2ZVQX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and alpha-naphthol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
b'DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 106
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvqX00
4AKHA 3CZQA 3U3MA 1IONA 2WMNB 4QM6A 4LHWA 1U8ZA 2UKDA 4XTCS 2XTZA 1X1RA 4Q4LA 1WF3A 3D8BA 3FKSA 2F3TA 4A15A 2ZYTX 1VIYA 1ZNZA 1R5OA 2AKYA 3ADCA 2GAAA 4XWOA 2QBYA 1NVVR 4KYIB 1XMJA 3ZJYA 2D2EA 4RFSA 4DZZA 2Z5FA 3B1XA 1ZD1A 3WMFA 3AB3A 1EX6A 2IWRA 5FPSA 5CYPA 4I4LA 3ZQ6A 4LY6A 5C46F 2XXAA 3QY0A 2ZETA 1G3QA 2RMKA 1U9IA 2OBLA 3AF0A 4JSTA 1E2KA 4OI4A 2Q3MA 2IYXA 4AI6A 3GLFB 1YR7A 3EZ7A 4Q19A 4TLDA 4ZCMA 4JL6A 4M1SA 3GP8A 1W4BA 2H92A 2CE2X 3RANA 3EIHA 4DRZA 5IDVA 3VR2A 2ZI9A 5EXXA 4AIIA 5FPKA 3U6BA 1FP7A 3AEZA 4KLZA 2ONJA 2UVQA 4YLGA 1N5IA 4F92B 3WP0A 4LYJA 3IIJA 1CTQA 3I8SA 3CB4A 3AUYA 1VG9B 3M4YA 4MKIA 3V00A 1EFTA 1HYQA 1TL7C 3S1AA 5HCNA 4M4SA 2WTUA 3VFDA 4H9GA 5LPNA 3L82B 4F7WA 2G0TA 4XOIA 1T5LA 3W3ZB 1HY3A 4RZ2A 5BWMA 1E2NA 1ZP6A 3AQ4A 3VNVA 4AG6A 4PC6A 2QP9X 3LQQA 2G88A 3BB4A 4NYMR 4P33A 5HZKA 3C14C 4G3XA 3RRNA 3U5ZB 3IUYA 4LYHA 2O8FB 2IF0A 3QPVA 4LJYA 4LJ9A 3KTAB 3EZ2A 4BFZA 3LQRA 3DVLA 1HTWA 1KZGB 1G17A 2V6JA 3QOFA 1VG1A 1CULC 3DMDA 1N6IA 4QM7A 1N0UA 2FSGA 1G6HA 1D5CA 4WAUA 5FR1A 2OEPA 1GL9B 3K70D 4DLVA 1X86B 2OG2A 1Z47A 4K8OA 3P4YA 4ASUA 2OO7A 2FEOA 3WRYC 1H8ED 5JFGA 1IHUA 3N2IA 4UNPA 2H1LA 4LPSA 1GKYA 1OH8A 3GLIA 1GFIA 2ODEA 3QKRB 5LB4A 1BS1A 1NI3A 2CCGA 1Q1QA 2BCGY 5TV2A 3N5CA 4TSFD 3HPQA 1GITA 4IVRA 1XD8A 1XXHB 2R44A 3L0OA 4A0RA 1XEXB 2HV8A 3CF0A 5KYKA 4B3DA 4TMKA 2ZRGA 3ZH9B 4CEJA 2PX3A 5HTKA 2QM8A 3WYFA 2FDCA 1G64A 3FWYA 3MJRA 3QVUA 2IXEA 4TLEA 1II8A 3THOA 1CJKC 2Q21A 3SBDA 2HXSA 4P4UA 2JA1A 1LS1A 1LV7A 3QXXA 4D0GA 5J4YA 4HAXA 4HZUB 1E2JA 3ZVNA 3X1DA 2OAP1 3RSLA 4LRWA 3LBIA 2DYKA 4W5HA 1CS4C 4HSEA 5EUMA 4PAOA 2VIIA 3U7EB 4R2HA 4FWTA 3DPUA 1KMHB 2C96A 5JWOA 1AZTA 1JJ7A 2YWGA 4C0KA 3E70C 1JXOA 2ZE7A 1XTJA 3Q3JB 4UXJA 2BVNA 4UKDA 3GCGA 2XNSA 1FW6A 2AKAB 5J4HA 2GETA 5CK4A 4PHGA 2AD5A 2AFIE 1OXXK 1NG1A 2AN9A 2Q9CA 2FG5A 2XX3A 2F1RA 5AJXA 1T0HB 3RRYA 5HE8A 2ZSDA 1GUAA 3A1TA 3WP1B 2X2FA 1AK2A 1JQLB 2EWVA 4QBFA 4BE7B 5EE5B 3T61A 1E98A 1I4LD 2G1KA 1E2MA 3EZ9A 4QJ5A 4FI3C 3KUDA 2KI5A 4B3CA 3V4RA 1R5BA 4KI0A 5L3SB 3T34A 1Z06A 4G5SA 2VLIA 2Z83A 4HDQB 4LJ6A 2ORWA 3C16C 4ARZA 3MFYA 2QA5A 1US8A 2WICA 5DI9A 4IDQA 1IN8A 1OE0A 2ZI5A 3L2OB 4OYHA 4Q03A 3BS4A 1RJ9A 2ZRNA 2IYLD 3A4MA 3GLHA 5UKDA 4GSYA 1P60A 2W58A 2G6BA 4TMTA 4DBLC 3M6AA 2IYVA 5KNDA 4RVCA 4A0HA 1FX0B 3CLVA 3N2EA 1EFCA 4CZ2A 4C7OB 4DDWA 4OHVA 1IN5A 1LF0A 4PZZA 5FL3A 4ON9A 5B64A 1GP2A 2JLSA 1N2CE 1SHKA 5JWRA 4H1VA 2ZYUX 2A5FA 3FHCB 4HI0E 1L8QA 3B8HA 4Q4AA 1DARA 5HKKA 1QDEA 1XU4A 1GDDA 2WJHA 3EAQA 3TUJC 4KFRA 3TQFA 1P72A 2HF8A 4QL3A 4IXMA 2WKQA 1UDWA 421PA 1N5LA 1SXJB 3UIEA 4JLJA 4KBFA 2D74A 5FOTA 5DE3A 3A4LA 2R9VA 4CEHA 1OHHD 3CRRA 1OYWA 2CDNA 3A8TA 3QF4B 3ICQB 3TR5A 5JZVA 3ZVMA 2EVWX 3IKJA 2A78A 2V9PA 2ZEJA 3RRMA 2QE7D 2R8RA 2NMVA 1GTVA 2NZJA 1R0YA 3PIRA 2C04A 2VA8A 1AKYA 2I3BA 2CK3D 3RSOA 1XCPA 2FWRA 1SVOA 2AR7A 1FUUA 1KDRA 2BMFA 1AQYA 4DLXA 1W7AA 5EXPA 1HQYE 4HYYA 3LBHA 3CZPA 4LJ8A 1X8KA 1KJZA 5D3MA 2ZRPA 4MRRA 1KI7A 5SZIA 5AUPB 3I5XA 1XRJA 4YMSA 2P6UA 3LW8A 2JJ8A 2QP3A 2VHUA 3BGWA 4B2IA 1D6JA 2J87A 2ANBA 3KXIA 3KZ1E 2KSQA 4L5BA 2IWHA 4OI1A 3W8RA 1QG4A 2R6CA 1FMLA 3CRW1 2CLSA 3PV0A 2QE7A 1NMYA 4CT4B 1E4VA 3IO5A 3I62A 1VTKA 1OT3A 3FHOA 3RVBA 5FTLA 4LBYA 3T1VA 1XDBA 4I81A 5BN4A 2XNDD 2KE5A 4POAA 2Q3HA 1U81A 1T0JB 1U8YA 1W2GA 2AFHE 4JBWA 1GAJA 4HB0A 1E9BA 1NBMD 2R6FA 2W2VA 2GJAA 1P2SA 3EIQA 4G01B 1I2DA 1U0LA 2QAGB 2CVHA 2ODWA 4TQ9A 2EYUA 3GLFA 1UAAA 1EFHA 4HAUA 4MUAA 1RKBA 2OSBA 3OEEA 3T35A 1ZM2A 4C30A 5E7MA 1G18A 3K1JA 4DLRA 1R2QA 4RKFA 3VKGA 2JJ2A 4XH9B 3NHBA 1CIPA 2BMEA 3AF4A 2IL1A 2J0UB 3Q8XB 5BN5A 4GZMA 1W0JD 4DSUA 4E07A 3O8RA 5JHGB 3IQXA 1Z2CA 3MAAC 3KKPA 3PQCA 1IXSB 3B78A 4Q7JB 2PCJA 3QXSA 4B6FA 2R6AA 3ZD6A 1UFQA 4HLUA 2Q6TA 1I4TD 4GT1A 3GLGE 5CB6A 1XZPA 1N6LA 3KXKA 1YZLA 4KU4A 2CL7X 2D2FA 3LVQE 2DWQA 3W9YA 1Z08A 1WB9A 2GJ9A 4LK2A 2ZPTX 4MUBA 4E03A 2GAOA 1P3JA 4TYQA 3VHXA 3EWSA 4V0OA 5AK0A 3T06B 1QF9A 5K8TA 3BBPA 2QTVB 4BEBA 2O8FA 4BFSA 1MO5A 1T3HA 2NO6A 3KTAA 2IHYA 4F4JA 4URZR 4Q5IA 3EZ6A 3KJGA 5F2EA 1G5TA 5J5CA 4JVLA 3AVUA 3BD9A 1FTSA 1W48A 5A5GA 2F7SA 3CKLA 1YJ5A 4KV9A 4F4CA 4WXPA 1ZBDA 5HR5A 3MWKA 4OI2A 1A1VA 2ZRIA 3QEJA 3CX7A 3VAAA 2AD1A 3EXAA 1F6BA 4PANA 5F98A 2YVUA 5CK5A 2JCSA 2W2TA 1V43A 3U60B 5JI2E 2H18A 5E7JA 4OQLA 1HH4A 3QKRA 1N6RA 1QVAA 2ZRKA 4B44A 2DWOA 1ZCAA 4Q4HB 4LZZA 4ERNA 4TT3D 4TZ0A 4D0LB 2VP0A 1XXHA 3CRMA 2GBLC 1M2OB 1XEXA 4JSYA 1OPXA 4URYR 4Q9KA 1U90A 2FF7A 4M0LA 2RB4A 4KJZA 5H68A 1U98A 2QMOA 1QZXA 4B3GA 4GFDA 4XIGS 4GOKA 1W36C 1XMSA 5GVSA 1DVRA 2FFAA 4DCTA 1Z0IA 5SZHB 5LD2B 4PC3A 3NTUA 4X8LA 3TRFA 4ZDJA 4FMBB 3ZVRA 4BASA 4JKIA 5GADl 4WZBE 4D4JA 3DZ8A 3G0HA 3RS2A 1GVNB 3FOZA 4HZUA 2PH1A 1E2DA 2NO7A 4M9QA 4CGZA 4JMPA 3VU9B 1BKDR 2ZJ8A 4TYPA 4TT3A 4Y0AA 4URVR 1KMHA 3BFVA 