2VEDA 4K8OA 4DEXA 1QHGA 1OXSC 1Q57A 1ZCBA 2ZAMA 4LV8B 4IDHA 5KU1A 3ZS9A 1ZC4A 1D9XA 2V7QD 3UWKA 4TMKA 1G41A 2O0JA 2BMEA 3FFAA 3SJBA 3T12A 5BN3A 1J8MF 4AI6A 4P31A 1QHHA 4MUAA 1TADA 1VYUA 4UQOA 4ZIRA 2YC4C 1P6XA 4LC0A 4IDQA 2SHKA 1YRAA 3VKHA 2IUTA 1R0XA 2NMVA 2V4ZA 1KMQA 1T6NA 3RSOA 3QSYA 1E3MA 5JJLA 4A4DA 2PCLA 4C0JA 4DVGA 2REOA 1CEEA 2IF0A 3B85A 2JLQA 3NBXX 4FD2A 1DADA 4LYAA 4W5HA 1JPJA 4NH0A 4HB3A 2RB4A 5AUQA 3KXIA 1N0WA 4LJ4A 1OIVA 4PAQA 2JJ1A 3RLFA 3B13B 4LSGA 3WXMA 1XPRA 3U44A 4JKYA 1HA3A 4XWAA 4EJSA 1HH4A 1KTVA 4O25A 1W2GA 3L2OB 2NO1A 1FOEB 1LVGA 2V7QA 2XNSA 1JR3E 1RVDA 1WQ1R 2KB0A 4TMZA 4B44A 3AF4A 4ZIRB 1JALA 3SYNA 2OXCA 4A8JC 5DYGA 3EPHA 5EXSA 2BJVA 2EYQA 3BH7A 3CX6A 3LQRA 1X1RA 1G19A 1W46A 2ZU0C 3BXZA 3H0KA 4LGMA 4PO8A 4V03A 3SBEA 4KBGA 5ELXA 2UVQA 1RYFA 1H65A 2BBWA 2BIFA 2B7BA 4N0EA 4JLDA 3VQTA 1H8HD 1HV8A 4G3XA 4D82A 4K81B 4M9XA 1KAGA 3NDBB 5C18A 3MSXA 3WNCA 5GJVC 3AP3A 4HAZA 1G3RA 1NVWQ 1E2NA 521PA 3VTKA 1XPOA 1U0LA 2IS1A 4PX9A 2QAJA 1OLOA 3UMSA 1CLUA 4QM7A 3MRSA 4OI0A 2I1QA 2WAYA 1ZM4A 4Q19A 4G5OA 2NO6A 3SJCA 2I3BA 2GCPA 2GILA 3A6PC 4A36A 1KI6B 5IT5A 1XEWX 2AKAB 1IY1A 4DXAA 1GTVA 4YMTA 3U7HB 1E9RA 2GWHA 3MAAC 3RNLA 4ARZA 1ZIOA 1NG1A 2J87A 2O8BB 5FI1B 4GRAA 5HKKD 2CNWD 4MKIA 3FTQA 3U5ZB 3BBPA 1IHUA 2OBNA 5FPHA 1UEIA 4TLDA 1US8B 4TQUS 2ZUDA 4UNRA 3K53A 2V1UA 2O52A 1E32A 1S3GA 4DLSA 4XJXA 3PUVA 1FX0A 3X1DA 3SBDA 4DLWA 3I5XA 1ZNWA 3LXXA 1Q1BA 4L15A 3EPJA 3P20A 1EX6A 1FQKA 4FN5A 4BQSA 4ZV4A 2ZQ5A 4NTZA 3X1ZA 1FMJA 4A2WA 3UMRA 1O3YA 2IK8A 4O2RA 1G3UA 2G77B 3RRNA 3KL4A 3F0TA 4RVCA 1SVWA 3OAAA 2J9RA 1TAGA 2ORWA 4DKXA 3L0SA 3KJIA 4XTCS 2BOVA 3OESA 4Z54A 3AVYA 1MO4A 1OXXK 3QOFA 4E5UA 4PHGA 5EJEA 2OLJA 1KI4A 2QAGA 5L3QB 3GLHB 3UK6A 4KFUA 2GCOB 3IBGA 1B0UA 1F2TB 4R9UC 1KYIA 3VAAA 2B6HA 5AJYA 1JQLB 2YVUA 2XTZA 2A2ZA 2R6FA 1XD8A 4AKEA 2J45A 4YC7A 2OCYC 3DO6A 4JJKA 2HCBA 2X2EA 4PHHA 3U7GA 3U3KA 4AG5A 5JEEA 2KE5A 3I8SA 2BBSA 5AUOB 5D3MB 2JLWA 2JAQA 3HU2A 1J90A 1XJQA 5GADl 4XSHA 4EJSC 1H8EA 2BDTA 3IDQA 2HJGA 4V0ME 3GLFE 2VH5R 3AVVA 4ZKEA 2PJZA 3W9YA 4NCJA 1IN7A 2C04A 2QGZA 3QKUA 2Q9CA 2DCUA 1E2DA 5KNCA 4HB2A 2CVFA 3LD9A 1ZD8A 1WBBA 1COWA 1IJEA 3AF0A 3BS4A 2CLCX 3NDPA 4H1VA 4U02A 4EIWA 3GLFA 1N6HA 2KWIA 4WXRA 2WWYA 3ASZA 2PCJA 4EPRA 4TL8A 1N6IA 3DL0A 2H1LA 1UFQA 4IJMA 1ZNYA 3TSWA 2AKYA 2PLRA 4B76A 2XB2A 4Q9LA 1VYVA 3VNUA 1GIAA 3HPRA 4HUQA 4WW0A 2Q9AA 4AKIA 2IEZA 1VIAA 2DHRA 4B33A 3RABA 2ZSBA 1AA9A 2RHDA 2VSOA 4NL4H 1G64A 1GFIA 1ZVQA 1OB2A 4IFBA 2WWHA 2FZ4A 3CWZA 4MRPA 1G3QA 1NN0A 1OV4A 3N70A 5SZIA 5AJWA 2LKDA 2G9NA 3TK1A 3WYAA 1P3JA 1G1MA 3ZQ6A 2PEYA 4EAQA 4LHZA 4HLCA 2R65A 3EA5A 2DFTA 2GEDA 4C0HA 4NDZA 4UNQA 1PV4A 4XD7D 2Z5FA 3LXRA 2NZ8A 4F92B 1CF4A 1YZUA 4GP6A 4JS0A 5BW8A 3QE0A 1HE1C 2YWHA 2JCSA 1XXHB 1FQJA 2ZEJA 3TQFA 2WPDD 2RGBA 5HTKA 4O3MA 4MYTA 4ZCIA 3CR8A 4WAUA 1KI1A 2C96A 4OQMA 1W4AA 2CDNA 4DWJA 4HZUA 3KFVA 1NBMD 3EA0A 1FNMA 1E2LA 3W6PA 2F9LA 5DSZA 5K8LA 1ZCAA 4LZZA 4B73A 2RGAA 2QA5A 5IF9A 2RH5A 2X77A 3C14C 1OFIA 2Q3MA 5CYPA 5HCIA 1OXVA 1GWNA 4RKEA 2JATA 5GVSA 4GOJA 4NP6A 4PQRA 1Z0KA 1N6LA 1TQ4A 5G3YA 3HJNA 3DHWC 2YOFA 4LHWA 2JJ2D 4TTRA 1XJ0A 2IS6A 5DIFA 2IYQA 3C15C 2WJGA 3LX8A 3K0FB 4KXFB 2VLIA 5FL3A 1WCV1 1N6OA 1T9HA 4LJ6A 5EP1A 1U0JA 2IW3A 2RKOA 3IGFA 2FNAA 2ZRFA 4PPFA 5TMPA 3D3QA 1JEDA 1G8FA 3FFBA 4NYIR 2BWJA 2D7CA 4KSBA 4DLYA 1OXTA 2DWPA 3KQHA 1W5TA 2H8KA 3SQWA 4JLKA 4EKDA 4N0DA 4FMDB 2QP3A 1ZJ6A 1FMLA 3RVBA 3UG7A 5GJBA 3CRMA 1P2SA 4DDUA 2J0VA 2F7SA 4EFLA 1FPMA 3NKVA 4JSYA 4P0TA 4B48A 1DAFA 4HAVA 4MGZR 4FW9A 4OI1A 4PAOA 1PVOA 1JAHA 2YOHA 4MYHA 3FB4A 3QF4A 3BE4A 3OEED 3EPKA 1VKJA 3REGA 1N2CE 3EASA 4EJSB 4O2LA 1Q44A 1AGPA 1NVVR 4ZO4A 2PT7A 4HSEA 4J0QA 3UATA 4GDFA 1IN4A 1D5CA 3B78A 3DPUA 3OEEA 2VP9A 4ERNA 4ZI2A 4TMWA 4Q02A 1YVDA 2CMKA 2KBFA 1GZSA 4BFXA 4AYXA 3VKGA 5L3VA 1IAQA 1XWIA 2VHJA 2BHRA 3QKRA 2QT0A 4B35A 3QXXA 4ZCMA 4C30A 1Q0UA 1FTNA 2YINC 2EU8A 4M1KA 1JXMA 2C98A 2ODWA 4NCIA 1MO5A 3AF2A 5FPYA 1CR4A 1TEVA 2AR7A 1XEXB 4HAWA 4Q1EA 5LD2C 1JAIA 4Q4LA 3FMOB 3WP0A 3IIJA 3EZ9A 4RD0A 3LO5A 2VHCA 2ATXA 3Q5EA 1ONBA 1IY2A 3EZFA 3AF1A 1ZM2A 3HWSA 3AUXA 5JHHB 1A82A 1XMSA 5EP4A 1XJCA 3ECCA 2ZETA 4MYUA 4F4JA 3GPLA 5CITA 3GJ0A 4DLRA 3DOFA 4A6PA 4PZYA 2BKUA 1DARA 1G7RA 1HT2E 2IYLD 3H4MA 4GFDA 3BD9A 2GRJA 3CKLA 1I4LD 2NG1A 3FHTA 2J7PA 5CB6A 5B58C 5EZ5A 2WPDA 1KK1A 4CYMA 3P27A 2IXGA 2GF0A 4XVUA 5DHFA 1KO7A 2OM2A 2ZE5A 3NIBA 3DZDA 5KO2A 2FGKA 4BFWA 2GK7A 4BEBA 2HYDA 4PSKA 4IHQA 4GZMA 4V02A 1KI2A 1T3LA 4NYJR 1Z6YA 2D62A 