2ZVQX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and alpha-naphthol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 106
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvqX00
2JCSA 2VHQA 4Q1AA 3Q72A 2QE7D 1W36C 3UK6A 1SXJD 3KQUA 4F4JA 4QNMA 3D31A 4YC7A 4MH0R 3PUVA 4HDOB 5FOSA 2R8RA 4JS0A 3WP0A 3LVRE 2CJWB 3E70C 4BFYA 3D3QA 1MO4A 2DR3A 3KB2A 1NVVQ 4LHVA 1E4YA 2J0UA 4MGZR 2VLIA 4C0LA 2IYZA 3EIQA 1W0JA 4EIWA 4B6EA 4G5OA 5CK5A 4TLDA 4C0AC 1S4QA 1KI2A 2XSZA 3U7FB 3C5HA 1ZYUA 4IEEA 1F3OA 2EFHB 2G1KA 3T61A 1G3MA 4B3DA 4EJSB 4GOKA 1OB5A 2B7BA 2ODWA 1IY0A 3E5HA 4Q9LA 1DAEA 2JLUA 1NNEA 3GEIA 2P65A 1HQCA 1GKUB 3NVAA 3ZYCA 4L16A 3U6KA 1XPRA 121PA 1UBGA 4TTPA 2ZE5A 2OFXA 2W00A 4HSEA 4PAMA 1E2FA 4LJ5A 1R5OA 4LWZA 4PX9A 2IUSA 1VIAA 4RKFA 1C9KA 3FB4A 4JLDA 1JPNA 2WJJA 3FFAA 5HZKA 1E9FA 2WZQA 1ZNZA 1K8RA 3SFVA 3CF0A 4II7A 1S3GA 1LY1A 3RYTC 1U9IC 2C9YA 2ONKA 4M1OA 2ZU0C 5KPDA 4JZKA 2WOOA 5EZ5A 3DPUA 1E0SA 1AN0A 1GUAA 1KK2A 3C8UA 3RS7A 2IUUA 2BOVA 3OF5A 3PV0A 4KFUA 3IBYA 1SVLA 4TLEA 5EE3A 5J5CA 2B21A 3THOA 2BMDA 2F7SA 1FQKA 2IUTA 2LKDA 4IW3B 1VCOA 2RB4A 1P2SA 4QJ4A 4Z54A 4GP7A 1L4YA 3P32A 2ZE6A 3GLFA 3K0EA 4LC0A 1DAGA 2C77A 3FVQA 4DLUA 5AJYA 2WAYA 3HPRA 2AK3A 4RD3A 1IXSB 4NCNA 1E98A 4PFSA 3NH9A 3OIWA 3AGQA 1OKKA 1CIPA 2ZSAA 1G21E 2F9LA 1SGWA 2W0MA 1Y3AA 4QM7A 2IL1A 4D0GA 4B3CA 4C0SA 3TMKA 5JI2E 5SZKB 2O0KA 3GFPA 5JFGA 1A82A 2ERXA 1BYIA 5EXTA 4DT1B 3IGFA 2BVNA 2KBFA 4A36A 2J3EA 1Y63A 3RNLA 4KITB 1FW6A 5KDDA 1E94E 1B0UA 4ARZA 3A1UA 1TQ4A 5G3YA 2RGCA 4EJSC 2J59A 5J4LA 1BYUA 2ASEA 3FE2A 2D7DA 4M0LA 2D3WA 3GD7A 5E7MA 1LF0A 1P2VA 2OBMA 1W7AA 2F55A 1P2UA 4A0GA 4EPXA 1E2DA 5CDFA 3GJ3A 5JLJA 2XXAA 1FP6A 4ZI2A 2YHSA 2EYQA 1A5TA 3A1WA 