3IQWA 1Y3AA 4MRVA 2J7PA 2C8VA 3C8UA 5EQTA 1W46A 1R10A 1MR3F 2QGZA 4AC9A 3E1SA 3P32A 3U3KA 4HLCA 5E95A 2FPMA 4II7A 1S9DA 1P73A 2YWFA 4JJKA 3W8NA 1KJYA 2GILA 2MMGA 2I1VB 1BOFA 1DOAA 2P67A 3PITA 4JLPA 2QENA 4XVQA 2K5UA 3B7GA 4KAXA 4US2R 1WBBA 2Q9AA 1UEIA 5L3SA 3E5HA 3AH8A 2ZR9A 3KKMA 2F1HA 4HUTA 1W0KA 5DIFA 4C0JA 4LJ5A 4R7ZA 3LDAA 2JDIA 4QGHA 1U0HC 4MA4A 4QNMA 5FBLB 1I4DD 3C15C 4UNRA 1ZINA 2CL6X 1CEEA 3MJHA 1E1RD 4LBWA 1FX0A 2XJ4A 4C7OA 4NE2A 5F9FA 2G1JA 4BPBA 2EWWA 3R9IA 1NNEA 5DISB 1KSFX 2JGNA 1G7CA 1F2TB 4ZKEA 4M1TA 2B7CA 4A8JB 3NC1C 1S4QA 1DAHA 4JLAA 5TB5A 3M1IA 4TQAA 1MOZA 2FOLA 1Q20A 1VECA 3U44B 1AM4D 2ZS7A 3EG5A 1F60A 2ATXA 4RCZA 3JVVA 2WBLC 3LY5A 1SXJA 4M9XA 3TQCA 4HB3A 4AYWA 2HJVA 3QNUA 5JRJA 3H86A 1FZQA 1UBEA 4TWZA 4DUGD 2WM9B 3LA6A 3GJXC 1UPTA 4LI0A 4K46A 3QF4A 2ZXUA 3SZRA 4JVMA 1ZUHA 1E1RA 2PL3A 3AP2A 4XD7A 2OILA 1TQDA 2IYZA 3RWOA 4JJZA 5CDFA 3TK1A 1H65A 4A82A 4BRUA 5FR2A 2QSZA 3A1VA 4DB4A 3NH9A 1IJEA 4RFVA 1DG1G 1S3GA 2REOA 4KLNA 3BC1A 4IDOA 5AJVB 4U00A 5J4VA 1SXJC 2H5EA 1KO4A 2WPDA 1JPNA 2GXUA 1LY1A 4QBHA 4U5XA 5KOYA 2A5DA 3MG9A 3KDSE 3BE4A 2PBRA 1PVOA 1ZMXA 3RS5A 2O8DB 1ZM7A 4NCNA 4BZXA 2N1BA 4NYJR 1M74A 4F93B 3QXHA 3BH7A 4OHWA 2NO1A 2V55B 1B23P 1MO3A 1VYTA 2ZRAA 4UNSA 3SHFA 3VQTA 3VX4A 3PUXA 2ZJYA 4XVUA 4LX0A 1E96A 4PFSA 4AURA 1NVXQ 3DDCA 1D2EA 4LV8B 2BEJA 1XTIA 4KFTA 4KO8A 2IYYA 1VCOA 2JASA 1ZNWA 2OBNA 1QHSA 2YZ2A 4XVRA 2QUZA 1G41A 2L0XA 1NLZA 2GCOB 1E94E 1XWIA 1XB2A 1ZNYA 1E2IA 3LW7A 4JS0A 4OHXA 3W90A 4AK9A 1OFUX 4AKGA 4OK5A 5BXQC 2BC9A 3TAUA 5DNYB 1NY5A 4B47A 2JLYA 4ZIRB 3CW2A 2QAGA 2RAPA 4L9WA 4BLSA 2Q0HA 5CITA 1TEVA 3GLIE 4MYHA 4DLZA 1JNYA 1C1YA 3REGA 2DHRA 5FOSA 1CJTC 1EK0A 1XPUA 2D7CA 1KAOA 2BBOA 2QU8A 3L8ZA 1WA5A 2B6HA 2GJ8A 2OFWA 2WKPA 2X8AA 2ZR7A 1RE0A 2AK3A 2J0UA 1MO6A 1JJVA 2W6JD 1ANKA 4ZCIA 2FSFA 3Q85A 5G3YA 4IOMA 3UMSA 1GL7A 3WMEA 2GDJA 4BEJA 2H16A 4YMVA 5B57C 5JHHB 4I1OA 4LHZA 2ZE6A 4WZAE 2VSXA 4MGKR 2PX0A 3BFXA 1Q22A 1TF2A 5EP4A 3QBVA 1YR8A 4KYUA 5HCIA 2OCAA 1CR4A 2QTHA 2XSZA 1GWNA 2G83A 1AS3A 3NC0C 2GF0A 3THWB 4M2LA 1YZUA 1S2MA 4TMZA 3TAHA 1G291 3QG1A 4PAQA 1AS2A 3C5HA 2VHTA 1PLJA 3VR5A 1CU1A 3CR7A 3F8TA 1VHLA 2ECKA 5ANRB 1SULA 2E9SA 3AF3A 4N0DA 4FMDB 3IO3A 4NZYA 5TVKA 2FMXA 1OIVA 4N3NA 5IT5A 2FZLA 2OLJA 4C0AC 3UWKA 1ZIPA 4PPFA 5EE3A 4MDEA 2ZSEA 3R20A 1JQJC 3AV0B 1NVVQ 2BKEA 4I99A 4B48A 4YQFA 3EA0A 2P3SA 3NIBA 5TMPA 5FBRB 3IPYA 1OXTA 1KO5A 1NLYA 4GP6A 2MSEB 2WJVA 1P6XA 1XF9A 3SJCA 2OFXA 2ASEA 4AG5A 2HYDA 1UJ2A 4JLBA 1J90A 3C4JA 3ZIAD 3TW8B 1CF4A 1DADA 1OF1A 2QY9A 2YV5A 1EESA 1RFLA 3SHWA 2O8BB 4CIDA 2XZOA 4NYIR 4DJTA 3PG5A 3THYA 1MKYA 4Q4HA 2OCBA 3DM9B 3IIKA 1VMAA 3W34A 2JIZD 1KO7A 1YZGA 2D62A 2D4HA 4KODA 4QGAA 4E22A 3GLHE 2CHVA 1S8FA 2GXAA 2J59A 2IC5A 1E79D 3D7MA 3VR4A 1EWRA 2DFLA 3A1WA 3AKCA 1HE8B 4CRWB 1NY6A 4V0MA 2BM0A 4O3MA 4Q9HA 1RRCA 2AXPA 2ODBA 1F2UB 3O47A 2QGNA 3AF2A 1N3BA 2VQSA 1LF5A 2IF2A 2RGNA 3HPRA 4JYCA 3W3AA 4PSVA 3UG6A 4BFVA 1NJGA 3OEHD 4DIDA 1Z0DA 3PUZA 1G19A 2GESA 2JJ1D 2H57A 2KB0A 2UZIR 4QOSA 4NYMQ 1NG9A 3VU9A 1KZ7B 4OI0A 4IRUB 1G4AE 5FPTA 4J0QA 1CRPA 3K8YA 1U9IC 1KSGA 4AWXA 4IVQA 2EFGA 2QNRA 2GXSA 3FFAA 5EE0A 2ZSAA 1P9NA 1YZTA 3SN6A 4V0LA 1E2GA 1VYVA 3DZDA 1GIAA 1ZAKA 4Q9IA 1E79A 2WSSD 5JECA 3ZVLA 2WIAA 1RC8A 4Q48A 3K0FB 721PA 3MLEA 1A82A 4IKEA 1RW4A 1X1SA 1IN6A 1EWQA 4MITA 4R98A 1NSTA 4O2LA 2VP4A 2WOOA 1E69A 4JYBA 5AUQA 4YMTA 2YHSA 3TIFA 3EC2A 4RZ3A 3BWDD 3K0AB 2R6GA 3IPXA 5JLJA 1G21E 1XEWY 3M0EA 3CONA 3BERA 2ZVPX 3LWNA 4NU0A 2GNOA 2ZANA 2XOKD 1E2HA 2DBYA 2DR3A 5CIWA 3WYGA 4Z1MD 3D3QA 4IDNA 1TUEA 1TF5A 1U94A 2ERYA 1VG0B 3KKOA 4MRSA 2REXB 4CW7A 2GTPA 1HQCA 2BWJA 2GEUA 4JKYA 1UEJA 2PZGA 4AY2A 2YC2C 4DSOA 1ZCBA 2BM1A 5G53C 1AS0A 1MO4A 3GD7A 2WWXA 4X8MA 1R4AA 4BLTA 4I1VA 2BMJA 3H2YA 3T12A 3N70A 2A7QA 4HUQB 2QMUA 1G8PA 1F2TA 3MCAA 1DTSA 5JBQA 4A8JA 3KJIA 2V54A 3WBKA 5FBVB 3Q72A 2FX3A 3OIYA 1QHIA 4TQUS 2FV8A 4B3BA 3U44A 1DAMA 3DOFA 3AKYA 2LCFA 2OZEA 2YWEA 3GFTA 2XOKA 4Z1MA 5DN6D 1E32A 2F55A 3GLFE 3LXXA 3D6TB 1E2EA 1H8EA 4RD1A 2XB4A 1OXUA 1TQ6A 4B3FX 3GQBA 2PZEA 1DG3A 1AZSC 1EX7A 3KKQA 3B1YA 1N25A 4D82A 3KB2A 1II0A 1HEIA 1XMIA 4TSFA 1VCMA 2C9YA 1XPOA 4AYTA 1NN1A 1W4AA 1WXQA 3QG5A 2IK8A 1EG7A 4DLWA 1FQKA 1ETUA 3DEFA 3MUFA 3ZZUA 3MGCA 4EQ6B 2ZRBA 2JLQA 4OQMA 3TE6A 1N6OA 4MYCA 1H8HD 2FA9A 3EX7C 3K70C 4ZDWA 1KYIA 3WHLA 1KNXA 3EW9A 4TLBA 1Z07A 2P0EA 4PPGA 2N46A 2GEVA 2HXYA 4PPNA 1SKYE 1E9FA 2W0MA 4JLVA 4F38A 4QKQA 5CYOA 4M21A 2O8DA 1ZM9A 2OM2A 1G7SA 5P21A 1MRSA 1Z3IX 1RZ3A 4B2LA 2P2LA 5L3QB 4PHHA 3PUYA 3GEHA 2V8OA 3LV8A 3SBEA 3QKSB 1T9HA 1KTVA 4LJAA 3MSXA 2F9MA 2QPAA 2GCOA 4C3ZA 4LWZA 4GRAA 3VHLB 5BN3A 4KVGA 3TBKA 4GPTA 2F43B 2W83A 4LSGA 3TUZC 1XZQA 1VYUA 4WXRA 4TTPA 4ZIRA 3VX3A 1XBTA 2ZREA 3CX6A 3QKUA 2Z6VA 2E87A 2PT7A 3QJYA 5D3QA 3OE7D 4RKEA 2ZRDA 2EQBA 3R8FA 2AL7A 4JLMA 2NPIA 4X8OA 4R71A 2H7VA 2WAXA 3ZZTA 3L8YA 3SOPA 3VKHA 1XXHE 1IY0A 1BMFD 5JSZB 2WVJA 4OKSA 5K8LA 3CF2A 4DHEA 1SVIA 1PJRA 1TPZA 4WA7A 4B74A 2AK2A 5DLQC 5JEEA 5KPDA 2VH5R 3KQLA 1IXZA 1BYIA 