1EFTA 2OILA 2ZSFA 1G8HA 5FH9A 3EG5A 1CKEA 2ZROA 3SNHA 3L0IB 4JBWA 1XEXA 5CLQA 1KO4A 3THOA 2AWNA 4H1UA 2ZM5A 3KTAA 3PUXA 1VHLA 3H2YA 1LB1B 1CRPA 3TAHA 2ZRDA 3QXSA 4IKEA 2G0NA 2OEPA 5HE8A 3SYLA 2FF7A 2GBLA 1RW4A 1UEJA 3UPUA 1J7KA 3EIQA 1EFRD 1Z0IA 2Z6VA 3I4LA 3TE6A 3N2EA 1NKSA 1QVRA 2FWRA 3F3YA 4TSFD 1UAAA 1F5NA 2CEAA 2O0KA 3RSLA 1RFLA 3TJZA 2PL3A 4KFSA 2KJQA 3ZD6A 4U5XA 2XTNA 1SZPA 4AK9A 3GLGE 4PTLA 4BZPA 2NGRA 5DGXA 1MO6A 1E2EA 5KUTA 4Q9JA 1ZUIA 2D74A 1UBEA 3NC1C 1R5NA 1G17A 1JECA 2EFDB 4ILEA 2O8CB 4B2PA 2QBYA 3M4YA 4C0LA 2IYTA 4YONB 5EXTA 2VTKA 2IUUA 3MUFA 2IF2A 3AKCA 1E69A 4NCHA 4BZXA 5ANRB 4B3XA 1Q22A 1E1QA 2KI5A 1XEFA 2CCKA 1GILA 2AXNA 2NPIA 3C5CA 4IXMA 1UJ2A 4TLCA 4PC3A 1E98A 2QN6A 1ZM9A 4URWR 1DAGA 1TF7A 2QSYA 1HUQA 4WZBE 1U0HC 4ACBA 2JIZD 3M0EA 1OSNA 8OHMA 2MSCB 3KQKA 3AVUA 4PC7A 3GLIE 1YZTA 4MGKR 2VYFA 4IEIA 2ANBA 5TDHA 3R9WA 1EFHA 1Q1QA 3VR4A 2QI9C 821PA 2N1BA 4QHSA 4BLPA 5D3QA 3GMTA 2PLFA 3U6KA 3FKSD 4X8OA 1KSGA 3GCGA 2ZJAA 3THWB 1X8LA 3IQXA 2Z83A 2FPLA 1OH5A 1UKVY 2LWIA 3BJIC 4CEHA 1II0A 4M8NE 4R71A 4O0MA 1YZKA 1NIPA 5JSZB 2PZGA 4G0NA 3UKDA 4TQ9A 2EW1A 2HT6A 3TKLA 2AFHE 4NHOA 5CIWA 2ERYA 1KO8A 2PMKA 1VCNA 1Q1EA 3KJGA 2P3SA 1JR6A 1E2QA 2QRNA 5BYKA 3U4QA 1A2BA 1ZINA 2QM7A 5FOUA 5C4GB 3Q8XB 4NYMR 1XMIA 3GEHA 1G4UR 5EUMA 3TVTA 2VP6A 1GNPA 4NYIQ 4QHTA 3R9XA 5K8TA 1BMFA 3FGNA 2JEOA 5EE1A 3VX3A 4H9GA 3O8DA 5J4HA 4URXR 1AGRA 2QEQA 3V4RA 3E1SA 1AKEA 3IHWA 2RHMA 2QPAA 4HAYA 1KSFX 2Q6TA 2WTUA 2GF9A 3IPYA 3LVQE 2CNWA 2FSFA 2RGXA 2XOKA 3AUYA 5FUYA 1WBDA 5JI2E 4HLDA 4KYUA 5JFGA 2OFOA 2QAGB 3NEJA 2OE2A 2E87A 3CF6R 2CLSA 4BEJA 4W7SA 3EZ7A 4A8JB 2BEKA 3DMNA 2ZI3A 2HYIC 3AKDA 2NZJA 3AV0B 1E2JA 4I4LA 4KSCA 4TQAA 3K9HA 5B30A 4NKRA 1TL7C 1Z0AA 4FINA 3BH0A 4YMWA 4XIGS 1M34E 1BYUA 4Q00A 3LFUA 4DIDA 1DEKA 3LNCA 4Q7LA 4BLRA 1D9ZA 2VQSA 4DLTA 3LLMA 1W4CA 2EFCB 4Q01A 5DI3B 2GESA 4LDJA 3NHAA 4CEJB 4RFSA 2ZJZA 3ZVLA 5J4LA 1ZUNB 3GLHA 2CXXA 5JI3E 4B3FX 1ZMXA 3HR7A 3TH5A 1UBCA 1WB9A 4HDQB 2ZRJA 1GRRA 3IO3A 4ESVA 2OUKA 3HU1A 4LC1A 4R98A 2CE7A 1KKLA 1T5LA 1N25A 1X86B 1KGDA 1YU9A 4JBXA 1YZNA 5GVRA 1E2GA 1E4YA 3X2SA 1NBMA 1Z6GA 121PA 4UJ3A 2ZAOA 4QGHA 3IEUA 1BYIA 1UADA 2ZJ5A 1E0JA 2WIAA 4AWXA 1LTQA 1GM5A 1X1SA 5JWRA 3TUJC 1XTKA 3AVQA 4DLXA 5FUWA 4Q9HA 1S1MA 4P4SA 4WVFA 1T91A 1NMZA 1RIFA 3AF3A 3DKPA 2HJVA 2LCFA 1IY0A 1T0JB 4JBYA 4XD7A 1W4BA 3LA6A 1II8A 3RRYA 2J5XA 3IILA 4M1OA 2F3TA 4WOPA 4PPNA 2HT1A 1E0AA 1GSIA 2CCJA 4RD3A 4N1AA 4II7A 4G01B 3ICEA 2CVHA 1YE8A 1QHXA 4DJTA 3VR3A 1TUIA 1IXZA 2VPPA 3RS5A 3QG1A 1P7CA 2C77A 1C1YA 1Y63A 5EXPA 3OE7D 2ZS9A 1N0UA 3L8YA 1KZGB 2AX4A 1TNDA 2D06A 3CH4B 4P3YA 1L4YA 2IWRA 3JZAA 2VIIA 4A2QA 5KSZA 3AEZA 3SEAA 4GL2A 4B43A 1OW3B 4LBVA 3QI2A 2C8VA 3I61A 1VYTA 3D6TB 3AM1A 2JDIA 1NBME 4R7ZA 4BFZA 1NF3A 3RANA 2OZEA 4RFSB 2ZRMA 1R5BA 4EPYA 1QG2A 3MFYA 4M0LA 4OL0A 3TBKA 1NVUQ 2GEVA 3UWOA 4XVRA 5FL7A 4U00A 3S1AB 4JZKA 1Q21A 3MGCA 1ZBDA 1QHYA 3WNDA 4NMMA 4PFSA 1KNQA 2OLKA 3TGPA 3ZVMA 1WXQA 3HDTA 3QENA 2ZRNA 1KK2A 3ND9A 4CZ2A 4YDHB 4B47A 1MH1A 2PBRA 1KI3A 3EARA 1GITA 2IYZA 1AIPA 4EPTA 3SN6A 3U60B 5JMTA 2Q9BA 4CEIA 2ZJ2A 4UJ5A 2JLUA 4DCNA 3K70B 1R10A 4QC2A 2VSFA 2ZTSA 3GEIA 4FXPA 3UIEA 1JB1A 1P2TA 1MABA 2D2EA 3NBZC 4Q47A 2OV2A 5E95A 4TL6A 3RS0A 1EFRA 3CUEF 2QU8A 2TMKA 2DFNA 1K5GA 3QVVA 5KDOA 2ZRLA 5TXGA 3BH6A 4B6EA 2J46A 4Q9KA 2GZAA 3GLHE 1MRSA 3A1SA 4UNSA 3D8BA 2JLYA 2W0SA 5C1BA 1YKSA 4TMVA 1W44A 1VG8A 2VA8A 2FEMA 3A1TA 4TYWA 4PSAA 2YWGA 2IX3A 1B23P 2ZSDA 3K1JA 2L0XA 3CR7A 2H17A 2VF7A 1E9DA 3KB1A 2ZE7A 2XTMA 3HR8A 4C2UA 5FOWA 5KYKA 1BIFA 3RHFA 2Z4RA 1P61B 3PIRA 1E9AA 2PT5A 4JLAA 2O0HA 4RKFA 3O8RA 1V43A 1MT0A 1HYQA 1ZW6A 2I1VB 1TQ6A 3C41J 4CEIB 1QVAA 3QPVA 2PZEA 1RRGA 2FOLA 2YNMA 3CRVA 3ZZ0A 2BMDA 2PJRA 3TR5A 1EFCA 1FUUA 1UPTA 1NN3A 1S2MA 2ATVA 5FBVB 3VFDA 1F6BA 1ZU4A 3KFXA 4LV6A 4TZ6A 3LX5A 2ECKA 4OHVA 3WP1B 1R0YA 3M1IA 2ERXA 4NE2A 4DCUA 2ZVQX 1BKDR 4BFVA 2FFQA 4W5WA 4RZ2A 2XX3A 2NOAA 4IDOA 4LPKA 4HZIA 2Z0MA 5HZHA 1OHHD 2BMJA 2PX3A 1WA5A 3LW8A 3SJZA 4I1OA 1N6RA 4A6XA 3THWA 4QBGB 3BFVA 2J1LA 3BOSA 3R8CA 3OE7A 1SKYB 4B2IA 4KYIB 2OFWA 3QVUA 4B3GA 4MITA 4RD1A 3VR2A 2ANCA 2QMUA 4P4UA 3ONWA 1E1QD 3QPUA 5K8UA 3QXJA 2BEJA 3ADBA 3FMFA 2P67A 1XD9A 2OCBA 1P75A 4IDPA 1Z63A 1RYHA 1KDTA 3B1YA 3LBHA 3FVQA 1X8KA 5SZJA 1E96A 2V9PA 3A8TA 3NWJA 3DDCA 4E07A 5JECA 3PITA 4OHXA 3GLGB 2GNOA 3PEUA 3OFND 4DSOA 4RCZA 3GP8A 2VP2A 3B5JA 1BO6A 1ZUHA 1UF9A 1E2PA 1CU1A 2FU5C 4ZCLA 1QDEA 1UKZA 4M1YA 1Z0JA 4HYYA 2PMDA 3K70C 3K0AA 2Q21A 4TLEA 2H16A 