2IS2A 1U90A 3VHLB 4U02A 3TSZA 1KO7A 1YZTA 2GAOA 2V7QD 2ZRPA 4JL8A 4OQLA 5TARA 3DDCA 4F4CA 5LB2A 1XJQA 2CJWA 3MFYA 4N1AA 4QBIA 5FI0B 1Z07A 4JL5A 2XGJA 3LBNA 1TQ2A 1XEFA 3ND8A 3EC1A 1XJCA 4Z51A 3K0FA 5KU1A 2XTMA 1L4UA 4V0OA 5BW8A 1WB9A 4M21A 2UKDA 2QGNA 3NEJA 1XD9A 4G1UC 3K0SA 1S9DA 4I1OA 2CNWA 4YONB 2FEMA 4LHWA 4ACBA 3A4MA 3PUYA 4XWAA 2O8DA 4NMMA 2XITA 3CX7A 1R10A 1W5SA 5GVSA 4WZAE 1R5BA 4GBMA 1TQ6A 1ZM9A 1W4AA 1EWQA 1KJYA 4HUQB 5CDFE 1AS3A 1J8YF 4A92A 1G4AE 2A5FA 2V55B 3BS4A 2ONJA 1E6CA 2C95A 4TQAA 4RZ2A 4UQOA 1NBME 1ETUA 1JR3E 1L8QA 2D4HA 3CF6R 1BS1A 1GRNA 2VF8A 5BN3A 2F1RA 3NHAA 2ZI6A 2YWFA 2ZJ8A 1LTQA 2BJVA 4GZMA 4EUNA 1CULC 3TKLA 1K5GA 2BHRA 3RLFA 1N5LA 3K8YA 2ORIA 3ICQB 1AZTA 1SVOA 1HEIA 1X86B 2YVUA 3UIEA 1P3JA 4V0LA 5AUQA 4M8NE 3SJBA 1ZD9A 2H5EA 3I4LA 2FSHA 2YNMA 4MYHA 3PXGA 1Q0UA 5FTKA 3K09C 1N6LA 3GJ0A 4NL4H 3OFNA 5G40A 2FOLA 1OKKD 2VP6A 4R7ZA 3JZMA 4JSTA 4TN1A 2HJGA 3C4JA 1N6PA 2X77A 3ZJYA 4ESHA 2CE7A 3CM0A 2ZIAA 1HYQA 2F1HA 2FMXA 5CYOA 3SEAA 3B85A 3AF3A 2V8OA 5CJPA 4DCTA 1N0UA 2BBOA 5B58C 4RD0A 2EFDB 1W4CA 5DIFA 2GJAA 1Q57A 3KX2A 3T1VA 2ZEJA 1IXRC 4RFSA 1Z6TA 4ZV4A 1QHHB 1UEJA 1ZCBA 2V7QA 3NDPA 1I4DD 1US8B 1RJ9A 3VR1A 2OE2A 3CB4A 1FPMA 3A1VA 2GJ8A 1VKJA 4DEYA 1CS4C 2IT1A 2JEOA 1YE8A 2GAAA 3AP1A 2ZJ5A 1G7RA 1ZVQA 3FGNA 5EQTA 3TSOA 5F2EA 1ZM3A 1COWA 3W5IA 3VKGA 1MABB 2RGDA 4W7SA 2ZRKA 4JLJA 1II8B 3REGA 2IS6A 3T5DA 1YQTA 2MSCB 1Z3IX 4WVFA 3QUSA 1QG2A 4JLNA 4Q7KA 4EPYA 3CNOA 1RYHA 1RRFA 2PEZA 4NKRA 3DO6A 2YC2C 3A58B 3CNLA 3GCGA 1SKYE 2FPLA 4LBZA 3BH6A 6Q21A 2JLXA 3KFXA 4MGYR 4Q19A 2QN6A 4Q9HA 3B1WA 5HCIA 3WRYC 4F91B 1GTVA 1T6NA 2WJVA 3QPVA 5FUYA 2ZREA 4HATA 2KBEA 3BOSA 4LJ8A 3TUJC 3W6NA 2GDJA 1CLUA 2XOKA 4OHWA 4EPRA 2YWGA 