4CVNA 4TTRA 2N42A 1S1CA 4YXWD 2GKSA 3IEVA 3BK7A 4BFXA 5KU1A 1N5JA 4D80A 4PHTA 1GZSA 4UQOA 4ESHA 3THXB 4NCKA 4CF7A 4CYMA 3EPJA 3B2EA 3THWA 4KCGA 5BYKA 3VR3A 3K0EA 2ZJAA 4JLDA 5GJCA 1Z8FA 3GLGB 2QPTA 4QRHA 4BLRA 4LV5B 2E1RA 4NTZA 4XSHA 5JCZA 1O3YA 3I92A 1BMFA 1GOTA 2HUPA 5A4JA 3PCRB 4X8HA 2OXCA 4C0SA 4OBEA 5L8VA 2ZI3A 3LNCA 4Q18A 1XTSA 1JI0A 2W6ID 4D0NA 4DCUA 4NCHA 2V1XA 5EXTA 1KI6A 4H1UA 3ADDA 1OHHA 2VP5A 3NBZC 3QENA 4MGIR 5B58C 4YXWA 3J81k 3L0PA 3LX8A 3BFKA 3QF7A 4B3XA 5J4LA 2HDNB 3X1ZA 1A7JA 1WRBA 2G0NA 2IEZA 2FNAA 1KI8A 2R2AA 4LGMA 2CK3A 2O0JA 2CL0X 2ZROA 5C1BA 2D3WA 3H4MA 4PO9A 3KQHA 2WHXA 4QHTA 3FMIA 3T1QA 3QQ5A 3SR0A 4A1FA 1UKYA 2GJSA 4NCJA 3NWJA 4V0NA 4EFMA 1PUIA 3IIMA 4NP6A 3UATA 1Z0FA 3K9NA 4HAZA 3NBXX 2ORIA 3B60A 4LUCA 2W6IA 3CF6R 1KO1A 3P20A 4O0MA 2WWFA 1Q3HA 3HR8A 3EC1A 4QNRA 1E9DA 5E7IA 2CLCX 2GK7A 4D4KA 1Q21A 4B2PA 4MDFA 1G3MA 3QE0A 3R7WB 1VIAA 2EU8A 4S2EA 2WV9A 621PA 5FPYA 5FOVA 1OSNA 4CEIB 4JZKA 4D2IA 2ZQ5A 3FDIA 1Q57A 1NRJB 1Z29A 1T8TA 3CNLA 2CHQA 4FD2A 1R8QA 2CXXA 2W2XA 4M1MA 1W5TA 2XNDA 3GFOA 4DC9A 2ZRFA 1QG2A 1Z0KA 1SXJE 2ZJOA 1HT1E 1NBMA 3MD0A 3ND9A 4YDHB 2B8WA 2HCJB 2AHOA 2QMHA 4C0HA 5SZKB 3AGPA 3G82C 4B76A 1U8AA 3QXJA 4RZUA 5JMTA 1R7RA 2PLFA 2ZTSA 3SNHA 1LW7A 2BCJQ 3SC3A 4TYYA 3K0FA 1E2PA 5BQ5A 2RGCA 5FUWA 1K5GA 1JR3D 5CDFE 2H17A 1TUIA 1Z28A 4IXNA 1YQTA 1W0JA 1Z0AA 4DXAA 2BJWA 4LC0A 4Q02A 3B1VA 2J41A 5AR1A 6Q21A 2C99A 1W36D 3K0AA 4HLUC 4P32A 1ZU4A 2PEZA 2OESA 4P4SB 1NF3A 5DH9A 1Z6TA 4TZ6A 4M8NE 4ILEA 1II9A 4TL8A 4M1KA 1TQ2A 4YMUA 2XEXA 3LLMA 5E3HA 4LYAA 4XWKA 4Q1CA 3O8DA 3BXZA 3VTKA 2ZRJA 3U3OA 3JZAA 3AVQA 4NMMA 1LFDB 1AQUA 1X8JA 2WWGA 2HEIA 4S35A 2WWWA 4DLYA 3AKEA 1JR3A 2ORVA 2V6IA 5G40A 1G1MA 1TU3A 5K8UA 1RIFA 2XTNA 4HUQA 3C7KA 3UXMA 3A37A 2IYTA 1SHZA 4LJ4A 1RVDA 1DAIA 3RLFA 4NONA 1F3OA 4Q9LA 3U4QB 2BJVA 1V5WA 3X2SA 4W5WA 1TEXA 1KIMA 3U7FB 2W00A 3BH6A 2B8TA 4O25A 1G8HA 1HT2E 3A1SA 4RSGA 1DAEA 1M7HA 1OH7A 3EARA 4PQYA 1GRNA 4B33A 1IY1A 4A6PA 4JLKA 2F1JA 2ZM5A 2XXAB 4GDFA 1DO2A 3BOSA 1R0ZA 1OKKD 4EDHA 1KGDA 3NG1A 2B92A 1GRRA 1OJLA 2ZU6A 2QRZA 1XCMA 2P6NA 1LVGA 3CBQA 5FTKA 5FI1B 3TSZA 3CH4B 2WJJA 3CO5A 3TH5A 4EQ6A 4JLOA 1CXZA 5J4KA 4M9SA 2C9CA 4A0FA 1VCIA 2WJYA 3PEYA 3X1WA 3ETLA 4QBGB 4C9BA 1FFHA 2C9OA 4GNKA 5KDLA 4MKGA 5FTMA 4AYXA 4D6PA 3RC8A 4QJ4A 1T8UA 2O52A 3BJIC 2ZUDA 4HLDA 3REFA 1GSIA 2O8CB 1M6NA 2BBWA 2I4IA 3PR1A 1ZD9A 1Q12A 2CLDX 3K09A 2ZRHA 1XJ0A 3PEWA 5L3QA 2GRJA 3RAPR 2WJGA 3R8CA 3SFZA 1UBGA 2FPLA 3QKSA 3QEOA 1HA3A 1E2FA 3ECCA 2YWHA 4G0NA 2OHFA 4R9UC 3KQKA 4M22A 1XX6A 4PC7A 5JRZA 2X1VA 3U2QA 1E0SA 1WE2A 2RKOA 4BWYA 2ZJZA 1XP8A 3ICEA 4G1UC 1FNNA 4EPWA 2ZE8A 2XTMA 4QHYA 2F43A 4WOPA 3EA5A 5TY0A 2IUUA 3A6PC 3Q5EA 5FFMA 2IXGA 4M53A 5DI3B 5FI0B 2PJRA 4HAVA 3K09C 5FBWB 4FCWA 4EFLA 1G7RA 4DLSA 4HAWA 3LD9A 2F6RA 3LH5A 2EFDB 4MRPA 1JECA 4ZI3A 1ESNA 3U6KA 2DB3A 1T5IA 5JI3E 4KITB 1U2RA 3P1JA 2DFKB 4OJKA 2ODNA 2Z43A 2WWYA 1KY3A 5JSZA 2FGKA 1D2MA 3P26A 1ONBA 3NEJA 4IOJA 3GLIB 2O0KA 2KBEA 4BLQA 2V7QD 3B5JA 5KSZA 5LDDC 2D7DA 3MMPA 1XEWX 1UM8A 2XZPA 2ZUBA 5CLQA 4V0ME 5DO9A 1DE0A 2PZFA 3OZXA 4GZLA 3DM5A 2C2HA 2G3YA 2IA5A 3THXA 3R9WA 1X8LA 3I73A 3UG7A 1E0KA 4JBYA 3TSOA 4B6EA 1XCGB 4DEXA 4DLTA 3LLUA 3OFND 3TNFA 4A92A 4DT1B 4US1R 4UXIA 2IHBA 1XMVA 2WAYA 1Q3TA 4UJ5A 4NYJQ 1XD2B 4BZQA 2R62A 4ABYA 2YOHA 1QHYA 1KK0A 4Q1DA 3SYKA 2FZ4A 1YZKA 4M1WA 3TUIC 2FE4A 5CJ2A 1KSHA 3CR8A 3MRSA 4DUGA 1SVWA 1SKQA 1R0WA 2VHCA 3UWOA 1TNDA 4D4LA 1B0UA 4IOKA 2X2EA 5EP2A 2ZS9A 3H0KA 3LO5A 3GJ0A 4AKEA 4BQSA 3B85A 3E2IA 4PX9A 1ZYUA 2OXRA 4B71A 4HLQB 2ATVA 2HLDD 2RH5A 1DAKA 4DDVA 5FTJA 3U61B 3EPLA 2C77A 3RS7A 1YR9A 2ZAMA 4UNQA 2P5SA 1OH6A 4C2UA 2JATA 4JBXA 1UKEA 3PENA 1U99A 4FINA 4Q4JB 4TLAA 3TR0A 4YC7A 1E0AA 4A9AA 2PEYA 3DL0A 4TL7A 1J8YF 1DPFA 3RC3A 4BFUA 4C0QC 2YKGA 3QSYA 1Q44A 3LFUA 1MH1A 1KDOA 1OIWA 1Z6GA 1ZW6A 4HDCA 5JEDA 4DLUA 2VRWA 2QPOA 2QM7A 1M1YE 1LNZA 1J8MF 121PA 2O8EB 2VP9A 2NG1A 3OIVA 3KQNA 3HP1A 3R7WA 1NN5A 2ZSFA 5FBQB 4FMCF 1EGAA 5FH9A 4CEIA 2RGAA 1G16A 3NVAA 4L9SA 3W6NA 1KI9A 1RJ9B 1YRAA 3FMOB 4LBZA 4TMWA 2HLDA 1OW3B 4XJXA 4OK6A 1QHXA 4C4PA 1NMXA 3AVPA 1SGWA 1CR0A 4P3YA 5KNBA 3PEUA 4MH0R 2ZJBA 4UNNA 3HYRA 1ZUNB 1J7KA 1PV4A 1GL6A 2IYWA 4ACBA 2QAGC 1COWD 2IS4A 2YNMA 4PZLA 4IJMA 1E2QA 3NBFA 2ZJ5A 1UKVY 2FPKA 3L0SA 3D31A 4OHZA 4V03A 1E4YA 2MMCA 1A2KC 3ZGXA 1E6CA 4BECA 4UJ3A 2RGBA 5L3RA 4RJLA 4RD3A 1G7TA 3VNUA 2KWIA 1TTTA 5GJBA 3IHWA 2ZRLA 2W6JA 1IXRC 2QQEA 2CE7A 2ZJ2A 4Q7LA 1N6NA 4MKHA 2DFNA 2GF9A 2WOJA 2PMDA 1W49A 4HEJA 3AVWA 2BMDA 4JVNA 1UBFA 3FKSD 3L43A 4NYIQ 1J70A 1WP9A 4TMXA 3CNNA 2ZR0A 1K5DA 3QKTA 5JS8A 1QBKC 3IDQA 4DWJA 4DCSA 2BBTA 3QIAA 4LC1A 4K81B 4B43A 2JLVA 2CEAA 3AVXA 2HF9A 3HU3A 3BAFA 1JBKA 3GEEA 4Z8YA 3KUCA 3LBNA 3UPUA 2QI9C 2Z0MA 1JAIA 1XPRA 4KFUA 4QHSA 3I72A 3G5UA 2VEDA 4URXR 2F1IA 4IDPA 4C2TA 3RHFA 4NHOA 4D25A 1KJWA 1XEFA 2ERXA 2RGDA 1JALA 2ZI6A 1Z22A 1J2JA 5BYJA 3AP1A 1CR2A 1X3SA 3RABA 1IBRA 2VSOA 4UXHA 1NKSA 3U4QA 2J3EA 3IBYA 4KVAA 3I3SR 3A58B 3KJEA 5EE1A 1N6KA 4JLNA 3FGNA 1UBCA 