1P9NA 4TYYA 4MA4A 1RRCA 2XZPA 1W48A 3DVLA 4RCYA 1XX6A 2CJWB 3BERA 3VHXA 5L8VA 1D2NA 2C03A 5D3MA 4C0BA 3HYRA 4A8JA 1E2MA 1E79D 2WAXA 4PC6A 4GT1A 5FUXA 1DTSA 1UKEA 5LBIA 2B8TA 3SFZA 1WMSA 2OCAA 2OAP1 2H57A 2GXQA 2WKPA 3K0EA 5FR1A 5JRZA 4URZR 4B2LA 2VRWA 1W0JD 3R7WB 1SQ5A 2R9VA 4JVNA 4Q18A 4KBFA 2QSZA 3CIOA 2WKQA 1OIXA 4KODA 4QHYA 5EZ6B 3WMEA 3EWSA 5FPSA 2R2AA 3KKNA 1VG0B 2W6ID 3MWJA 3TRFA 1ZRHA 3LW7A 4TLAA 1OPXA 3QJYA 3QG5A 3R20A 5BYJA 1XD2B 3BB1A 5KOYA 1HE8B 4M53A 4KLNA 2ZANA 1GKUB 4ARZB 4A82A 1Z6XA 3QXHA 1L7VC 5CDFA 4URVR 1IM2A 2C5LA 2P6NA 4DEYA 3L8ZA 4G5GA 1KI9A 3DMDA 4UXIA 2QROA 1A1VA 2BM1A 4V0MA 2VL7A 2MSDB 3LDAA 3KUDA 3PENA 3KQNA 3CW2A 1T3HA 3KB2A 2OESA 1W1WA 1V5WA 2FZLA 1R5OA 3OZXA 3W3AA 4IRUB 1FUKA 4D0NA 3OFNA 1GNQA 4D4LA 1E2IA 1OT3A 3CZPA 2A5DA 2NO9A 4PZLA 3T34A 2IXEA 4Q5IA 3CRW1 4U7DA 2XJ4A 4D0GA 4DDTA 3U4QB 2J0SA 2HUPA 3K8YA 3CLVA 5AK0A 2BC9A 2V55B 2WMNB 4ITRC 2G0TA 4L9SA 1CJTC 3TUIC 3VR5A 4MGIR 1XZQA 4MKGA 2O8EA 4AYWA 4LCBA 4MRSA 4I99A 5KSPA 4DLZA 2ZRPA 2GTPA 3X1XA 2GJSA 2ZR7A 4B75A 1BMFD 1XDBA 4CEHB 1YR9A 3CO5A 3T35A 2RGGA 1CULC 2WMOB 2XZLA 2BVNA 3LVRE 5J47A 1RPZA 2ZRAA 3VKWA 3CF0A 5CK5A 3G0HA 3AVPA 1NMXA 2FDCA 2WWWA 4L16A 5H8WA 1P73A 2C9CA 4Q4JB 5A5GA 1ANKA 2C78A 1ZM7A 1G9XA 2ZRCA 4MQBA 2FN4A 3FKQA 4XWOA 2Z4SA 3MWYW 4MH0R 2PX0A 2NPFA 2IYUA 3OF5A 4MDFA 4GI7A 2EVWX 4UNNA 5HR5A 1ZAKA 3SU8A 4LI0A 2FE4A 1DO2A 1PLLA 1E9FA 1U8YA 3AB3A 1FZQA 2WHXA 4DLUA 3AGPA 2DBYA 1G7SA 4MKFA 4TWZA 1U2RA 2A30A 1ZNXA 1T0HB 2VF8A 2ZYUX 3TW8B 2A5JA 2HLDD 2JIZA 4GP7A 4IFEA 1KSJA 5H68A 2XNDA 3RS7A 1IOZA 3BB4A 1G8PA 2VP0A 1CP2A 3I8XA 4JL6A 4XSGA 2QTFA 1SHKA 1S1CA 1KHTA 3RAPR 2FA9A 2LKCA 2WOJA 4RY2A 3SZRA 3M6AA 2ASEA 4CIDA 1M6NA 1IQPA 4RD2A 2RAPA 3IQWA 5FPTA 4D0LB 4G5QA 3O8BA 2BBOA 4BGDA 2HXYA 5DN6D 4ASUD 3BRWD 4FWIB 1ELOA 4OK6A 1XTQA 1DG3A 2XAUA 3E70C 2FV8A 2F3RA 3THYA 4RSGA 1KJZA 4EFNA 3QY0A 2ZIAA 4F38A 1Z0DA 2GAOA 2G83A 1EX7A 2GJ9A 2FFHA 5B57C 5M04A 4QG7A 1GUAA 4DB2A 2IT1A 4B32A 3IIMA 4RZ3A 4BECA 3OHMA 1IXSB 3QUSA 1F60A 4TYNA 1S3SA 3AH8A 5EE5B 721PA 2YHSA 2W6JA 3RYTC 3ZQJA 4NU0A 4FMCF 1U81A 4ASUA 2IYRA 2OO7A 4DHEA 4EDHA 3NC0C 5EE0A 1JPNA 3BK7A 3ZVNA 2QPTA 1KK3A 3D7MA 3SQXA 3I5YA 5FTMA 3NTUA 3FPAA 2OAQ1 1NNEA 4A0HA 2QUZA 1A7JA 5FL7D 4LHXA 4LJYA 4B71A 3NVAA 3L0OA 2J0UB 4JL8A 1U8ZA 4HLQB 2AHOA 2CL6X 3GJ3A 3SFVA 3Q5DA 1DELA 2GVZC 4KVGA 2Q3HA 1IONA 1II8B 3B1WA 1W0KD 3UG6A 3KJHA 4D4MA 4OQFA 4ZKDA 2NTYC 1VCMA 4PC1A 3B9QA 4P4TA 4DCVA 2KSQA 4TL9A 1M8PA 3IPXA 1GRQA 2K5UA 3IIKA 4S2EA 4M1TA 1TMKA 2DFLA 4AKGA 5DI3A 1RE0A 3TQCA 5CYOA 3K0FA 3KUCA 2AK2A 4M9ZA 2FMXA 1G6OA 3JZMA 1E9BA 4GBMA 2ZUBA 4V0NA 4BFYA 1S9HA 5C46F 4IOMA 1PZNA 4LBZA 3B60A 3F5FA 3OIYA 3W5IA 4D81A 1XPUA 1KSHA 3AP1A 3K0AB 3CONA 1EWRA 4BRUA 2QE7A 5L3SB 3ZD7A 2XOKD 2FSIA 3W6NA 4QBFA 5TVKA 4NZYA 4XOIA 1JI0A 3RC3A 5DNYB 2YC2C 4AIIA 1DE0A 5CJPA 5BWMA 2DWQA 3THYB 1HY3A 3B1XA 2EFGA 3NBFA 2BBTA 3NBYC 1HURA 2GJAA 2GJKA 1WF3A 2IWHA 3RWOA 3KDSE 4GNKA 1KDPA 1C4OA 2ZRHA 4B74A 3SOPA 3CF2A 3VU9A 3ICQB 3IUYA 4WZAE 2FJUA 3NH6A 2P2LA 2YWFA 1XMJA 2HLDA 2WV9A 1E99A 3I3SR 1N5LA 4MDEA 1IBRA 1W4RA 1Z07A 5AJZA 3ZH9B 2F1IA 2DFKB 4B3CA 2D7DA 3EZ2A 3WBKA 1OHHA 2PZFA 1DBSA 3GJ6A 1TU3A 5FOSA 1N5IA 4D6PA 4QXAA 1TUEA 2AWOA 2WSMA 1YR6A 2AN9A 3CNLA 3ADKA 4HAUA 4DSNA 4E09A 5AUNB 3ZZTA 2WICA 4Q7JB 2B7CA 3T61A 2VP4A 4ABYA 4DCSA 3RS3A 5GJWC 1GKIA 4HZUB 4M9QA 2J0UA 1L2TA 1FTSA 1I2MA 4Q48A 1E0SA 3SYKA 1MR3F 2GK6A 1ETUA 3MLEA 2XSZD 4KI0A 1QHSA 1I4TD 5EUQB 1LV7A 3MWLA 2WBLC 4IOJA 3REFA 3PUWA 3Q7PA 4IOKA 1TU4A 2OBMA 1XFAA 2FG5A 3P1JA 4M22A 5KDLA 4CT4B 5F9FA 2JGNA 2NIPA 4LYJA 2GXUA 2G3YA 2WZQA 4JMPA 5FOXA 2X2FA 1NVXQ 2QT1A 1EXMA 1SKYE 4ZDKA 3PEYA 5G3ZA 2DB3A 4JT4A 3BGWA 4Q4AA 5B64A 4FMCB 2IL1A 1Z47A 1JQJC 3AKEA 2NO7A 2E1RA 2WSSA 3GLIA 4C0QC 5JRJA 1TQDA 1NI3A 1YHNA 2WJHA 2ZI9A 3KZ1E 3A37A 3Q72A 1P9WA 4OQNA 1R6BX 1NIJA 1GL6A 1EFUA 5FTLA 3EAQA 2W6JD 4AC9A 4Y0AA 5JWHA 4NPHA 2D2FA 3ZS8A 2IA5A 2X1VA 4Q9IA 3EPLA 2V1XA 3GJ8A 4B3DA 1MABB 1XTJA 2EWVA 2YJTD 5CDFE 3G82C 5IDVA 2CK3A 1F2UB 3KXLA 3U44B 4TLBA 3GEEA 3HU3A 2HV8A 4F4CA 5JCPA 3GLFB 2CE2X 2QQ0A 1VMAA 2GCOA 4HI0E 1Q20A 2QM8A 1W7AA 1T8TA 5AJVB 4M1SA 4F7WA 4EPVA 4MRVA 1M7BA 4LYHA 3CWQA 1U99A 2QY9A 1N0VC 3Q85A 2GDJA 1P60A 3CPEA 4YQFA 4KCGA 1E9CA 2ZJ8A 1T8UA 1Z3IX 5HKKA 5DYIA 4BFSA 4CGZA 3J81k 5FFMA 4ESHA 2ZUCA 4JVMA 4KFRA 3ND8A 4UKDA 4GOXA 4HUQB 1AS2A 4KHZA 2AXPA 2V3CC 1NLYA 4Q66C 1G6HA 1VCIA 3EC2A 3VX4A 2ZI5A 3FDIA 4QRHA 4OKSA 1SHZA 1G4AE 1QRAA 1ESMA 1LS1A 5LB2A 1YQTA 1G5RA 