1ZUIA 3QKSB 4KV9A 1GL9B 1S1MA 2J41A 4D0NA 1SXJA 1JR3D 5BQ5A 1XRJA 3W5JA 1ZM4A 5G41A 4JBWA 5C4MA 2BV3A 2H17A 2ZR7A 3LXXA 4A6PA 3B1VA 4FMDF 1PV4A 4RKEA 5K8LA 4M1MA 4DLZA 4KSCA 2V6IA 1ZBDA 4RZUA 1E2NA 3KTAA 3OZXA 2OBLA 1PUJA 1N3BA 4M9XA 3ND9A 3QPUA 4DSOA 3CX6A 2GHIA 2PLRA 1Z6XA 2YOFA 3SJCA 2ZUBA 4UNRA 1E1RD 1MV5A 1TEXA 5KTYA 1U99A 2FGKA 1OXVA 1P9NA 2WPDA 3X1ZA 2VP4A 2W2VA 1L7VC 2GXAA 4ZKEA 3QVUA 4IFBA 4PSAA 1TNDA 1T91A 2REXB 5EE1A 3I61A 1E32A 3IHLA 2QPAA 4LYFA 2DWQA 3GJ6A 1H8HD 1FQJA 5A0FA 3RRNA 3X1WA 3RAPR 1YZQA 3QG5A 1G1MA 1XEWY 4XTCS 3LQRA 4Q7MB 4Z1MD 3U44B 2ANBA 1UBEA 4TTRA 2CVHA 4BE7B 5B64A 1JNYA 1P7CA 2NOAA 5C4GB 3QJYA 4OQXA 3PCRB 2EVWX 2MMGA 4LBYA 1Z6YA 3DEFA 3CUEF 4LBVA 4NTZA 3U5ZB 2GCOA 1TF2A 4Q5IA 3ADKA 4FD2A 2G0NA 4BLRA 3CONA 4M1KA 4KVGA 1EFCA 3VKWA 1ESNA 3BJIC 4IDNA 3VNUA 2F9MA 2QE7A 4NYIR 5AJXA 2ECKA 3PENA 3RANA 1SKQA 2ZJ2A 1KSFX 1Q20A 5FR2A 2JLVA 2BC9A 2CK3D 2KB0A 5EUMA 2H18A 3FKSA 2R65A 3O47A 3IPXA 2H57A 2F1JA 5FBWB 1W5TA 1ZCAA 3CLVA 4Q4LA 5J4HA 2X2EA 4LOAA 2R6CA 1SQ5A 4UKDA 5JBQA 3B60A 1RIFA 2WJIA 2AWNA 3RS2A 2IXGA 2X2FA 2NGRA 3IEUA 1Z0JA 3AKCA 4JVMA 1A7JA 3DM5A 4D6PA 3NXSA 2DWPA 1KO5A 2Z5FA 4RD1A 2WWXA 1NF3A 4WZBE 4B3XA 1R5NA 5FUVA 4CVNA 4AK9A 1H8EA 1CJUC 4ERNA 4G0NA 3BH0A 2G88A 4HDCA 1N6NA 2ZSBA 3AVUA 5UKDA 1N6HA 2OUKA 2AKYA 2EWVA 4EKDA 1DAIA 1D9ZA 2XX3A 3NC0C 2MSDB 3SHWA 2HYDA 4E5UA 4XSHA 1XCPA 2VHUA 3NH6A 3W8RA 2ZUDA 1FUUA 2J45A 4GSYA 1XFAA 3O8DA 1EX7A 1IBRA 2RGAA 2WJHA 4PR0A 2O8FA 1EFTA 4QNRA 1T8UA 3MD0A 5KSOA 2HDNB 4URVR 2VP0A 3L8ZA 1YVDA 1SHZA 5IF9A 3HU3A 3KQLA 4D26A 4FCWA 3R7WB 2F6RA 1G20E 4A0HA 5BXQC 1AGPA 5EXPA 4CW7A 2RGEA 2DFTA 5H8WA 5GJCA 1DG1G 2ZRIA 3OEHD 1R0WA 2O8BB 5KNCA 1GITA 2VIIA 3NEYA 1WCV1 2J9RA 