3SQXA 3CRVA 4B73A 3F0TA 3DO6A 4RZXA 2PT5A 3B9QA 3QPUA 2J0QA 3AGQA 1TMKA 2OCPA 2VO1A 5AUNB 3DOEA 3CUEF 4LPKA 3VR1A 1FP6A 3FHTA 4TMVA 4LYFA 1VCNA 3ZIAA 3NXSA 1ZD8A 3U3JA 2RHDA 1NIJA 5IK2D 5B2ZA 1D2NA 1P75A 3LXRA 2OLKA 1Q1ZA 2VF7A 4URUR 5FUXA 2IYUA 3TJZA 3IEUA 2IS1A 2JIZA 1FPMA 5HE9A 2GA8A 1AIPA 2CJWB 2C78A 4MYTA 3I61A 2VHQA 3EIEA 5H70A 4G5GA 4HAYA 4WVFA 1NKTA 1CR1A 4DDUA 2IEYA 3O8BA 2NO9A 3WY9A 5JWHA 5LD2C 2DCUA 4LHYA 5KTYA 1WMSA 3HR7A 3RS0A 2CHGA 3K53A 4B32A 5KUTA 5H1YA 1G8GA 1BO6A 1EFRD 1YZNA 4OQNA 2RGNC 2B21A 1BIFA 2O8CA 4ZDKA 3Q7PA 2FU5C 2RGXA 3QXCA 5M04A 2QG6A 3GJ6A 2DPXA 1DELA 3K9LA 5H8WA 4OJQA 5FPHA 2QT1A 3OEHA 4ASUD 2J9RA 1KSJA 2JJ1A 5IK2A 3U7HB 1BH2A 1DBSA 3AKDA 4ITRC 1SKYB 4PQRA 3BH0A 1OV4A 4N0EA 2GWHA 3NEYA 2LWIA 1E9RA 3KXLA 3AF1A 1IM2A 1KAGA 1ZM4A 1L4YA 3MWJA 1W4CA 1GNPA 4Q1FA 3HJNA 4MYUA 3T5GA 4EAQA 2WSSA 1KI4A 4LBVA 3QI2A 1XTQA 3EPKA 2G9NA 1G3RA 4ESVA 1RYHA 3AUXA 2IYRA 4PTLA 5DI3A 2EW1A 1DAFA 1EFRA 2ZI4A 4GOJA 1KK1A 3GJ8A 1G20E 1XNJA 4FCTA 1E9SA 3CH5A 4Q00A 1MT0A 3KB1A 3SJBA 2BHRA 1W36B 3SE0A 1GNQA 2A9KA 4IFEA 1I2MA 4PSAA 3PXGA 1DAGA 2ZAOA 4ACAA 4BZPA 1Z0JA 4IDHA 1ZJ6A 4M1YA 1A4RA 4QGGA 4Z8XA 5EZ5A 2J1LA 1R5NA 3H1TA 4KSCA 1YE8A 4P4TA 1E9EA 4JL5A 3WYAA 2HYIC 3NH6A 1UDXA 1NVUQ 1Y63A 4W7SA 4A4DA 1YHNA 5KO2A 1ZUIA 1QHNA 2BIFA 4V0KA 1XJQA 4IEEA 3TSWA 1E9AA 1G8YA 2CCKA 4FN5A 4ZDIA 2FFBA 5EXSA 2YJTD 3CX8A 2OV2A 5AJYA 4A8JC 1HE1C 1CJMA 1P9RA 4HATA 4GP7A 4DT1A 2J0VA 2FEMA 1M34E 1L2TA 5LB2A 5FUVA 1NIPA 2Q9BA 4JVSB 4PSKA 1XD2A 3T1OA 2A5JA 4N1AA 3GPLA 3UKDA 5GJVC 1E0JA 2X19A 3SJAA 1NBME 4NBSA 3SEAA 2RGGA 4HB2A 4Q01A 4FMDF 4DKXA 1CBUA 5DN6A 2ZUCA 1R0XA 5F3WB 1ZRHA 4BUJA 4DSTA 1E9CA 2BDTA 2IX3A 4V02A 3W6OA 1NL3A 1M7BA 1OFHA 2P65A 5JJKA 5C4GB 2NGRA 3W5JA 4Q1AA 3ZYCA 3WRXC 1UKZA 4BFYA 1MV5A 4R2IA 2A5GA 4WIAA 4JL8A 3SYNA 1OLOA 3FMFA 4M1OA 1EXMA 2JLRA 4A6XA 2F3RA 2IXFA 3HU1A 4Q4JA 5FOUA 3C5CA 3WNDA 3I4LA 3FTQA 2OAQ1 1H8HA 1VG8A 5TARA 5KDOA 4LHXA 4HDOB 4Q1BA 2WSMA 3KQUA 4YMWA 2EFCB 4W9MC 1Q1EA 3KL4A 1EFUA 2QZ4A 1NSFA 3CRQA 1IN4A 5HKKD 5DSZA 2Q3FA 1VHTA 1P5ZB 4L15A 2O8EA 2C03A 3WMGA 5HPYB 2JLUA 5L3VA 3ASZA 4CT5A 1JR3E 1KI3A 2J0SA 1NN0A 4D4MA 1X6VA 4PO8A 3I8XA 3I32A 4TL9A 3FFBA 3H84A 3TVTA 2QEQA 4HB4A 3RNLA 2EYQA 2UZ3A 2BBSA 2NTYC 3IGFA 3OHMA 2KJQA 2NOAA 2OT3B 3QBTA 3AM1A 4NDZA 1GG2A 1YR6A 4LDJA 2XITA 3QVVA 5TDHA 1OIXA 2HT1A 1ELOA 5EUQB 4DDTA 4IHQA 3RDPA 5HZHA 3GMTA 1VDZA 2FSHA 2YYZA 4F91B 5KNCA 3FVQA 4EUNA 1C4OA 4L4UA 3SU8A 2GCPA 3ASYA 3NBYC 3OF5A 3OE7A 2ZSBA 1MRNA 2R6DA 2CMKA 3JVUA 4NKRA 1G4UR 1Q1BA 2V4ZA 4XTRA 1QHHB 5LBIA 1P7CA 1W5SA 5GJWC 4TYWA 3ND8A 1HV8A 2IYQA 1W44A 1T3LA 2NPFA 3TGPA 3I1FA 1NMZA 2A5YB 4CDGA 4DB2A 2J7KA 2FGJA 4QG7A 2GCNA 4TLCA 4EPRA 1RRPA 4ZI2A 5F9HA 1PUJA 2C95A 1OFIA 4I1SA 4EPTA 2V3CC 4US0R 1OYYA 2BKUA 2VP2A 1IQPA 3BB1A 2AWOA 2QORA 3EZFA 2EFEB 3HYTA 1XTKA 4TYNA 2ZI7A 2ANCA 3CWQA 1F48A 1SZPA 2VBCA 2WIBA 1IN7A 1O87A 1QVRA 1CJUC 1QHGA 2A3RA 2OE2A 2WJIA 1LTQA 3VR6A 1CRQA 1LS6A 2O8BA 1UF9A 4EPXA 1JEEA 1G6OA 2WMOB 1JEDA 4G5QA 1G3UA 1KDPA 1OXVA 1XTRA 1S9HA 3WNBA 2YINC 3OEED 1P61B 5G41A 3ZDQA 3F3YA 1K8RA 3PJRA 2JJ2D 1IJFA 1P4SA 3Q7QA 3CPHA 3ZLJA 3FMPB 2QP4A 3HDTA 3A4NA 5CM8B 1WBDA 4MRNA 5AUOB 4Q1EA 2Y8EA 2BV3A 1A2BA 3OAAD 1P2TA 3GJ3A 3HWSA 4DCVA 2IUSA 3K9GA 1Z5ZA 4LOAA 1JR6A 4EKDA 3VMFA 3ADKA 2ZYVX 1F2UA 4QXAA 2PMKA 4L16A 1IY2A 3ZD7A 4QC2A 2ZYWX 3Q5DA 2VPPA 2FJUA 3X1YA 1AGPA 4GMXA 3SDZA 4ZCLA 3SI7A 2CVFA 2AXNA 2IS2A 1W47A 2KBFA 5E4FA 2ZE5A 5FL7D 4B34A 2CJWA 3PEVA 4IOLA 1JPJA 3CIOA 2A30A 3UMFA 4MGZR 5JJIA 3OAAA 4A2QA 1P62B 1R6BX 4RD2A 1HURA 2OFOA 1E3MA 4LCBA 1HUQA 4RCYA 4FCVA 1KNQA 3WBJA 4A2WA 2IT1A 3RS4A 4A2PA 4EJSB 3C41J 1N5KA 5KSYA 2J45A 3UK6A 4LV6A 4GL2A 5CB8A 5FUYA 1C9KA 4ZO4A 3EWAA 5K8IA 1KK2A 5C2JB 4I1UA 1FOEB 2IUTA 1WQ1R 4M9ZA 1OB5A 2Z4SA 1NJFA 3RRZA 4Y0VA 1N6HA 4U7DA 2YOFA 4OQXA 4IEIA 4ZPXA 1IAQA 5FL7A 2C5LA 2AX4A 4QJ3A 3RS3A 221PA 2HCBA 2IYSA 1TU4A 2ZIAA 1G8FA 1NP6A 4Q47A 3KFVA 3LRPA 1ZNXA 2JAQA 2AWNA 4IVPA 2GEDA 2O5VA 4GBMA 2D06A 5EP1A 3QUSA 2YOGA 1G3IA 4TN1A 8OHMA 2XGJA 4BFTA 2GHIA 3P4XA 3R9XA 2GBLA 4LHVA 1JB1A 4IFBA 2XB2A 2QMEA 1MABB 1TAGA 1S96A 1WDTA 2ZU0C 4PHFA 1E99A 2P5TB 1SQ5A 3IHLA 2FH5B 5IRCD 4QFMA 1KK3A 1KOFA 3T5DA 1KO8A 2J46A 2VTKA 5DHFA 5FOXA 2R65A 4DEYA 5SZJA 2QBYB 4NH0A 2GXQA 4RFSB 1J99A 2RGEA 1Q0UA 2NIPA 1WCV1 3THYB 1KY2A 4AD8A 1XD9A 3PUWA 2JLXA 1OH5A 3IBGA 2H8KA 4BLPA 2ZVQX 1PLKA 2JEOA 2IW3A 4BRWA 2QAJA 2IBMA 3ZQJA 3AVYA 2J7PD 4OK3A 5J47A 3TW4A 3U7GA 1T6NA 3TVDA 2V1UA 2A2ZA 3ONWA 3A36A 4AKIA 3BB3A 5JJLA 3GEIA 1PLLA 3RYTC 4FMCB 5EP3A 1E2LA 4QBIA 4B35A 2XJ9A 2CBZA 2FSIA 4O2RA 2I1QA 1P2UA 2GVZC 2QL6A 4FXPA 4F4IA 5EJEA 3ADBA 1E1QD 5KSPA 1P9WA 1Z83A 1FMJA 1AN0A 1ESMA 2GZAA 3GJ5A 4RD4A 2HT6A 2SHKA 4D26A 4P31A 1RPZA 2VP6A 3SJZA 4HZIA 3FYHA 3S1AB 4IW3B 1AGRA 3SYLA 3MWLA 1W0KD 3PVSA 3B6EA 1Z2AA 4PC2A 2BEKA 4DSNA 4C0LA 3QPWA 1D8TA 4EFNA 1PZNA 4G5RA 4JIMA 2JDID 2B7BA 5J40A 2VYFA 1QRAA 3P27A 1OKKA 1VKJA 4KFSA 3JZMA 5FOWA 4OHYA 2X77A 1LB1B 3LAWA 3FB4A 3NDPA 1XJCA 1CJVC 1NVWQ 