5LD2B 4CVNA 2MMCA 2P5SA 4A9AA 1W36C 1KI7A 1FP7A 5FR2A 5JCZA 2F1HA 3BFXA 3K0CC 3UMFA 1KKMA 1F3OA 4LX0A 1XXHE 2WJVA 4BPBA 3THXA 1NN1A 3E5HA 3K70D 1EESA 2CL0X 1PUJA 2HF8A 1CR2A 4I1SA 1PLKA 1G18A 4KJZA 5KPJA 1HT1E 1W5SA 1QHIA 4HAXA 4BLTA 2GCNA 2WVJA 5JLJA 1QHHB 1TF2A 2FSHA 1G21E 1GVNB 1CTQA 1MV5A 2OT3B 2WWGA 2V6IA 1AQUA 5KNDA 2RCNA 3CB4A 2WWIA 3WRXC 1Q1ZA 1R7RA 3NG1A 4WBSA 1K5DA 4QKQA 4WXPA 1ZM3A 1Q3HA 1BH2A 1RZ3A 1EGAA 2OBLA 1RJ9A 3V00A 2J3EA 3GJ5A 4P4SB 4OQLA 2H7VA 2CHGA 1NL3A 1G16A 1GDDA 2G88A 4DSTA 2VO1A 4AG6A 4KFTA 5AUPB 4LOAA 3PV0A 5CM8B 4Q7KA 2GEUA 4KV9A 1SVSA 2F43A 3WNBA 2E9SA 1KMHB 3OAAD 3LWNA 5BQ5A 3QF7A 4ACAA 4QOSA 4DRZA 5IK2A 2ORVA 1OKKA 1AZTA 3C5HA 1SXJE 1PJRA 4JJZA 4FIDA 3G5UA 2BV3A 3LLUA 3Q7QA 1KOFA 4YLGA 1QHNA 3PUZA 2ZI4A 3LRPA 1WRBA 3BC1A 4DCTA 2BMFA 3QQ5A 4DSUA 2BCJQ 3ETLA 4GOKA 4CF7A 4ZI3A 1UDWA 1Z5ZA 5DH9A 2A5FA 3TIFA 1ZD9A 4A15A 4A1FA 2QBYB 1UDXA 2WWFA 2C2HA 3ZLJA 2DWOA 2ZE8A 1W36D 3W90A 4QFMA 3QKSB 1S96A 4TL7A 5JEDA 4DDVA 1HTWA 3CX8A 4DC9A 1YZQA 1XF9A 1S9DA 1A4RA 2J7KA 4EQ6B 3AQ4A 3DM9B 3QF4B 4I81A 4TT3D 2P65A 2AK3A 3A58B 1OE0A 4BFUA 2C9YA 1GL9B 3PCRB 2QNRA 2V54A 3QEOA 3QPWA 4LBWA 2J41A 3K09C 1TQ2A 1OYYA 3B8HA 1DAHA 2RGDA 4HATA 3WYFA 2ZS7A 4TZ0A 1ZU5A 2AD1A 3MMPA 4QL3A 5G40A 2H18A 2AL7A 3WMGA 5UKDA 2P6UA 4TT3A 2ZITA 5G53C 1IN8A 1H8HA 2GETA 4AD8A 5E7IA 1OKKD 1LW7A 5J4YA 5FTJA 4BRWA 5GJCA 1D2MA 3QKRB 1E79A 4CT5A 2IS2A 1JR3A 3K0CA 3BORA 1Z2AA 2C99A 1G8GA 2AFIE 2ODBA 3DKVA 3B1VA 3KQLA 4IVQA 1S4QA 1SXJC 1VCOA 4XTRA 5AJXA 1U98A 3H1TA 3ASYA 3TUZC 3U3JA 1GOTA 5CLLA 3O47A 3B9PA 4BE7B 4DDWA 4RD4A 5JWOA 2F43B 5DO9A 3WMFA 3GJ4A 3O8CA 3EX7C 4Q4HB 5FOTA 2ZJYA 1IXRC 2GAAA 4QBHA 4ZDJA 3DM5A 4TMTA 4WZ6A 1DAIA 3OEHD 2CCGA 2VHQA 2ONKA 2REXB 5IHPA 5CM9C 1U8AA 3K09A 1TPZA 2F1RA 3LBIA 5CK4A 2ORIA 1Z29A 1XU4A 5J40A 2Z43A 2DPXA 2ZRBA 2ZYVX 3EXAA 3NXSA 4M2LA 5HZKA 4JIMA 1DAMA 2F6RA 2CHVA 2ODNA 3I32A 5CIQA 1E2FA 1NSFA 2F1JA 2JDID 4FCVA 5CB8A 1Z83A 1WDTA 4V0KA 2VBCA 5KSOA 2HDNB 1KMHA 2XEXA 1OH8A 4A0RA 3OIVA 2OCPA 3I73A 4PPQA 2XXAA 2O8DB 1Z0FA 1GP2A 3CM0A 5F3WB 1PLJA 1J2JA 4PQFA 3GQBA 1S8FA 4LWZA 3BIFA 3L43A 3PVSA 4PR0A 4JVLA 2G1KA 4IEEA 4US2R 4EPXA 3B1ZA 5HE9A 4YDSA 4NCNA 5DI9A 2YV5A 3IKJA 1ZNZA 2MSEB 1UBFA 4E22A 5A4JA 3X1WA 3T15A 5DE3A 2Q0HA 1OXUA 4Q1BA 1M2OB 1ZYUA 2ZR9A 5EQTA 4DT1B 5KHOC 2O8BA 2ZE6A 4LJ5A 5CJ2A 1J99A 2C9OA 1AS3A 4HUTA 4Z51A 2XITA 2P0EA 2ZSAA 5H70A 1E6CA 3V9PA 4CDGA 1JNYA 3A1UA 2JLRA 3QIAA 5JHGB 1YR8A 1R4AA 2ZPTX 4PHTA 3CX7A 1E4VA 5FUVA 1FFHA 2CBZA 1OFHA 1X6VA 3W6OA 2N46A 5L3SA 3ADDA 1MKYA 1XB2A 4NBSA 2FPMA 4IDNA 1OB5A 1WP9A 1G3IA 4Q4HA 4MKHA 1U90A 1F2UA 5DN6A 4ON9A 3SHFA 4AYTA 1T3SA 1KI6A 3QXCA 2XJ9A 4WA7A 4DUGD 3R8FA 4Q1AA 2R6CA 2RGCA 2ZJOA 1RRPA 1KI8A 2JASA 1J70A 3C7KA 3OEHA 3QNUA 3B7GA 3SDZA 4I1VA 1A5TA 2QZ4A 4UXJA 3TMKA 3VMFA 4C4PA 2IEYA 4N3NA 4Q7MB 3HPQA 4V0OA 1VG9B 1SVIA 2FFAA 5FTKA 2YOGA 3UXMA 4HB4A 3A1WA 1XTIA 1KK0A 2NO0A 4LHYA 1RC8A 1CXZA 1Z2CA 2F9MA 4G5RA 4OQXA 2QRZA 5JS7A 3FE2A 2OSBA 5JSZA 1MRNA 3TW4A 2B21A 3B2EA 2BJWA 1G3MA 2OXRA 5TY0A 1GRNA 4NONA 2J7PD 4WIAA 3CZQA 4GMDA 4K46A 2EWWA 5C4MA 3GJXC 2XSZA 4PC2A 3W3ZB 1D8TA 1XMVA 2FFBA 3P32A 3P4YA 4PO9A 1JBKA 1Y3AA 5DISB 3EIEA 1KO5A 1NMYA 2CL7X 3FMPB 2DYKA 4QM6A 1SVLA 1R0ZA 3X1YA 2WJJA 2R6GA 3CPJB 1O87A 4QJ5A 2ZJBA 2ZR0A 2A7QA 4YXWD 2IYVA 4BWYA 5J4VA 1KY2A 2A9KA 2ZYTX 1CRQA 1H8ED 4IVPA 3QBVA 1GNRA 1R2QA 3DOEA 2J0QA 5LDDC 3W5JA 3C4JA 1J8YF 4XWKA 4Q03A 2QP4A 1JJ7A 4X8HA 4CEJA 1WE2A 2IHBA 3KXKA 1IN5A 4FI3C 3QKTA 1AZSC 4NYJQ 2J59A 4QGGA 4DBLC 2XZOA 3FWYA 4KO8A 1MO3A 2VSXA 1Z6AA 3PJRA 1XP8A 2BCGY 4GPTA 4M4SA 1E1RD 1ZP6A 3U7EB 2V8OA 4JKIA 4URYR 3TSOA 1XZPA 1ZD1A 4D4KA 1P9RA 3FHCB 3U3OA 3T06B 1F48A 4JLBA 3PEVA 3SS8A 4B34A 4OK3A 5FTNA 4HB0A 1P4SA 1LFDB 2QE7D 1XTSA 3K0SA 1XD2A 3QEJA 4L5BA 4PAMA 1CBUA 1HEIA 4PO1A 3THXB 2EYUA 4US1R 3TAUA 3PUYA 4EQ6A 1UKYA 1E1RA 3AGQA 4KAXA 5IK2D 4LJ8A 3K9NA 1U94A 5J4KA 4URUR 1Z08A 4MRRA 3AVTA 4GSYA 3TLXA 4LYFA 2YYZA 1TEXA 1E9EA 1NY6A 1SVKA 2IYYA 1N6PA 1DG1G 4JLPA 4F93B 3WBJA 2D4HA 2ZVPX 3I1FA 2JLVA 3WRYC 1N3BA 1XCGB 4Z1MA 2WWXA 1N6KA 4XVQA 5HPYB 4UNPA 4D25A 3JVUA 4IVRA 2R62A 2IC5A 4QJ4A 1W0KA 4BUJA 3CH5A 1U9IA 4BZQA 1I2DA 1L8QA 4RD6A 3ZIAA 2NQ2C 3I62A 3U2QA 1OJLA 1G7TA 3CRRA 1DAKA 2W2XA 3SJAA 2BM0A 2A5GA 4LK2A 3SR0A 1OFUX 4JSTA 2IYSA 3BB3A 1OH6A 3VR6A 3LQQA 4FCTA 1RRFA 3T5DA 2ZREA 4EFMA 1SVOA 1M1YE 3W8RA 1AN0A 1US8A 1XXHA 2VP5A 4XH9B 1SXJD 1II9A 3A4NA 4LJAA 4OI4A 1YJ5A 4PANA 4FCWA 2GZHA 3V4FA 2QENA 5KTYA 5TV2A 3U61B 1KAOA 3KKOA 4PXAA 4Q4JA 3U3MA 4MYCA 4TN1A 1NY5A 1AJEA 1YZGA 2R8RA 4JLNA 3ZIAD 2QMEA 4M9SA 3QKSA 4M21A 1NJFA 1KZ7B 5KDDA 3PQCA 2W0MA 3GLIB 5SZHB 2JLZA 1EWQA 2KBEA 3MCAA 2YWEA 4PZZA 3MWKA 1G291 2HF9A 2ZSEA 4Z1MD 3MG9A 2R6DA 1RJ9B 4NYMQ 1TF5A 1CJKC 3C16C 2RGNC 5FPKA 3NEYA 3L0PA