1M7GA 1OFTA 4FW9A 821PA 1G5RA 2WZQA 4PR0A 3EASA 2GZHA 2ZS8A 2VF8A 4JT4A 2O0HA 3GJ7A 1XFAA 4PC1A 1YRBA 4MKFA 1ZU5A 1E1QA 4P0TA 4GOXA 3WXMA 1BYUA 2OUKA 4Q7MB 1JXMA 2PJZA 4TTQA 4JT2A 3FKQA 4E09A 1K6MA 1R8SA 2QTFA 4PO1A 1T3SA 1P2VA 4A36A 1SXJD 2REBA 4RY2A 1CP2A 1KMQA 3CNOA 4ZV4A 1W2HA 1ZVQA 5G3ZA 1FTNA 4GMDA 3CWZA 1YZQA 2Z4RA 1FNMA 1GNRA 1DS6A 1GKIA 1S3SA 4OQFA 5CIQA 3WNCA 5DHAA 3UANA 4KBGA 4PXAA 4TL6A 1CKEA 4PAMA 2QSYA 4XD7D 1D9XA 4EIWA 3Q9LA 2YC4C 3A1UA 1KI2A 2WKRA 4PPQA 4Q9JA 1FL9A 3DMNA 1RRGA 4GI7A 5CLLA 4DIEA 5TXGA 3NHAA 5A0FA 4PZYA 2TMKA 4E5UA 3ZZ0A 5EZ6B 2QT0A 1N0VC 4WZ6A 4DCNA 2ONKA 4NCIA 4CEJB 1YVDA 4BLOA 2LKCA 1TF7A 4G5OA 1DO0A 3U3RA 3AVVA 3KJHA 2F9LA 3X1XA 2GJKA 2WPDD 1Z6YA 3K70B 2QRNA 1SVMA 4W5JA 1II8B 3GLGA 1ZIOA 1JAHA 1T91A 3LX5A 1KI1A 1QHHA 4Z51A 2QQ0A 5AJZA 3NKVA 2DWPA 3F5FA 4RD0A 2JLZA 2XZLA 2G77B 1UADA 1KKLA 1G9XA 2WWHA 3I5YA 3B1ZA 4DVGA 3B9PA 2PLRA 1VPLA 4ZKDA 4WBSA 3GJ4A 4L8GA 1Z6XA 1TADA 2V7QA 1S1MA 1Z6AA 3VKWA 3CPJB 3DKPA 2NQ2C 3BRWD 4LJ7A 5KPJA 5ELXA 3K0SA 1YKSA 2FFQA 1KKMA 2BOVA 3K0CA 1RRFA 4WW0A 3SFVA 1FQJA 1D9ZA 1ODFA 2QN6A 3B13B 3OIUA 3UMRA 3W6PA 5B30A 4NL4H 2DFTA 1RYFA 2EFHB 4U02A 3EPHA 1NLFA 5BW8A 3OFNA 4URWR 2FFHA 1GRQA 3WHKA 3BIFA 5CJPA 2RHMA 2CNWD 1GKUB 4NPHA 5KDDA 4Q66C 3ZS9A 3AVOA 3CPEA 2NO0A 3KFXA 1F5NA 5IHPA 1A5TA 3AP3A 2HJGA 4BGDA 1NN3A 3BORA 3TMKA 3GFPA 5DYGA 4C0BA 4B75A 1SVKA 3OIWA 1S0UA 3K0CC 5JS7A 4MQBA 1TQ4A 4OL0A 4ARZB 3T1TA 3MWYW 4MGYR 5DGXA 5EE9A 1US8B 1Z63A 2NZ8A 1GM5A 3RWMB 5FTNA 1G5PA 2VSFA 1L7VC 3GLHB 4A0GA 1GILA 1L4UA 4QGFA 1YU9A 1ZM3A 2PCLA 5KHOC 1M8PA 3L0IB 4Q21A 2OBMA 2CNWA 2XSZD 1N0WA 2RCNA 4BFWA 2IS6A 1AJEA 1N6PA 1KDTA 2XAUA 4KHZA 2VL7A 3NDBB 5AJWA 2GZDA 4FWIB 4Q7KA 2FN4A 5DYIA 1OXSC 4EPYA 4Q4AB 4KSBA 2J5XA 2P6RA 3B82A 3SQWA 1SVLA 2GK6A 3V9PA 1U0JA 3O8CA 4YONB 1W1WA 3PUVA 3LVRE 4XWAA 4CEHB 4EJSA 1T4GA 3DKVA 3AVTA 4D81A 1SVSA 3T15A 3SS8A 5JCPA 2MSCB 3KKNA 1KHTA 1ZC3A 5KSOA 2CCJA 2ZITA 1ZC4A 2MSDB 2OCYC 5AWFC 1TX4B 3FPAA 5IF9A 1DEKA 2WWIA 4PQFA 2JLWA 1OB2A 4P4SA 1FUKA 2W0SA 3V4FA 1COWA 3KX2A 4KXFB 4EPVA 1AKEA 4XSGA 3ZS8A 5GVRA 3OESA 4Z54A 1CLUA 1IOZA 2GVDC 3DHWC 4YDSA 3TKLA 4FIDA 1AA9A 2VHJA 5D3MB 5C18A 2LKDA 2ZRCA 2DY1A 3FE2A 3K9HA 5CM9C 3IILA 3PFIA 4EJSC 2ZRMA 2QROA 1KI6B 3W5IA 2C98A 3HU2A 1W4RA 3B1WA 521PA 3TLXA 1MABA 4RD6A 5C4MA 3CM0A
chains in the Genus database with same CATH superfamily
1JR6A 3LL4A 4OQYA 2VT6A 1IONA 2WMNB 1F2VA 3DONA 1EVLA 4FBMA 2AQIA 1U8ZA 5HCUA 5T4EA 5HNKA 4BX3A 1WF3A 1U11A 3FKSA 2F3TA 4D8UA 3E22A 3WDKA 1PK9A 4UVHA 1C81A 1R5OA 2ZDQA 3BUSA 4U7WA 1MO2A 3UT5B 3HV2A 3CZ5A 4LJKA 4N41A 1NVVR 1S3FA 1G20B 1Q0RA 3FWZA 2D2EA 2W6OA 4WJZA 1NC1A 2QW1A 4DZZA 1DMSA 5MHTA 3B1XA 1N7IA 3M6MD 1W94A 3P5BA 4JFRA 4HGZA 3QEBZ 2R60A 5F4ZA 5JISA 1O54A 3EEYA 5AXCA 5B36A 5MGBA 2P9EA 3ZQ6A 3G5AA 4LY6A 4MLPA 2Y93A 2RMKA 1U9IA 4WA8A 3K0KA 4O3FA 2Q3MA 3RUDA 4QTYA 1YR7A 4Q19A 5AW1A 2HJSA 3LT2A 2H92A 1DKNA 3OM0A 1IBCA 1K8XB 2QTAA 3EIHA 4PIPA 2R8BA 1OLUB 2ES4A 5EKTA 5IDVA 3VR2A 1UBRS 2QW8A 1FP7A 4KX5A 4XPIA 4L2IA 3KJZA 4I50A 4NE7A 2ONJA 3W78A 2BKVA 2IZ5A 1DWOA 2XI4A 5EI5A 1PT9A 2AR9A 3EUEA 4QTUB 3RADC 1R50A 3A7DA 3M4YA 4K9QA 4EHAA 5C3MA 1TZ2A 4KKVA 3CLKA 2H3HA 2YN0A 3S1AA 1YXMA 1QO0D 3JQ7B 4C76A 1Y4AE 5AM3A 2Y0EA 1HFWA 2GHTA 5FWNA 4BNNA 4JEUA 5FEMA 3LJKA 2R96A 4OP1A 1E0DA 3ZDDA 2DHDA 2XCLA 1IZ8A 1S2DA 3R7DA 4FONA 3E0XA 2FTKE 1H2EA 1T5LA 5D1HA 5DLYA 1EWVA 4E2YA 1T6BY 4RZ2A 5K3AA 2HPAA 2LDXA 3IIIA 1E2NA 5BWMA 4AG6A 2PJUA 2KHZA 3VHXB 1A27A 5DFAA 4KAAA 1T35A 3U5ZB 3CW8X 1JIIA 1NPDA 3TOSA 2GD1O 4BFZA 3ZQUA 4F12A 4ZCPA 3ABIA 2C2YA 1CUBA 1RPNA 3L8GA 3DQZA 2P79A 3W3AH 4XQGA 5H0IA 5T6MA 4KQWA 3DMDA 1N6IA 3BK1A 5THXA 1KY4A 2FSGA 4J07A 4KO1S 3WIDA 4XQEA 1D5CA 5EWJB 3UMCA 4BLUA 2YJ6A 3I3OA 5EKSA 2D54A 1T10A 3I04A 2WTBA 1NNLA 2LNDA 3OICA 4J0DA 4UU7A 3OE4A 3V4OA 4DLVA 5A6SA 4K8OA 1V95A 3P4YA 1Y5MA 4LAFA 4LWQA 2FUEA 1SQ6A 1IHUA 4PYNA 4JGBA 5AK6A 3EA4A 3N2IA 1JIUA 1RLMA 2N75A 2HA5A 1GKYA 1U5BB 1JKJA 4NEGA 1AZLA 3WSVA 3BXGA 3GLIA 3GZJA 4XWGA 1D4ZA 5DK6A 4DQ0A 1G1AA 2J9FA 1JMKC 3N5CA 2II6A 2ATCA 1Y1TA 4UE6A 2ZJ1A 4F2DA 5LWQA 1ZLXA 2V9CA 5LUBA 4Z6KA 1IBMB 3MZ0A 3K2QA 4ERNA 2I7DA 1SUFA 4EMUA 5A04A 3CF0A 3WK8A 4BNLA 1P44A 1WW3A 1U2QA 3T99A 1PFWA 2HO4A 3HVRA 2BGMA 5CH8A 5EIEA 4F3TA 4RACA 1LQ2A 4YHBA 5ESXA 1D03A 5K05A 1K75A 3FWYA 3G5LA 1TJYA 3WV5A 4ZGWA 1N2EA 1AF7A 4RV9A 1B0AA 1CJKC 4OHCA 3SBDA 4R2JA 3WHIA 2JA1A 1LV7A 4ZC1A 2G40A 1XALA 2IITA 3R2JA 1G9TA 2Y6UA 5BRJA 3OPMA 4H1TA 3IVCA 2OC9A 4HZUB 1E2JA 5EMLA 2SICE 3DBRA 2EKBA 3O90A 4CLOA 4RULA 3D8NA 4WNIA 5G0WA 4JWTA 3OZFA 3H17A 5EUMA 2AN3A 1M6EX 4PAOA 3GZTB 1VBMA 4R2HA 3DPUA 3M3DA 3FRJA 5CXXA 3N59A 3TB4A 3GNQA 3H83A 3RHSA 4G26A 3UOWA 1FSFA 3GUHA 1A72A 3E9RA 4UXJA 1F8FA 2G6TA 1UEXC 4MIKA 4JI3B 3W1VA 4WUTA 5CK4A 3VTZA 4PFKA 2FPPB 2PH5A 1OZAA 2AFIE 3NOXA 5COAA 5K0BA 2JIBA 2HMTA 5L45A 5AJXA 2F1RA 1VE1A 1T0HB 1LI4A 3HTXA 4FTWA 4LW8A 1GUAA 1HNWB 1EGQA 4DMCA 2XWQA 1P1RA 1BW9B 2PU7A 4BE7B 3ZU5A 3KFLA 1E98A 1EK1A 1I4LD 1C1HA 2C7GA 2VF2A 2Y99A 1K7FB 3LM8A 5DF1A 2QS9A 1QR6A 4IUBS 5ARCA 3AJEA 2WZBA 5HKBA 1HM5A 4GPIB 1AXEA 5H3LA 4KI0A 1ZKDA 1Z06A 2I9KA 4U9HS 1G6KA 3FUTA 4HDQB 1IQUA 1DQSA 1J1ZA 3I2FA 2IQ5A 4UULA 4YJ2F 2AMYA 1US8A 1PR9A 4F85A 1GZ5A 4N82A 1K66A 4OYHA 4P86A 1GXSB 2FZGA 2JW5A 2OV4A 1H2WA 2NSYA 3A4MA 4JQZA 1F38A 3D4LA 4GSYA 3IEIA 5UKDA 4O1MA 5K0GA 1WOYA 5HF5A 4DBLC 7GPBA 4P7BA 2PWBA 1R74A 2VHEA 4R54A 1UMKA 4X1IB 4YWJA 1FX0B 1FNDA 3CLVA 3BWEA 2J9ZB 2R47A 3GV0A 3IJPA 4CZ2A 1I33A 3O82A 4OHVA 1G5QA 1NUTA 1LF0A 1E5TA 4RL6A 3CG4A 1DV1A 5FL3A 1X19A 4H1VA 2QDKA 1LBTA 4LOIA 2QB5A 2EDAA 1W8DA 3GY0A 4J2HA 3R5TA 2A0XA 5G1OA 3FHCB 2V0GA 3C8ZA 2VDUE 2Q1TA 3N8IA 1XU4A 3FG9A 4ZN6A 1B00A 1OWPA 3ZDAA 2C7PA 1Z5VA 2HF8A 4BNGA 4KO4S 1Y6FA 3KTDA 1WQ3A 2H1VA 4PX3A 2R1ZA 5L53A 1XTBA 1CQPA 3UIEA 1UZAA 4C7JA 2PKWA 5FXMA 1VOTA 5FTWA 1BHQ1 2SECE 4LDZA 4IIJF 3ICQB 2VK8A 1POWA 1KQFA 3TR5A 2GQ0A 2X0EA 3ZVMA 3IKJA 1PK7A 1PGNA 2KS6A 2DXIA 1OA1A 1XDDA 4OHMA 3RRMA 1KXJA 2Z3WA 4N47A 2QE7D 4MUMA 4C6RA 2OMEA 2C4VA 3PIRA 1C2YA 2JLCA 2VA8A 1AKYA 3ZJ4A 4TZTA 2NACA 2EXXA 1Z17A 2H7XA 3CN7A 1IL0A 3H9JA 3OU2A 4ZVMA 4F56A 2CV2A 1EIWA 2XVZA 3Q6IA 4OHRA 1KH2A 1O94A 2AR7A 2XUAA 3RRJA 2BMFA 2I3DA 4JGGA 1SXGA 2Z6AA 3TXYA 5EXPA 2PX4A 4FNGA 5J58A 1QGED 3WKBA 1H5NA 1G21A 1DTEA 1X8KA 2VZ9A 3VNRA 2ZRPA 4UUOA 4MRRA 3WL5A 3TIXB 3I5XA 1H9BA 1JYSA 3EDMA 3TEFA 1YA8A 1XRJA 2EX0A 1EFVA 2Y6VA 1DI0A 4M1QA 5H3CA 1RQRA 3ZCUA 4X95A 4QXOA 1CQZA 2J87A 3KK0A 3KU1A 1A7KA 4Y2QA 2ODPA 1ZK4A 2KSQA 2RONA 3FW1A 4M38A 4Y9UA 5JD6A 4M76B 2FVXA 2HQ1A 3DV0B 3L18A 3MWEA 3PYXA 10MHA 1Y4ZA 3PC6A 3BZBA 2VWHA 4L3OA 2JD1A 2XKBA 3QFRA 4WKOA 4DPMA 1GNLA 2DULA 1HDXA 3F7NA 4TV9F 4E4YA 5C80A 3TEJA 5FTLA 2VPQA 3VYWA 5BQPA 3SLKA 4X71A 3T1VA 1XDBA 3AFOA 2JBHA 2OC4A 2XNDD 1OXKB 3D8RA 4TM8A 3G0BA 3ZLBA 3LDGA 3NPAA 4YEDA 1YA6A 1ZK3A 2L69A 4HNAB 1U81A 5E6RA 2PAFA 4N5IX 4NENB 3LCRA 1UP4A 3QUBA 4JBWA 1ZHFA 4EEZA 6YASA 5KCZA 3UAYA 1RACA 5DCWA 2O1XA 3EIQA 5FORA 3A6LA 4G01B 5AM4A 2QAGB 3ODGA 1WXXA 5B4UA 4YPFA 3NHMA 2EYUA 1NJ2A 4U7GA 3IBCA 3FA2A 3FUXA 4X84A 2OSBA 3RBAA 3RHTA 3T35A 1ZM2A 3O2JA 4C30A 2GZ1A 4QECA 3ZW9A 1JF8A 2QD5A 4RKFA 3VKGA 4K9LA 3NHBA 1CIPA 2FSVA 3HFSA 1L7DA 2IL1A 4AB1A 3WLSA 2HFKA 5BN5A 5HGXA 1TRHA 4GZMA 4J29A 3TLGA 4E5NA 4DSUA 3PDIB 1V6CA 3K4PA 3G9ZA 4KE7A 4OLJA 5CW1A 3PQCA 1JLHA 1X7YB 3DQPA 3EHEA 3FNIA 4O0LA 4YJGB 3B78A 1J23A 2PCJA 5IYZF 5ICCA 2QV7A 1CUYA 1PEDA 3ANSA 3F90A 2IDZA 3LHIA 4HLUA 3EAFA 4UHCA 1QQ6A 2CDAA 1GQSA 1PV1A 1N6LA 3DMFA 5KNDA 5FLXA 5BSTA 3BRQA 1DG9A 3LVQE 4YRKA 1Z08A 2GJ9A 4LK2A 1I1OA 3BWYA 5LIRA 4B7ZA 3OQIA 4WXHA 4E03A 4QT0A 4JYAB 3OEYA 2R8OA 1OGIA 1QO7A 3IJRA 5CHEA 4BOYA 1HQDA 4IP0A 4FEGA 1E89A 2H4HA 2C59A 4Y1EA 1MGOA 3RTEA 3T5BA 4YFYA 3ONFA 5EIBD 1JKMA 3KJGA 4MV6A 2R6JA 5J5CA 4JVLA 4OFWA 2PRIA 1FSZA 3BD9A 3DCIA 3LSYA 1ZGGA 2IHTA 2EGHA 4P4GA 3LQYA 3UJ8A 4KV9A 2ZQYA 1SBHA 2ZWOA 5HR5A 2DHQA 1RJGA 3D5EA 4BBPA 4J43A 4PRYA 3FH0A 5ALVA 2DR2A 4EVSA 3RPEA 3KYJB 4P84A 1LLDA 4NU8X 2AD1A 4MJXA 3PXBA 3G9TA 1F6BA 3QK7A 4CJXA 5F98A 4CMIB 3K94A 2VDWA 2YVUA 5TX7A 4ZI7B 4L4YA 1NLMA 5IBCA 1QDUA 2W2TA 3GA0A 1PDWA 5E3JA 4R7GA 4DV3B 2XUDA 4LVUA 4I5IA 1O95C 2OPBA 5E7JA 3WGYA 4OQLA 2CNBA 3BF8A 5I7HA 4G5HA 2WAAA 4U3JA 1M83A 2P62A 4V39A 1JHVA 1U3CA 1DDGA 1U3FA 4IIHA 4LZZA 3EPPA 3PDWA 2GAIA 4QLAA 4YRMA 3MQ4A 1PJQA 1XXHA 4I7EA 1CEXA 1E8NA 1SQGA 1UJ4A 2PFKA 3IVMA 1M2OB 4N54A 5TEVA 4URYR 3OF3A 3V1NA 1QDLB 4TRRA 1VMKA 4RF2A 5HRUA 1V8ZA 3UMGA 1C2TA 5JS2A 4A10A 1VMEA 3R4VA 1CUVA 1MN6A 2GEKA 1PEKE 4B3GA 4TXMA 4XIGS 1MQAA 5DLDA 3RODA 1UQUA 1XMSA 3R6TA 1DVRA 4P54A 1HE3A 3IAAA 1Z0IA 3DTVB 4FE3A 4OKNA 3X3HA 3NTUA 4X8LA 2YV2A 4QYIA 3NHLA 4BASA 1E5QA 1L7AA 5F5LA 2OHIA 3DZ8A 3DPIA 1XDWA 3E3NA 4H18A 2IVZA 3U40A 3LKZA 5FEUA 3MB8A 4ARAA 2E6KA 1RPJA 3HBAA 4MX8A 2H6EA 1YRYE 4RVDA 2QRJA 4M9QA 3C1UA 4ZEOA 3W79A 5JSUA 3DE0X 1WDLA 1NZJA 4TYPA 4TT3A 1IDN1 3AONB 4Y0AA 4URVR 5KQMA 5DWQA 1ZMOA 1KMHA 3KSDO 4LYGA 5MN5A 3IB6A 3I6ZA 4O29A 4MRVA 4R8LA 1JDZA 3RT1A 1LNQA 3EOBI 5CA0A 3RNOA 4BQQA 2GF2A 1T13A 1R10A 2QGZA 5AW4A 2ZYRA 1DPGA 1ZI8A 1Q50A 2MDTA 3U3KA 2AB0A 1IPFA 2Q0QA 5DVZA 2PJDA 4K88A 3HNOA 5M3BA 1XQXA 2FLVA 1S9DA 1PT5A 1S6YA 3HXKA 3FTPA 1P73A 4G4SP 4QELA 4R1NA 5AKEA 3MGGA 3GWGA 2EJCA 1KRHA 1V9SA 2CD9A 1QU2A 5CLGA 1D3AA 2JGLA 2P67A 3RTDA 4XVQA 3THSA 4EYKA 2H5IA 2HD4A 4ENSA 2NVUB 1M5UA 2FMKA 5EESA 2RAFA 2YQ4A 1ZMBA 2NQTA 3AUSA 2ZR9A 3E5HA 3KKMA 2YBEA 1W0KA 4GE3A 3ZXXA 4A6DA 4HUTA 2LUOA 3LDAA 4J9UE 4QGHA 3M5CA 3C70A 4ZCRA 1U0HC 1BWRA 2CFOA 3AG5A 3CXRA 2R7AA 1I4DD 4PSUA 1UBKS 5GPBA 2Q6VA 1X7WB 3ZI0A 4LI3X 4MI1A 4P4LA 2WINI 5B4VA 4D5EA 2PL1A 3DEHA 2OZKA 2G1JA 2BYTA 4J7CA 5LP6A 1NDHA 1VFNA 5EXDA 1NNEA 2JGNA 4M1TA 3WYNA 1PWYE 1DC7A 1L4FA 2B7CA 3K4HA 5K20A 1S4QA 1DAHA 1A8SA 1MG0A 4TQAA 5TB5A 4C4ZA 1DCMA 2P1DA 2W4MA 3ORHA 2EAUA 1VECA 1ZX1A 3SAJA 1DDOA 2ID7A 2WDZA 3E18A 3SR3A 1MB0A 3PEEA 4K86A 2OVBA 2P11A 4Q37A 3VZDA 2WBLC 2ZCVA 3VM6A 4RPIA 2HJVA 1E7SA 1PTJC 3H86A 4M9CA 1FZQA 1LA2A 3R6WA 4RVSA 4TWZA 1N2XA 3L6BA 4WERA 5KWSA 5J23A 4NJMB 