chains in the Genus database with same CATH superfamily
2VHTA 2XXAB 3Q9LA 4C2TA 1X1CA 4X8LA 1DWQA 3E2IA 4FHGA 4QUHA 1QS0B 3OOWA 1TUGA 2HBYA 2JC3A 2Q1TA 3MN1A 4HLUC 4LNHA 5JNSA 2X15A 2WLSA 2P2DA 3IDFA 5ITVA 3S1AA 4EX6A 3HC7A 1D2EA 5C81A 2H1VA 1JR2A 2TMGA 3I2HA 1JEQB 5GV8A 3U6BA 1DJPA 4KQHA 2XWSA 1ZC3A 3T1OA 1BEUB 2I7VA 1KO1A 1LX6A 1ODSA 3I53A 1XEWY 1KH3A 1M74A 5DHAA 3GGOA 2FSVA 4O1HA 1F2DA 1VA4A 1TGYA 2QTNA 4YALA 3G9QA 3ZY6A 1BDJA 5SY4A 4EL5A 1R0LA 1XBTA 2Q2OA 3OTWA 4RTRA 4LF7B 1CDZA 1CJVC 3K31A 3RTDA 1CUEA 3FHOA 5CVDA 3T1TA 4AF7A 3Q4GA 1JSZA 2B94A 3SC2B 5LZ2A 3ZE6A 2WQ6A 4A0FA 4LPSA 4MP3A 4OL9A 3FWHA 4W7HA 1RJGA 1LS6A 2JFWA 4IAOA 4NCKA 3MJHA 4O2BF 1U7XA 3KOXA 4ZT7A 5J63A 5LXTF 3KHUA 3RB8A 6REQB 3KTAB 2QTVB 4JGIA 4G5SA 2D1QA 1FFAA 4YCSA 2Q3DA 1UT8A 2Q8PA 3VH2A 1N5RA 1XCMA 3P8ZA 1FP6A 1URPA 1VA5A 1KY4A 3NH9A 3Q1KA 1UT6A 2COUA 3KX2A 2J3QA 2I6UA 3BMCA 1P7VA 3H1GA 221PA 5ER6A 5AHOA 4U2CA 1JDBC 3Q2OA 1KEZA 2LV8A 5K0EA 1Y33E 3OKPA 2BH9A 2NTJA 3T1VA 1FVOA 1RADA 4CMEA 5KPDA 3D3NA 3LECA 4Q3DA 3FOZA 3RUIA 3WK4A 3WQBA 2O8FA 2P5YA 1ESNA 1P2UA 2XUAA 3HJBA 3OZAA 4OBEA 1U28C 2B30A 3AHFA 3PL1A 1HQKA 1J9GA 1A71A 1EVKA 1NJ1A 1P6QA 1QF9A 1X3SA 1M2WA 2D3WA 2WFMA 3I2FA 2B37A 4GWGA 5J23A 2PKRA 3GJ7A 2CFIA 4I1UA 3O8NA 5EIXA 1VJDA 2PH1A 2PUFA 3PL5A 4JC8A 3KKPA 4MB6A 3QEBZ 3WQRA 1U9IC 3CSDA 3IHLA 3U16A 4JCOA 1EZZA 4JLVA 2QTRA 4AT1A 1QK5A 1XK6A 1VYHA 3KJNA 1KEWA 3OZDA 5TARA 4WDQA 1FL9A 1AU9A 2V3WA 5BWLA 4JUBA 4Z3OA 4FMBB 2R8PA 3OU6A 2IUSA 1M2NA 1VRCA 3CG0A 1C2TA 3CB2A 3P9YA 3PNVA 2O5VA 3AKYA 4GMXA 3VU9B 4IHJB 2IU4A 3AI1A 4OH7A 4Z5XA 3DDUA 2GPAA 4Z99A 4OQQA 1OZAA 4FE4A 3A26A 1TX4B 3OEWA 4C0SA 1SCIA 3B5IA 2NN3C 1IDOA 2C3MA 3E48A 1HQYE 4CRWB 3GLKA 4R9NA 4AN0A 3HA3A 3KLOA 1Z5WA 1E7RA 4K86A 5F5LA 5JS8A 3A4MA 3KPWA 2NVBA 1N34B 1Z0SA 5MN6A 3ONNA 2IHUA 1V2HE 2G04A 3S1SA 1NKTA 1M2GA 4R2IA 1WXDA 2QRGA 3O03A 4YHBA 5F1YA 4Q4AB 3HMQA 3OT5A 3ZUPA 2I9KA 2ZU6A 3FIUA 4ZZ1A 3SSOA 2CXSA 4GWKA 4F60A 3NV9A 1SHTX 4UAJA 2DRIA 3X2FA 5DMXA 3WB9A 4LJ7A 4HDOB 2CJPA 1P17A 3RRZA 2X9QA 3X1MA 5FOVA 2YVQA 1DIOB 4TYQA 5ESDA 3QWBA 4INPA 4RVNA 4NZPA 4LS3A 4DV0B 3LPLA 3ABOB 4K9PA 4LMPA 4ZCPA 2Q4BA 2H1OA 5JJIA 3DEFA 4QBIA 2O8CA 1WMDA 1WW8A 3N7UA 3A1VA 2GSDA 4Y1FA 4X66B 1ZUWA 2GHIA 3TR0A 2QG6A 4W5JA 1OH7A 4TUYF 3NHZA 4TTSA 2JLXA 1Y6JA 1FCJA 3R6TA 1VIDA 4OHZA 3TGWA 3GFOA 2R86A 3VC3A 4BU1A 5BN5A 4OGFA 5DYWA 5JZVA 3AOEA 2AMFA 4QNRA 3P9PA 3IP6A 3FFWA 2HI0A 3G0OA 4L9AA 4NV3A 3SQDA 4Z1OA 3GLGA 4LY6A 3H42B 1PTKA 4E2XA 5HRUA 4L85A 1IQRA 1Y5IA 1YR7A 2P9HA 1FFSA 4K40A 1SBYA 3F6YA 1LBQA 3WGVA 5ERXA 2UZIR 3HM9A 3ETNA 3B6EA 3EA4A 3BHJA 1Z06A 1I4DD 3CV3A 1KJYA 1NPDA 1UAGA 3EWAA 3EGDA 1M7GA 1JNXX 4F3CA 2CJWA 1ISRA 1UPXA 3PGXA 2A3RA 3PDIA 2YUTA 4TROA 4MV5A 1LWOA 5LZ4A 2VPZA 2WG2A 3LH5A 2EFHB 3N59A 4MR7B 2PZJA 1J06A 2XVZA 4B6FA 4JXKA 3TINA 3PDCA 4MVYA 4HNAB 4AJNA 4EVSA 4YRDA 5KYTA 1KETA 1PFKA 1XG5A 3AP2A 3UFBA 4AKHA 4EG8A 4C4OA 1D0IA 1P3DA 3JQRA 2F67A 2WUWE 4BFTA 1X77A 1BAPA 8AT1A 5JD3A 2GA8A 2ZS8A 3DUFB 3IVMA 5LZ9A 1H3NA 5F9HA 3ICVA 3OZFA 3PG5A 4JR2A 1DUSA 3CNEA 4OAQA 3F8TA 4D2IA 2IITA 2Q2VA 3PYXA 2X1MA 3OIWA 4V2IA 1L6IA 4JJEA 5DMHA 3AEQB 2ZIGA 4IKOA 5ADVA 5F78A 2R3SA 1P5FA 4RACA 4LJ9A 5LMCA 3ZDCA 1XL0A 1FXWF 3JR7A 4ZYWA 1KOJA 2B4QA 1X7HA 1QB8A 3L82B 3NHLA 4EA6A 2JGFA 3OLCX 4DWVA 4F6CA 1U0RA 3ZU3A 3HE3A 2IBTA 3R8XA 2C8JA 4GC5A 5IH7A 4AO6A 5HTOA 2GKSA 1QPZA 3WLTA 4AVYA 2REBA 1ULTA 1OF1A 2V98A 3ZDFA 3ISJA 3I9FA 3ZX5A 4P0QB 5F2NA 3A1NA 2IS4A 2VNJA 3KYIB 1JIKA 4KIFA 2REQA 1U9YA 2ZULA 4P32A 4YI3A 3TNFA 4EJ0A 3TOSA 2NU8A 3ZWMA 4WOKA 1G6KA 5BN3B 5CBKA 1GZDA 4LXHA 4GDMA 3TEFA 3KJEA 3EF1A 1NWHA 4JGBA 4JBNA 5E9JA 4X00A 1YC5A 3HYTA 5BMVB 1SULA 1FJ2A 4F2WA 5LYYA 5EE3A 4H1TA 3MD0A 1BU8A 4R7GA 1WCIA 1W47A 2GZ3A 1GN8A 2JF0A 3FSRA 1L0BA 4OYHA 3EW9A 4UE3S 4GD3Q 4G97A 4EUNA 2PVPA 4DB4A 2GXSA 4P53A 4BO6A 5AXAA 2FSGA 1TM5E 2FW1A 4KYTA 3LP6A 2ONJA 1PRYA 2LD4A 1JG3A 2PWBA 1L7OA 2JK0A 4GOND 1YZLA 2C9ZA 1P72A 5DHUA 3S5UA 3SKVA 4QNMA 4D3SA 2WIGA 1Q0QA 1WXXA 3F2VA 1KEKA 1D1TA 2DY1A 4XWWA 1L7RA 5F35A 2CEKA 3MD9A 1K75A 4YV2A 2MJLA 1LW6E 2VT6A 1LY1A 3EGDB 2HXSA 3BIXA 3OPYI 3W8EA 3ON5A 4BQFA 3LXUX 5TB5A 1GGEA 1J5XA 3SKXA 2HCJB 4KLRA 1EK6A 4W8OA 3R5JA 1T2AA 3DMTA 1RKBA 4I3FA 4P93A 5JCXA 5P8WA 3ZY2A 4ALNA 5F98A 1W5AA 3B51X 1EQ2A 3ZG6A 1NOIA 2G9RA 3KKMA 1X1QA 2CXHA 3PDHA 3JYPA 2OGTA 2BI7A 4HWOA 5EJGA 3I28A 4FFMA 3ROXA 3T3DA 2F59A 2VJNA 3INRA 5F21A 1SCUB 1U28A 3D64A 4K9LA 4KLCA 2CK3D 2WJ4A 3TBHA 3MAGA 4ER3A 4YMUA 3QX3A 2O8EB 4BTEA 3UWDA 3C6MA 1ZD4A 4XM1A 2ZI7A 4YACA 5M5BA 3U7QB 1Z28A 1PG2A 3EE6A 3W34A 1U1DA 3FYUB 5A03A 5C3MA 4B1FA 1ONPA 3LL4A 3R0JA 3LCRA 3AIOA 5ARDA 3T1HB 4P98A 1Q84A 1U31A 3MHTA 3P2KA 4MS3A 4Y0VA 1DHTA 1UPUA 2PAAA 1E3IA 2CLKB 2VSQA 3RQSA 3K6SA 1QH8B 5SYAA 3EG9B 4BO2A 3C8UA 1JR3D 4HMOA 3V9AA 1X7YA 1T5HX 2H0RA 1FVXA 3W1EA 2UUAB 5CP8A 3AUTA 4TTQA 5EHIA 1DQYA 5FQNA 3SBXA 2V5VA 4IZ6A 3LBNA 1ULHA 2A86A 1ZLXA 4POAA 3FKSA 3O3MB 4ZGBA 3JQAD 2Z3ZA 4J1NA 2OB2A 4ZAZA 3V80A 5LMZA 1GG2A 3HJUA 1SN7A 4FFBA 4F4FA 1NVVQ 1UZUA 1RWWA 2FMIA 2JA2A 4MPTA 5FBWB 4C0KA 3R9IA 2VA9A 4LV5B 1VKRA 3L0BA 5FBKA 4MW6A 5C9ZA 4OB7A 1OA0A 4RPJA 5JPIA 3BD6A 3A9UA 1J56A 1WKVA 2FJPA 2ODEA 5JNWA 1MOZA 2I7CA 3E5RA 2QTVA 2H3EA 5IDWA 2GM4A 5IXJA 3DMTC 4X9XA 1X1DA 1ZOPA 3D1JA 5BQOA 3UOAB 4C4TA 1MOSA 2OCGA 1H3EA 2QMHA 3MF4A 1TM1E 1DC3A 1QV9A 3BPSA 3AVWA 4ZT5A 2IY9A 5IHXA 3WL3A 4Q1FA 4X71A 3RUCA 1D04A 2AJ8A 3IQIX 1AUXA 3QNWA 2VEDA 1CS0B 4I4TB 4J90A 1QHGA 4K8OA 4UDOA 1ZCBA 3EG9A 4ARIA 4DMFA 4IH1A 4J2HA 4JYPA 3I4CA 2MYUA 9MHTA 2DULA 2RFLA 5EKDA 3EZXA 3UWKA 4MGHA 3ZLVA 1CZUA 1SUEA 3FFAA 5T4BA 1Y7IA 4AUKA 5BN3A 1RE1A 1NBAA 2D0DA 3O92A 2RJ3A 2B8EA 2O54A 3CTPA 1NBOA 1P8JA 5ICFA 2QUIA 5T41A 3UHAA 1YRAA 2VG8A 4GLBA 3RAGA 2IUTA 2P69A 1R0XA 1KU0A 2FTKE 2PX4A 1K7YA 4LHEA 2OV8A 5JATA 3B3AA 1D7AA 2DHCA 1T6NA 4GKVA 4P4LA 5BVGA 3UCXA 1XZLA 3BIWA 4MP8A 1C9JA 3GJQA 4MQMA 3VU0A 2FWNA 2X7JA 2TMYA 3B85A 2QZ9A 3M3HA 2P1ZA 3G7NA 1C1HA 1H3FA 3NYQA 4H3SA 3MEQA 2G17A 2WIJA 4G4SO 3WNZA 2Y2VA 1H4TA 1CQIA 4ZMRA 2PQ2A 1RXSA 3JS5A 2RB4A 1NOJA 4ZVQA 4X62B 1VHJA 3WL7A 4E5KA 4KYVA 1OIVA 2WEKA 3CLUD 2OC9A 4LA4A 2JJ1A 4LSGA 4BO7A 1JAZA 5JO9A 3RGWS 3JATB 2N75A 1LDEA 1SB8A 2VUUA 3DDOA 5CH5A 4PTYA 1U2GC 4GWLA 1W2GA 2WU3A 1F3LA 2PGDA 2YWDA 2NO1A 1FOEB 3OWOA 4H18A 2HPHA 4HX5A 2I2WA 3I6MA 1LI5A 3MS2A 1PFQA 3FNEA 4RYLA 4U9HS 3TPFA 4C3OB 2N3ZA 4CUJA 5JJ5A 5IMSA 1A97A 1F2VA 1LPSA 2CXRA 3SYNA 4DM4A 2YQ5A 1G2OA 2BT4A 4TVBA 5EXSA 3KOOA 4COKA 4YUVA 1JT9A 4PO8A 1G19A 1W46A 3BXZA 4KGVA 4RHEA 3WWOA 4FDTA 4V03A 3T7SA 1MC8A 2X6QA 1RYFA 2BBWA 4N0EA 5HS4A 1XDSA 2B2NA 1E6MA 1ODKA 3I39X 4G3XA 1IATA 2C5AA 1E8DA 1KAGA 1IEVA 1Y3FE 1N8NA 1ZI9A 2HN9A 2VTVA 3A6FA 3CJQA 3LT4A 4FZVA 4GW3A 2DPGA 4HQNA 5C18A 3FPLA 1GD1O 2FJ0A 4FZRA 2IS1A 1DBWA 1Z7WA 1B2RA 3PYMA 4PX9A 4RKQA 4ONEA 1P2FA 1OLOA 3QKWA 3SQMA 2I1QA 3B9RA 1YONA 5B4UA 4G5OA 2NO6A 1E5VA 1GNSA 2W2MA 2I3BA 4LDPA 3TLEA 5THXA 1NNLA 3HYCA 4G86A 4A2CA 2Q1UA 1PEYA 2HQ1A 2IZ5A 3FZEA 1IY1A 4DXAA 3U7HB 2APJA 2GWHA 3KZXA 3MAAC 3RNLA 3VC2A 1PR5A 5HBGA 1ZIOA 4EVRA 1QORA 3DR3A 5A3QA 5B1HA 4CKXA 5HKKD 2V7GA 3FTQA 3BBPA 1IHUA 3PX3A 3HVRA 4DG9A 1UEIA 3DNMA 4FFWA 1US8B 2DTDA 4GXQA 2IXAA 4TQUS 4UBMA 1YIOA 1LFAA 3GZTB 2FR8C 5E9AA 5HVNA 1ZGBA 2JKVA 2Q7OE 3TE7A 1GUBA 1G8KA 3K53A 3ZNOA 3NYRA 4D0RA 2O52A 3JZDA 3WJ2A 3DF9A 3SBDA 4CIBA 3NM4A 3PYLA 1OYOA 1RBYA 5I7FA 1FSPA 2OOKA 4TV8F 1WO8A 3R75A 3KS9A 1M2VA 4S0XA 2Q3JA 3T38A 5C4IA 1FMJA 2IK8A 1NJSA 2WTXA 1XALA 4J7CA 4DCOA 3KL4A 3F0TA 4RVCA 2I2AA 1RYDA 5KYWB 1TAGA 3KB6A 3WTCA 4ZAXA 4Z6KA 1HMYA 2EZUA 2VF4X 1O57A 2BOVA 3OESA 2AF4C 1N9ZA 3CR3C 1F14A 3C6KA 3S7TA 1BN7A 2BDEA 2HGZA 2BKVA 4G0YA 4PHGA 1OWOA 2BZ0A 3O4JA 4GMHA 1AH2A 3KT8A 3E7FA 2JH3A 4E0BA 4K6MA 3IBGA 1CFJA 4P1ZA 3OLZA 4M87A 5K0JA 3W2FA 1V4BA 4G0ZA 3IRVA 5CD9A 2NNLD 3IEMA 3HV0A 2Z8ZA 2A2ZA 3E4CA 3O4RA 1GDTA 2I3GA 1WG8A 3AOEC 4AKEA 4UFPA 3ED1A 4WK4B 1Z0UA 2X2EA 4RIEA 3U7GA 4KGXA 2RG7A 4P7JA 5CVJA 1WDMA 1ZA1A 3U3KA 4B7UA 3H5NA 1VB5A 3HU2A 4B85A 1YJAA 1H8EA 1XZFA 3TNLA 3GLFE 2JIRA 3OTOB 3KQTA 1P7ZA 4G0VA 4D57A 1YMUA 2PLNA 2R4TA 5K3DA 1T9BA 4WL0A 3TZHA 3ZK7A 2QGZA 5KSWB 1VMIA 3Q2KA 3ZE9A 3BGIA 5KNCA 1MC4A 2WF6A 4XB1A 1G1AA 1ZD8A 4HEA6 3QUBA 3GGSA 1COWA 1S8AA 4R9RA 1UANA 2XYGA 1T2EA 3VTZA 3BS4A 1P91A 4BVAA 4BVEA 1F4VA 3PPIA 3GLFA 1W93A 1RQNA 1YZFA 2W4QA 1FMCA 3GNSA 3USES 1P0QA 3BWVA 4UBIA 4FHFA 3TN7A 2D0IA 3ASZA 1KY5A 3JALB 3VNAA 4NMLA 1IPEA 4EPRA 3HDYA 4TL8A 3BA1A 1KJQA 3IOYA 5I5GA 4WK6A 1Z4QA 1ZNYA 3B48A 1J2RA 3GBVA 2AKYA 2SBTA 1R3DA 2QD3A 3N53A 1AKQA 2JD0A 1R8YA 1GKLA 3P45A 4JI1B 1VYVA 3CZ9A 1GIAA 1NAIA 4HUQA 5FNZA 1P19A 2QHXA 4AKIA 2VCEA 1EU1A 1RYEA 3TZQA 3V1KA 4B33A 1WUJS 1YR3A 3JSAA 3KHKA 3R6WA 4JC0A 2P27A 4RIGA 4EG5A 1RMTA 2RHDA 