3IKMB 5F64A 4PYJA 3B1JA 1Y48E 3HKEB 2ZXUA 4WKBA 5CJJA 5T3UA 4EJ2A 3A14A 1L4MA 1HL3A 3KVRA 2CB9A 4JLWA 3WBBA 2PRZA 2XYPA 3D6VA 1DMRA 4G2NA 1ULSA 1YMVA 2IODA 4ZFNA 3UUGA 2BPOA 2VQFB 2Q1SA 1H65A 2BKLA 1YHZA 1C3OB 1MAWA 4HG2A 2V65A 3PS9A 1G8AA 4OP3A 4BWVA 2ZM6B 3NH9A 1XVVA 4HTFA 3LY8A 5LWHA 3IFSA 1S3GA 4H6VA 4CM9D 2IYEA 1E60A 2REOA 4L57A 4JI8B 5J4VA 1SXJC 1IOVA 1I7NA 3T9FA 4E5YA 4BJ1A 2O5CA 5ALTA 5KOYA 1BMQA 4WLOA 3SLGA 3MG9A 3SHVA 3HCPA 1LK7A 2I2BA 1GN8A 4R9RA 1FNBA 4PICA 1ZM7A 1ZSVA 1W30A 4IJVA 4NCNA 1XZCA 4FSDA 3QXHA 4MHSA 4MUJA 3KD2A 1SPBS 4K2AA 1B23P 2G0AA 2GDZA 2OKCA 2DLNA 3QVXA 3SHFA 3VQTA 4YPVA 2P2SA 1DJNA 3VV3A 4LX0A 1E96A 2NO5A 3GUUA 4O8ZA 4PFSA 1NVXQ 5JY6A 1Q1NA 4BO2A 2A9VA 2Y71A 3BZWA 4C7KA 1B0PA 1IM5A 2IYYA 5GGXA 1VCOA 1NU8A 4MO2A 2JB9A 5EL0A 3KOXA 2ZBEA 4FHGA 5A02A 2L0XA 1NLZA 1E94E 3NGXA 1M0EA 4JS0A 2P2CA 4AK9A 2YWJA 4G0WA 5LQSA 4E3ZA 2I65A 4AKGA 3QKIA 1ABFA 1YBHA 3WWDA 4RMGA 2D1QA 1NI5A 2QJFA 2WJ4A 2X5OA 1G5HA 5JJ5A 5DNYB 4B47A 1OBOA 5JG7A 3CW2A 4L4RA 4D3DA 2SCUB 5TVGA 3MLAA 1X1EA 5EQDA 1HL7A 2H0RA 3MHPA 1JA1A 3BQ9A 1D2CA 1TEVA 4MYHA 4UE2A 1JNYA 1TK2A 2I3GA 5FOSA 5G0VA 1EK0A 1HE2A 2D7CA 1KAOA 1VDMA 2A9PA 2QU8A 3E3LA 4OM7A 3L8ZA 1WA5A 2AI2A 1JKXA 2OFWA 4F5DA 2VJBA 4FZRA 4PYLA 5GM2A 1CNMA 2HEGA 3HJUA 2JIRA 3ANXA 3B2QA 2CHFA 3DG9A 4XGRA 5G3YA 2XQFA 4JI1B 3WKEA 3WSTA 2I7CA 1JQBA 1TM3E 4IRMA 1KPGA 1USVA 1J1IA 2WILA 1H4TA 1PU2A 4YMVA 5LFAA 5JHHB 3TW0A 4KPYA 2X23A 5ULLA 3DDHA 3EGIA 1KR2A 3BFXA 3HVJA 3P5SA 2H1WA 1Q22A 2B4AA 2ZBUA 4H7JA 3RYIA 4W5NA 1DWUA 3UXEA 1YR8A 2DZDA 1TLLA 5E6SB 2XSZA 1GWNA 1KA9H 1JNXX 4IFIA 4PRZA 3K72B 4M2LA 2W70A 3A4IA 4TMZA 5CPBA 1QRTA 5LIPA 1C29B 3N05A 4J0GA 3ABQB 3NGLA 5A3QA 1J0DA 1DRUA 3F8TA 5AKLA 1EP1B 5ANRB 4I66A 2C7QA 4FMDB 3IO3A 4EDFA 2W4QA 4IAOA 4Y2HA 1U8XX 1AVTA 1M1NB 5TVKA 1VMDA 1OIVA 5IT5A 4C0AC 5IXJA 2H29A 3A3NA 2X8JB 3CLSC 1JQJC 1DC3A 3AV0B 4GDFA 1NVVQ 3DFZA 2JGIA 1L7NA 4CMKA 3EA0A 3H9QA 3GRUA 5TMPA 2O19A 4ZOEA 4GP6A 1KO5A 1TECE 3U81A 3LFHA 1E3EA 4E70A 1QIMA 2MSEB 1EGVB 4AP5A 2WD7A 1IQ0A 5CDHA 2XBUA 4LXXA 1ZJJA 3CS3A 2HYDA 1UJ2A 1Q1AA 4JLBA 3FNHA 3PQ2A 2NP6A 3ZV4A 1Z7WA 4NNPA 3WJ1A 2YZ7A 4ENWA 5ISMA 1EESA 1XQWA 1U5CA 1V6AA 2XZOA 2AMVA 1NBEA 3I5UA 1RXWA 1MJ5A 4E5SA 3THYA 3EYWA 2BH2A 3T7CA 1ECPA 1JXQA 3IIKA 2PSJA 3VZQA 1YSCA 1TVKA 4TS3A 1OLXB 2DRIA 1RDFA 2NV2B 4I46A 4KQMA 1GGEA 1VE3A 2Y27A 3H4IA 2CHVA 4DM7A 4WRRA 3CIFA 3AFGA 5HF6A 5CFRA 2ZBRA 1Z0ZA 4KQKA 1N3YA 5F7XA 2AJDA 1HE8B 1SKBA 1YOBA 4UPVA 1FYWA 1NY6A 2BM0A 2AXPA 2NXWA 2E85A 3ZDZB 1NF9A 2GCEA 1JQ5A 2Z2XA 4A3SA 5JY1A 2FMUA 3AF2A 4M6WB 2OYRA 2GFHA 3IAXA 4KO3S 3UG6A 4C89A 4DY6A 5JXHA 4PTZA 1NJGA 3OEHD 5BSVA 2GPJA 3FDZA 5JRDS 2WB2A 4Y6LA 1PL0A 1G19A 2GESA 2O1SA 4HC4A 2BKXA 2H57A 4Y30A 1M34B 1C4WA 3LVFO 3QW2A 5FA5A 1NG9A 1XHFA 3I30X 4O6VA 5AOCA 4B3SB 1BXRB 5J2TF 3OOHA 3MINB 3RYCA 2WTNA 5H16A 3ZDXB 2VHZA 2WUVA 1KSGA 2UYHA 4D3XA 1TPYA 2QNRA 1NAHA 2FCRA 5EE0A 1YZTA 3RLIA 2VJOA 3GP3A 5BV8A 1KXZA 1CY0A 3TQIA 2P6RA 2JCYA 1SZDA 4E5MA 1E2GA 2MSLA 2EJVA 4Q9IA 3DWIA 4I8IA 1RC8A 1A95A 3MJEA 9LDTA 3MLEA 3H5NA 3JZFA 4MVJI 3D7KA 4ARVA 1RW4A 5CDGA 3MCVA 4MITA 4XDHA 4JB8A 4P3OA 3OZBA 3FSGD 2VJDA 2XLCA 4OREX 1YFLA 3WK4A 4OQEA 4JYBA 1EXNA 3NCHA 2IZ0A 2WB4A 1AZWA 3UK2A 3QLJA 3ZQ4A 4P3XA 4MK4A 1PHRA 2I8CA 4U2DA 1AGYA 3A6KA 4Y0NA 3GIDA 3UWPA 3M0EA 3CA8A 4IHJB 3CONA 3S70A 2QGFA 4BMOB 4PIVA 5FLKA 1FYEA 3AUAA 4P53A 4JOBA 5AI5A 2NU7A 3UQYS 1WMAA 2DBYA 2DR3A 3AO0B 3TXXA 3K92A 4B3HA 2D2XA 2R5NA 5AQ1A 1ORVA 2FEXA 4IYRA 1O5IA 1U94A 2QVYX 4EJ6A 2R0QC 2REXB 2DBZA 1GPAA 4QTXA 1OXMA 3MTIA 3WL6A 1SJ9A 2BWJA 2GEUA 3ZNOA 1BMTA 2X1LA 2YC2C 4EHJA 3M81A 4ZV9A 1D0IA 2I33A 1WSWA 1AS0A 3I9LA 4BVFA 1O9HA 4OYYA 1R4AA 1IB6A 3GUYA 5DNUA 4KZPA 1USGA 1CFJA 3DZJA 3H2YA 1KEEA 4J0FA 4NBRA 1Y6RA 2QMUA 4MVJG 3RQSA 4NXNB 5JBQA 2PS0A 3KJIA 4Y2YA 3Q72A 4PRKA 2ZFUA 1QHIA 2P2YA 3WJ7A 3O84A 3Q8KA 3AKYA 4DIMA 1JG7A 1QX4A 3C87A 2ZWVA 4Y6RA 4Z1MA 5DN6D 1FFDA 2DERA 2M1ZA 4JQOA 5E2AA 3BDVA 3RWBA 3BZUA 1H1DA 1PKEA 3RYFB 4E15A 3VBCA 4BN5A 1WB4A 4HF7A 3RK0A 4JB3A 1QIGA 1WO8A 2XQJA 2GN8A 4WESA 1EX7A 3KKQA 1L5QA 3B1YA 3FN4A 5AKHA 1NUQA 1Z4NA 1ZMTA 2SKEA 3SY8A 1HEIA 1QLHA 4AYTA 3JASB 4CIAA 3DH0A 4XRRA 4LRYA 4NNOA 4GKJB 3MUFA 1ETUA 3NWOA 4XLTA 3LUJA 2PGDA 2JLQA 4OQMA 1EK2A 4M7RA 1N6OA 3HXQA 1H8HD 3GT4A 1E2BA 1M2KA 5A05A 1KNXA 3EW9A 1DQRA 3RFTA 2BFFA 1Z07A 4XQCA 5CVVA 1CQIB 7ABPA 4H3KB 1ZA2A 3CY6A 2PKCA 1PS9A 4DBZA 5BRNA 4G1BA 5CYOA 4AQDA 2OM2A 1EJ2A 1SC6A 3FLEA 3IAEA 1IHYA 4X41A 1ZGJA 3C7TA 5E4YA 1VIDA 2C92A 1XMQB 1RAIA 1Y8ZA 5CHYA 2NU9A 4PHHA 4ER6A 3BMOA 1NR7A 3PUYA 4JN6B 1PW7A 1WW8A 3KYDA 4H2DA 3RSGA 5IJWA 4DIBA 4QPZA 3R5SA 4LJAA 3EEBA 3PNLA 2QPAA 3IB3A 3SXUA 4PXYA 4MP6A 3KLBA 1JFVA 3RSHA 3JQ8A 1XC7A 2W8ZA 2WJ3A 4FHEA 6AT1A 2A1UA 4GPTA 1P9OA 2CXQA 5HM6A 1CUIA 2F43B 4WCFC 4LSGA 3A31A 1YKGA 1N2ZA 1VYUA 2ZAIA 2HQSA 3UTCA 4AF7A 2DF8A 3GFVA 1ISSA 4L5IA 5H7XA 4A6EA 4W5QA 4LFAB 1EIZA 3F96A 4N39A 2I7XA 1TO6A 5E4JA 3OE7D 1RWNA 2AE2A 4D6XA 1I8TA 1XUOA 2GEFA 3L7AA 3DVSX 3R8FA 2F8SA 3VSBA 3FCOA 4R71A 2H7VA 4BO4A 4CMEA 3ZZTA 5I7UA 5DK4A 3HCRA 1IWOA 2G72A 1GO2A 1DC5A 4ZT2A 3N8NA 4UPDA 3O95A 5JSZB 3ENZA 3QW4B 3KQMA 3DPSA 5H80A 2H54A 2F9FA 4B74A 1JZTA 2AK2A 1OVMA 3BKWA 4KKXB 1RYDA 4PLFA 2VAWA 5JEEA 2Q3BA 5KPDA 3G2HA 1IXZA 1WD5A 5IC4A 1BYIA 1P33A 1O89A 4TTRA 1MX1A 2D5CA 1KMCA 1CS0B 3RBZA 7REQB 2IZZA 1WNFA 2FSSA 4EO4A 1JDBB 5KU1A 3HJFA 4FR2A 4IVNA 3ZLTA 1R4MB 4LOHA 4UQOA 4XX0A 1WV1A 2ADOA 5EMHA 4AQYB 3GJZA 1J2TA 1CUCA 1DJOA 1PZGA 4JT9A 4KQGA 4M37A 3THWA 4C4YA 1NYLA 3CVJA 1BWSA 3U9LA 5BYKA 5ED4A 5C31A 3G02A 2C2BA 2ZJAA 3GBSA 2QPTA 4QRHA 4BLRA 2K4MA 1EVQA 3NDRA 1K63A 2P7HA 4FD3A 5C7YA 2E1RA 3GWZA 3HGQA 4L5CA 5AOVA 5F1PA 2Q1YA 1WHSB 1O3YA 4KPUA 1BMFA 2HUPA 2PANA 3EVZA 3PCRB 4MR7A 2OXCA 5A4JA 4ZXPA 3FOFC 3WGKA 1SY7A 2W5UA 2IUYA 2VCHA 2W6ID 3O6VA 4L0CA 4D0NA 1IJBA 1FFYA 3ZEAA 1DRVA 1OHHA 3QENA 4MGIR 2TMDA 2R7KA 3MUNA 4D8TA 5B58C 3L0PA 3DA8A 5FFNA 5WRFA 4OGFA 4O2BF 2OD2A 2NVWA 3BQMB 4EG8A 3SNKA 1LPOA 3A9VA 3INRA 3FFTA 2JPDA 5A5EA 2G0NA 2IEZA 1OFVA 3IDZA 1O8CA 1KI8A 2RHCA 3QQPA 4R2KA 3F7TA 1A9YA 2OHJA 3UT5A 4PINA 3G23A 2O0JA 2M98A 1G20A 4RORA 5JQWA 4L85A 2D3WA 3JQAD 4PO9A 4ECEA 3KQHA 4BNIA 2WU3A 3FMIA 3O4VA 2BL4A 2PH3A 2GJSA 4EFMA 2P4HX 3PL1A 4D99A 1PUIA 1CE8B 3A26A 4HAZA 2QIOA 4RY9A 2IU0A 4NBTA 4WASA 4WKCA 5LQRA 4QRIA 1KO1A 1W4ZA 4GU5A 4GXRA 2XNKA 2F64A 2WJPA 2BJHA 4B4KA 1NZFA 4RQBA 1MFZA 2M6KA 4HVAA 1FPQA 1E1YA 2GK7A 4AUNA 2EQAA 1NYQA 1OLUA 2ILTA 2LRHA 4I55F 5FJJA 4DW8A 4MDFA 4B3MB 4Q05A 3IQIX 1AQIA 5K6RA 4C5AA 5FKJA 2HCTA 5JZOA 5DYWA 3T7AA 2D1YA 4GM1A 1JVSA 1SZCA 4UMFA 1KZ4A 2O14A 1ARZA 3HKCB 3TXAA 5F4BA 1C9YA 2PZAA 1RYMA 3AR6A 3VC7A 3OQMA 4ZAYA 2DJ5A 4YREA 1BGVA 3GFOA 1ZOLA 5HS6A 3JQ7A 2PYIA 4K9KA 1U7WA 2ZRFA 1Z0KA 1A9TA 2BMAA 1ES9A 1LPPA 3SM9A 4HBGA 1NBMA 4WLUA 1JQ3A 1ZK2A 1FUYB 4A8PA 4ZICA 5ES4B 5HJEA 2HHHB 3AGPA 3DMHA 4DZTA 3IUSA 4D5GA 3U1BA 2H2HA 3G82C 2Z2YA 4YCLA 3VAYA 3ZCQA 5C53B 4G41A 2IH4A 1GTJ1 3DDOA 5C8ZA 2BCJQ 3GPBA 3MRXA 3E03A 2DKOA 2Q5OA 3RC9A 2H17A 4KLCA 1Z28A 4BIMA 5B2EA 1W0JA 4DXAA 3DMTA 4GGMX 1E20A 1CP3A 3PHBE 5D8DA 3DBVO 3MOGA 5AR1A 1DBWA 3KYBA 3UCXA 1T3ZA 3I9FA 3G0CA 3WK6A 2DG2A 6Q21A 1W36D 3OM1A 3ONNA 5I9BA 1UBNA 3SF0A 4BJHB 3PGA1 4CF3A 2I6TA 4UTRA 4YUAA 2I4NA 2VAVA 1LJUA 2P5UA 3FZEA 1VHQA 5CT9A 1CUAA 5DH9A 4K05A 4TZ6A 2AQKA 1TMOA 4M8NE 4WKNA 3JV7A 3E2MA 1II9A 4X24A 4ZP1A 3HDGA 4E1VA 1QVWA 5FIUA 3HU5A 2VNAA 3BSFA 4Z9FA 1TQ2A 1XLTA 3RC7A 1BCRB 4LYAA 4XWKA 4Q1CA 5LR6A 4DV2B 3HP7A 1NTOA 4UQLA 3BXZA 2PSHA 4EB3A 3CCBA 5BMVB 1U5BA 5EHGA 3VTKA 7MDHA 3ICVA 3OT4A 1X8JA 4DLYA 1QV7A 3EUFA 3FMVA 1QHFA 4HVCA 5C4MA 5G40A 3V8MA 3OFSA 4MIEA 4X3OA 3UXMA 2ZPAA 3C7KA 1KBZA 3EXG2 3WOVA 4E7OA 1NMEA 1X13A 1A2QA 1M6VB 3DCNA 2RH9B 3FCXA 3O4GA 5AKYA 3G2JA 1KP9A 2A1TR 1F3OA 5BYBA 1ZI6A 4OL9A 4BO1A 2BJVA 2VA9A 3U62A 5JMPA 3X2SA 3EVTA 3R3SA 3IVGA 1ZUWA 2HA4A 3DE2X 2M2IA 1USWA 3OBIA 1NU6A 3D6FA 3CLRC 2P9TA 2EP7A 3FTNA 1A7AA 4GWLA 4LRUA 1U7ZA 3LHSA 1OH7A 3EARA 3OQ1A 4GC5A 3B48A 3QLUC 4M83A 1IY1A 3PK0A 1UZLA 4XGNA 3H2SA 3TCXB 2F1JA 4EYOA 3UAXA 3HACA 2XXAB 1RQLA 3HSYA 1ONOA 5EEGA 2PPVA 4CLDA 2P3QA 2I2CA 1GRRA 2ZG6A 2QRZA 2P6NA 2AZXA 1H5UA 1P5FA 4OBBA 4YO7A 5FTKA 4CR6A 4ZJUA 5ITVA 3CKYA 4MYDA 1FE8A 4P5PA 4HEA6 1RLOA 1YB5A 4YAWA 5J4KA 3RGWS 1GHTA 1MDFA 3SLRA 3NNDA 4TWIA 1L5VA 5CLIA 3ETLA 2QTRA 3WZMA 5JYCA 1X7GA 4DILA 4HDKB 4QASA 2J9GA 1ZJWA 4MKGA 5IYZA 5FTMA 4DDHA 4EK9A 3EZLA 2GFQA 4AYXA 3WYCA 1UIMA 4H35A 1T8UA 3K0BA 2IPLA 1IRIA 3HSSA 4MYRA 1JEYA 3AL3A 1GSIA 1Y82A 3IEXA 2O8CB 1AOXA 4OLFA 4GPAA 4RVUA 4HMOA 3QNWA 1ZN7A 3OX1A 3DYIA 4NWIA 2B35A 3AETB 1ONPA 3VNBA 4BRSA 1K06A 2ZRHA 4QQKA 5IVHA 1WLSA 4BHTA 3S2GA 4N76A 5DHPA 4MWSA 2V3VA 2GRJA 4M99A 3RAPR 5ADUS 5L3QA 3V3KA 4MWZA 3P9RA 4TZ0A 3O7WA 3FB1A 1VHJA 3P9ZA 4WNAA 3UV7A 1P2DA 3QKSA 3AV3A 1A3CA 1VSVA 5JRZA 2Z1DA 2R8ZA 3CZMA 2ADMA 3KYCB 4OHUA 2O7SA 4X1KB 3S2IA 2JAHA 3A2LA 1KP3A 4X1YB 3FUUA 2ZE8A 2Z2JA 4QHYA 3P9QA 2UYQA 3L46A 1P17A 4DADA 3EA5A 4X1IA 3A6PC 3STXA 1TIBA 2YCLA 3EG9A 3AMVA 3MA0A 4M53A 5TEWA 2PJRA 3EIXA 2WQZA 4FCWA 4EFLA 2D0DA 3JS5A 7YASA 2X42A 3WZLA 1E3IA 2Z6UA 1JG4A 1KPIA 1C8BA 3H1FA 1T5TA 5K6AA 5LZ7A 3KSZO 4ZI3A 1N9KA 3IPLA 3C5WP 1XCLA 1BDBA 1ZEMA 3ZD8A 1BXGB 1YF3A 2VR1A 4RAOA 2BE7A 2WWYA 4OJKA 2Z43A 2FGKA 4I6JA 1EUYA 3JZDA 2YUTA 2VYCA 2A94A 2UYOA 3GUCA 2P41A 4BIIA 3HBFA 5FV7A 2W2OA 1QQTA 2PR2A 3H8VA 3GD5A 4HAOA 4BLQA 2JGDA 4U7HA 3LY7A 4YI3A 4QSHA 4JJAA 1XEWX 2H1RA 3NETA 2FW0A 4V0ME 2XDQA 2C2WA 4G0MA 1DE0A 2W2MA 1EEXB 3DM5A 5B7PA 1TC1A 1U1FA 3LG2A 1XDZA 2JS7A 2IA5A 3KTOA 3D81A 3HUDA 3UG7A 1JJAA 2B7LA 4ISBA 3COSA 5BVGA 4X6LA 2MINB 4DEXA 1BCSB 4XFJA 3LLUA 3TNFA 4IS2A 4MVJF 5KEIA 4J1TC 1SWVA 4DT1B 4YJDA 2FMIA 3U09A 3A1NA 3JR7A 3X1MA 4BNFA 1WETA 1L4KA 1XD2B 2R62A 2ZBFA 4FJ2A 4ZK2A 2YOHA 3DYVA 1KK0A 2EW2A 4O33A 3TNDA 1WF6A 2NSLA 5LZ4A 4M1WA 3SJUA 2FE4A 2CUZA 4UVGA 4XPZA 5CJ2A 4EJ0A 2JEYA 5HIKA 1CK4A 1Y5RA 1ABBA 4HL6A 2ACVA 1SVWA 4DUGA 4D3YA 3IP1A 1R0WA 3GCXA 1GGVA 1TNDA 4G2TA 4W8HA 3R75A 4QDTA 1VL2A 3HADA 2QLJA 5DJ5A 3W5DA 4RK1A 1KEPA 4TKVB