1NGSA 4CCYA 5TF0A 2F4NA 2XMPA 3R1IA 4J8PA 1JU9A 1T26A 4K9QA 3GCWA 2H1RA 1IB6A 5I7EA 4NPAA 3VOTA 1CY0A 4AZ3A 1HLPA 3WGHA 4EA9A 3KSZO 1DIAA 4IS2A 2HMYB 5AJWA 2VNKA 3TK1A 5LIPA 4EAQA 4UHBA 2NZ2A 3V1YA 4LHZA 5D3KA 1L1EA 4X94A 3PRKE 3VNQA 4D02A 4QSMA 5DB4A 5DHPA 3DW3X 2DFTA 2BZ1A 4YJ2B 4C6TB 4ZTUB 1RQ2A 1CF4A 3AR3A 4B8YA 1V6CA 4C7XA 1JX6A 3QE0A 5BW8A 1HE1C 4XQEA 3TDNA 2WPDD 3FOEC 3HXOA 5G0UA 4MYTA 1UAYA 4ZCIA 4WAUA 1SZDA 2EDAA 2O2GA 1KI1A 3TOVA 4NOMA 2XMSA 3NT4A 4PS1A 4Y0NA 1YZYA 1JYSA 2VAWA 4DWJA 4IY1A 3QPBA 1W4LA 3KFVA 3OOYA 5B3AA 5YASA 1E2LA 3W6PA 5MGBA 5DSZA 5B6JA 5K8LA 4LZZA 2RGAA 1G2QA 1IB0A 1NJ6A 1PW7A 2JHGA 3R5XA 2C2YA 5IF9A 2I7DA 4CV1A 3MJSA 1PAUA 4OGWA 1ID1A 5CYPA 1P5RA 1BRTA 1KH2A 5GVSA 2JATA 4NU5A 2ROQA 4NZZA 1C9NA 1XDDA 2VJKA 3F4KA 1U3DA 4GOJA 2JD1A 4NP6A 4N39A 1Z0KA 1W59A 1N6LA 1XKQA 4O4IA 1SIWA 2C54A 1K8ZB 2GZ2A 3WXBA 3HJNA 5IJ9B 3O2QB 3ID6C 1GPYA 4IL5A 4JJAA 4NE9A 3N58A 4HN2A 1IHXA 2IS6A 2OZLA 3UPTA 2IYQA 1NMEA 3C15C 2JAXA 2WJGA 3IURA 3MCTA 3IUEA 4N49A 5BMOA 3A31A 3K0FB 1PYGA 2J6HA 4UUNA 3RYHB 4HVCA 2D8MA 1P1CA 2UU9B 1WCV1 1JEQA 2F00A 2NSYA 1GGVA 2XYVA 5EP1A 3AR6A 1A2QA 3QK7A 5JLAA 2R8XA 4RA9B 4E5YA 2P6OA 1JEDA 3FFBA 3ZWQA 5F5NA 4IZOA 4C7KA 4ZZ3A 1Q91A 4DLYA 5C7IO 5B4VA 3TRDA 4P7GA 4IQ0A 2V6BA 1YIAA 4D9BA 1YVPA 3DT9A 4BXOA 1GV0A 4HXFB 1AQLA 3UG7A 2GAJA 1AF7A 1VQ1A 4FYJA 4BPRA 1T3TA 1NA5A 4TKVA 2X4LA 4G2NA 4EFLA 3NKVA 4ZMBA 2FWAA 1PJTA 4FW9A 1T8PA 4PAOA 2VJLA 3TSYA 4ZC8A 2IYAA 4RIFA 1JAHA 1FP1D 4C3VA 3PJGA 5IJ9A 3PTLA 3L18A 3QF4A 3G79A 4TS1A 4KQGA 5DJ5A 1UOOA 4DCGA 3H17A 1VKJA 3ONDA 5AK3A 1C81A 1LBHA 1N2CE 3EASA 4GAEA 4JT8A 4RCVA 1ORRA 2D1SA 2Q8QA 4B0OA 3GC6A 3BSSA 1MDBA 2PT7A 2R96A 4YJ2A 1XL1A 3VC7A 4G0XA 3GP5A 4MV0A 1NMSA 1WLYA 5DM70 1D5CA 3OCYA 3OEEA 4I4CA 3TRJA 5C8DA 4NSNA 4ZI2A 2W8BA 4FDVA 3PFFA 4Z7NB 3QOXA 4E7OA 3OZRA 2FSUA 3LUDA 4NNJA 1EA7A 5L3VA 4F7DA 2GYVA 2QT0A 1B76A 1BX0A 4ZCMA 1Q0UA 5H02A 3MMSA 3E7WA 3R0IA 4EGQA 1MO5A 3AF2A 3OOHA 1EG2A 2C88A 1CR4A 1TEVA 3OG9A 2A88A 4HK4A 4Q1EA 5LD2C 3VGPA 5A02A 4Q4LA 3FMOB 5HF9A 1SKAA 3DKRA 1Q14A 3U7QA 1IY2A 2ATCA 2PGAA 3EZFA 1ENOA 2VDRB 3AUXA 3EMVA 3HWSA 4YBRA 3UWPA 4DMRA 1XJCA 4YV7A 1EGHA 4CTMA 5BYAA 1WZCA 2AFIB 4K1LA 2J4DA 13PKA 4F4JA 4BP8A 1BWPA 1U1EA 1V5IA 2FF5A 2XRYA 3ITNA 3E9YA 2I99A 4Q9DA 4UE2A 5F3DA 5K3CA 1Y9ZA 3SMQA 4GFDA 4I50A 4NOLA 1WCIB 1VJ0A 3MOSA 5BY2A 3OPQA 3QEMB 3A3PA 2Y1KA 5CB6A 5B58C 5EZ5A 4JODA 4JT9A 1RYZA 2FZEA 5DYTA 3RAJA 2ZE5A 1BA3A 5T4EA 5KO2A 2FGKA 3G23A 1WVGA 4HGYA 4BNTA 1M5UA 2H1WA 1G4HA 4NE7A 4V02A 3TFWA 5HHTA 2C3PA 2WVAA 2XUZA 4QPNA 1Z6YA 3CZ4A 1M73E 3H05A 4ZYZA 3UBTA 1EFTA 1G8HA 1CKEA 2ZROA 1FFXA 4X6UA 3SJ7A 1U4OA 4JBLA 5DSTA 5H3HA 1KO4A 2ZM5A 2AWNA 1Z36A 1FFDA 5EL0A 4PG7A 1YU6A 3KTAA 3JD2A 3V8BA 5AVRA 3RFUA 4LF9B 1C4XA 5FULA 3PUXA 3H2YA 1IUNA 1UBLS 1GY8A 2J4FA 5H83A 3W77A 1CRPA 5HA5A 3SZUA 1NQUA 2G0NA 2NZYA 1N4AA 3RROA 4YASA 5DBFA 2ATIA 4P81A 5HE8A 3UAZA 3ZK8A 4ENUA 2FF7A 4DV7B 1RW4A 1UEJA 2QM0A 3LXMA 4V38A 1LSOA 4OTZA 4CR8A 3DO8A 3R3SA 3I4LA 3TE6A 4DA4A 1NKSA 3W3AD 2R1TA 5A3JA 1XDUA 2QRVB 3LK6A 5K6AA 3BMQA 5I47A 1UAAA 4X7RA 2XHZA 1TI7A 3BD8A 2QWXA 2O0KA 2WV7A 1Y6RA 3RRBA 3RSLA 3RYFA 2MT9A 1M6VB 1LLQA 4D3DA 4OJMX 3FYUA 4U5XA 1ZONA 4QULA 4BQOA 3IE1A 5IC4A 1W36C 4PTLA 1SCBA 1LI4A 2AXEA 4LIPD 2AN1A 1XRLA 3IIIA 1O6BA 3HXLA 3LQ4A 1E2EA 1ZUIA 2WUEA 3NTRA 2CWWA 3JAMA 1R8XA 2D74A 4H4DA 4DQLA 2QUAA 4JMLA 4L8FA 5K6RA 2EFDB 4MV9A 3S68A 2YIDA 2OO5C 3HUDA 4B2PA 2O8CB 4L3WA 1JV2B 1NC3A 1HTBA 2GBPA 3M4YA 3A6DA 5D87A 3F5MA 1VP3A 3IP1A 3U9SA 2QGFA 2R751 3WLOA 1B1CA 1J8QA 1E69A 1I6LA 2QJWA 3ITKA 4BZXA 5CFLA 1C3EA 1E1QA 1HDIA 2RGYA 3G7SA 1NHWA 1XEFA 4IXMA 1GILA 3DHVA 2DPHA 2EJTA 4GYKA 4CXMA 4PC3A 2XQFA 1P4HA 3DXYA 2R0QC 2NVWA 1DAGA 2VQDA 2QSYA 4LECA 1RMQA 1U0HC 4M8LA 4RU1A 5AW2A 3ANMA 4KREA 1JHRA 4FNGA 2W6QA 1ULBA 4MGKR 4MV1A 4IEIA 2ANBA 3DZIA 1ORHA 3PI6A 3DXXA 2XHEA 1NVBA 3AEKA 4QVKA 1T3ZA 4CLOB 2QI9C 4C4AA 3TMYA 5FI3A 821PA 1OT5A 1PDOA 4CV2A 1VSUA 3OLWA 2C7GA 5FHRA 1J6UA 1MXFA 2W2KA 5KQLA 1KSGA 1QF6A 1OLXA 3VSCA 1VB3A 4LRXA 1X8LA 3KYJB 4W1PA 4YWHA 3GUVA 2P78A 3ZWVA 1TD9A 4EKEA 3D8HA 2JAPA 2C5SA 1QTIA 2Q50A 4HPWA 4MNTA 2LWIA 2GDZA 4UBNA 3WADA 1II0A 4M8NE 4R8MA 4AO7A 4D9CA 4CEHA 4PCUA 2CV0A 3WKEA 2YQ4A 4O0MA 2QDXA 1LPPA 2NU8B 1ZCZA 5CIWA 4XAQA 5MHTA 3QBJA 5DN9A 2ERYA 1SUWA 1ZJJA 4L7QA 3V5NA 1KO8A 4OLBA 2FAXA 1Q1EA 3KJGA 2P3SA 1JR6A 4CCWA 5BYKA 5FT9A 3OPYA 2Z6AA 3K3PA 1O89A 2VNAA 3GEHA 1G4UR 1MB4A 4RNDB 5EUMA 4CN9A 2O20A 4ZI7B 2VP6A 4ND1A 4ZALA 1GNPA 4CN8A 2ZTHA 3IP9A 3EGXA 1L1RA 1L1QA 5K8TA 4I9FA 2HZBA 4NU6A 1FYDA 4CBVA 1KFEB 1UMCB 3G2NA 4QDXA 1RHMA 3WGJA 3WL5A 5J4HA 4URXR 1W76A 3V4RA 3E1SA 5HG0A 4P84A 2QPAA 4HAYA 3R24A 4Q9NA 1RQRA 3IPYA 4H7HA 2FSFA 5D51S 3RVRA 1JEYA 4XDHA 2RGXA 2XOKA 3AUYA 4P22A 1LDYA 5FUYA 2C5GA 4A26A 5JI2E 3ETHA 3OO1A 1H5QA 4O6VA 4TWBA 3DFIA 4WCVA 5I7OA 5KI6A 5JD5A 1UMBA 3IAM1 2XOXA 1H1TA 2E87A 3CF6R 1XELA 5BOVA 2VYND 3OQ6A 2C3YA 1MZVA 1QE5A 2QTCA 3R77A 1Q6YA 4CTJA 2CJFA 1Q17A 1R12A 3F3SA 4OBBA 3PA8A 2YW9A 2QX6A 2R85A 2VJYA 2VR1A 3H1PA 4FHZA 2AMLA 1ULAA 4NKRA 2CKDA 2PFSA 3Q15C 4FINA 4YN3A 3NT2A 5IJXA 4YUZA 1N2GA 2GO1A 1STOA 2UZAA 2A1IA 1WV0A 3EQ2A 1I9CA 4Q00A 4TS4A 5AJTA 4YV0A 1X42A 2WTNA 4DIDA 4O4IB 4CMHA 4QDZA 2H6EA 4Q7LA 4CMBA 1JZSA 3FTPA 3W1WA 3MRXA 5C7YA 4GDFA 1W4CA 3GRRA 4N7RA 3AHJA 5L3ZA 4CLOA 2VDNB 3DQPA 1X14A 2DAPA 3IR5A 2AFVA 2ZJZA 3SXJA 4C6RA 1OCEA 5GMOA 1UPFA 1JDZA 2R7KA 4G65A 4ITVA 3NEAA 4KN8A 4XUDA 1FRNA 1D2RA 2ZRJA 1GRRA 5HGXA 3QYJA 4ZWNA 3O8OA 4RA9A 3KBOA 3HU1A 3L0ZA 1JKMA 4R98A 4N4AA 1IFXA 3DHYA 3UN1A 5LVAA 1P5HA 5I9TA 3AB7A 4AJ1A 1RLIA 1T5LA 1M2HA 3CYFA 4RC9A 1CY4A 4KN6A 1E7YA 1YZNA 4MUGA 3GGPA 3TEMA 4PYMA 5GVRA 3X2SA 1SCUA 1Z39A 2NVOA 4ZGGA 2GHQA 2ZAOA 4A6DA 1BYIA 1UADA 4W6ZA 5TGZA 3BZBA 4F4DA 2L19A 2C9DA 1R74A 1E0JA 1LVUA 2LBPA 1I3NA 4YT5A 2BUAA 3AEKB 1E6KA 1X1SA 3EISA 3VZRA 2I4TA 2FSSA 5JWRA 4LMRA 3NJRA 1WM1A 1WQ3A 2XT6A 3CZAA 5FUWA 4CIWA 4CKEB 4WVFA 4ARCA 2VN8A 3PQEA 3LQ2A 4CLDA 3U09A 2XCSB 2W4MA 1W4BA 1RR6A 5ULLA 3RV4A 3P94A 5B7NA 2QVBA 2PWZA 3G2PA 5CVEA 1DB3A 1ES9A 1HLDA 4NCXA 4M1OA 2Q5CA 4BMNA 5IM4A 4J49A 3RYHA 2HT1A 4K28A 3TQTA 1E0AA 2W6PA 1GSIA 4HQKA 5CXUA 4MROA 4II7A 3FSGA 1PZEA 2VXOA 3HB7A 5E4YA 1PNOA 4ITUA 4OB8A 4X1IB 1GZUA 3K35A 1KU6A 1VLMA 4DJTA 3MGAA 3VR3A 4QATA 4Z2AA 2VPPA 3KVNA 1SEVA 3JAWB 4Z7OB 3QG1A 3E9ZA 4NENA 4DMHA 5AI5A 3ZBUA 1Y63A 4QUAA 1QO7A 3RUPA 1B0ZA 1IBCA 1UFVA 1V41E 3M49A 2OORC 3IJRA 3LHIA 3FKJA 3NHJA 4GR9A 4JN6B 1JQDA 2Q5HA 4KX3A 2ZJFA 1KZGB 2KM1A 3CH4B 4HDNB 2LDBA 4A2QA 4ESEA 4RV4A 3SEAA 2VPWA 2C31A 1LWNA 2C8VA 1ZWKA 2B5VA 3QI2A 3VSDA 3E3NA 3D6TB 4N5HX 1Z37A 2QD4A 1NBME 3KUUA 4WZAA 4BFZA 1W35A 2WMDA 4OXKA 4HWRA 5BNFA 2W11A 3BJZA 4RFSB 2ZRMA 1J2EA 3NFYA 3T7DA 2QB5A 3O8QB 2DKFA 4MVXA 3UWOA 2MU1A 2YWJA 4UZFA 2ADFA 3ZV7A 1LBSA 2EJWA 3QVWA 4PZAA 4JZKA 4DR6B 4AP6A 2ID8A 1ZBDA 1QHYA 1X9HA 2EJBA 4EQZA 4J4HA 3GO4A 4LVUA 3IX7A 2OLKA 3LGAA 5A6SB 3TI7A 1TZMA 5EVCA 3WIUA 1FNDA 3KYDB 4LYEA 3NJ8A 3EPRA 1QJ4A 3ND9A 2VI5A 1MBZA 4B47A 2HL6A 3SR4A 1V1RB 4HEQA 4Y6SA 3N07A 4L6CA 1GTMA 2WWRA 4C7BA 4ENRA 3U60B 5JMTA 4CEIA 3VAYA 4DV2B 4RDXA 3UC9A 2AN3A 4F97A 3K9BA 3P0FA 1C4KA 4PZ0A 3W5CA 1THMA 4QC2A 2VSFA 3GEIA 3OCWA 1V71A 2GSWA 3WK9A 4B3JA 5A4DA 2Q9UA 4RS3A 3GR6A 2D2EA 1HL7A 1JLSA 2F3PA 4WLFA 5CHYA 5BVHA 4IFIA 4GPD1 4XFKA 2Q3CA 1EDBA 4Y67A 1T8WA 3G6KA 3IOMA 4BV3A 2JIMA 1AKTA 1S2NA 3W9BA 4B6EA 1UEXC 2XYQA 5ALVA 5I3ZA 1T36B 6YASA 3GLHE 1EE9A 1PNVA 1EI9A 1AKWA 1BDMA 2W0SA 2Z9DA 3IDAA 3NBMA 3Q3CA 5ESRA 5ABPA 3R7BA 4EDFA 2VA8A 3R3UA 3QXGA 3TRKA 4QIHA 4TYWA 2VJMA 3CLSD 4LSWA 2IX3A 3GN1A 1PBNA 3OOSA 2ZSDA 3T3IA 3EXG2 1DCTA 5I4CA 1YJQA 3K1JA 5FWXB 2GEFA 2KLHA 2VF7A 4A5OA 1WMEA 1R6VA 2ZE7A 1SK8A 3STWA 9LDTA 5LKRA 4JSRA 4NEGA 4U2FA 4ER0A 1GEEA 1LI7A 2PT5A 4HRYA 4JLAA 5F33A 1CQJB 2P1RA 2HIMA 4MUMA 1M10A 2QL9A 4CEIB 3M5CA 1JDNA 1PG5A 5AKEA 1IRIA 2PZEA 4CM7A 3D7LA 1RHQA 1W5BA 1ZVKA 3ZLTA 4UVIA 3K30A 3WSVA 1UPTA 2ZTLA 2OORA 2B6NA 1S2MA 3AY0A 1XQXA 5FBVB 2M9MA 1SBIA 3E82A 1ZU4A 5EIAA 1J2YA 3KFXA 5HZGA 1KQGA 1YB6A 2W5UA 3ETDA 1AZWA 3Q8KA 4TZ6A 3ANSA 2WSLA 4PXYA 2V7EA 3USZA 1R0YA 2ERXA 5LYJA 4F86A 4DCUA 3T7TA 3VBCA 2YXBA 4XGIA 3LT2A 2FFQA 5BURA 4MMXB 4RZ2A 5DW0A 2XX3A 3K7EA 3LHFA 4IDOA 5AXDA 2Z0MA 3A4IA 3U26A 1OHHD 1Q1AA 3SM9A 3KSBC 1WA5A 3WMXA 2VNHA 1Y8RB 1Z2PX 4CM3A 1N6RA 2COKA 2P2SA 3BFVA 4HNVA 2JGDB 1LC3A 4ZMSA 1GR1A 1W1IA 4TV9A 3R8CA 4B2IA 4RTOA 4A7PA 4AUMA 1SOMA 3PUKA 1F0NA 3IB6A 3OT1A 4HGNA 3I64A 4E33A 3S28A 4MWDA 1TCAA 2OFWA 3QVUA 4JD5A 3G2JA 1WTAA 1ZRMA 1Y1PA 4IIVA 1IZ9A 5IM5A 5JAPA 2OECA 1QLHA 3K9QO 4CF4A 4PLPA 2AMVA 2I2FA 3S2GA 1HNXB 2R68A 5JDCC 5KJ6A 3WOHA 3HJHA 1NHGA 4E4RA 1P75A 1EUCA 1MVNA 2J5RA 4RHXA 4DIKA 1KDTA 1Z63A 1EWYA 2W6OA 2CSXA 3BSWA 3WGQA 2Y0EA 3TQSA 4YRIA 1V6AA 3G2OA 3DBIA 4OHBA 5FXMA 1ZCJA 3OJXA 3DDCA 3LCMA 4NBLA 5BUZA 2ZM6B 2H5IA 3H18A 3DEZA 4OHXA 3GLGB 2GNOA 3SX2A 3DOIA 3WSWA 4J2OA 2P8SA 4RCZA 1WPGA 4RQBA 3AMVA 3CXRA 4F71A 2CLHB 3GN2A 4G67A 5M2QA 4YJ3B 2BFFB 3O75A 1MV8A 5J1TB 1KZ6A 3UQZA 2FU5C