1D8TA 2A5YB 1MO5A 4FCVA 2B6HA 3U61B 4GOJA 1YR6A 3T15A 3UWOA 1ZAKA 2QBYB 4AKHA 5GJWC 4TQUS 3SFZA 1U98A 3ASZA 2GESA 1JEDA 3OE7D 3R7WA 2O0JA 4QFMA 1XTIA 2Q3FA 1U0JA 3AM1A 1F2UA 4ZDWA 1E99A 1N6IA 4D4LA 3U60B 4JVLA 1Z83A 2E87A 4YDSA 3ADCA 1AGRA 2JLSA 1E2PA 1WXQA 2FN4A 3AV0B 1E2HA 3EA5A 3A4NA 5EE5B 4GT1A 1G291 1NKSA 4ON9A 2VPPA 1P75A 4M1YA 1MOZA 1TF5A 5CM8B 5L3QB 4OHZA 4XVRA 3L0OA 3F8TA 1CBUA 4OK6A 2FEOA 5J4KA 4MA4A 2E9SA 3AVOA 5FH9A 4DB2A 5B30A 3LH5A 1JAHA 4XWKA 2Y8EA 3BAFA 1XEWX 1TUEA 4A8JA 2D2EA 1E9CA 1XXHE 5FPTA 1KDRA 1NN0A 4MUBA 1QHYA 4BEBA 3AVWA 2JDID 2QP3A 1MABA 3WHKA 5JHGB 1YZLA 4HB3A 1WBDA 3ADBA 5DHAA 3X1DA 2XTZA 2FGJA 3CX8A 4UJ5A 5JS7A 2ZRMA 3ZQ6A 1Z0DA 2QG6A 5IK2D 3M6AA 3V4RA 5F3WB 3D8BA 2WBLC 3TAHA 2VHJA 1RJ9B 2BEKA 1XWIA 1NBMD 4RFSB 3R9WA 1NKTA 5JJIA 1W0KD 1RKBA 4EAQA 3UPUA 4Q4HA 1MRSA 4JT4A 1NI3A 3CRW1 2QZ4A 2V3CC 1XCGB 5SZJA 4OJKA 1G7SA 1AKEA 3IEVA 2OZEA 2IS1A 1GL6A 2NO0A 3LLUA 5CM9C 3C15C 2ZVQX 2EYUA 4Q1FA 1SVWA 3U44A 4DZZA 3QXXA 4NYJQ 4CZ2A 1VHLA 4DWJA 1W2GA 3B82A 2XTNA 4BEJA 1ZIPA 2DWOA 4F4IA 4AI6A 4QGFA 5EP1A 3PJRA 4B3FX 5GJVC 5TXGA 2C8VA 3AF0A 4TT3A 4BFWA 1UFQA 2IWHA 1BMFD 2H92A 3FMFA 3PFIA 4Q1BA 3GJ5A 2W6JD 3CO5A 2EU8A 4US1R 4DRZA 2JATA 1CU1A 4C30A 1YKSA 3KFVA 5SZIA 3U6BA 4JVNA 4M1TA 2WM9B 4NHOA 2AWOA 3BE4A 5KDLA 4ZCLA 2W0SA 3I8XA 4YDHB 4E03A 4TYNA 2R9VA 2J1LA 1N5IA 2KWIA 4DKXA 3UMFA 1JXOA 3AP2A 2IEYA 5DSZA 3EZ9A 2B8WA 2C2HA 4URXR 721PA 2I1QA 2QA5A 3DM9B 4JIMA 4DLRA 2GEUA 3THXB 2VP2A 2VF7A 4YMVA 3T12A 3N70A 1SVKA 2HT6A 3MWLA 4RY2A 5AJZA 3B9QA 3DMNA 4MKIA 1MT0A 3A1TA 4ZI3A 1ZUHA 4BPBA 4LJ4A 4URUR 2V1XA 2G83A 1UADA 3QBVA 1V5WA 4OKSA 1SVIA 2QP4A 1TPZA 3DOEA 5J40A 2V54A 4TL6A 2G0TA 5HE8A 2DY1A 2XJ9A 4Q7JB 3K1JA 3LWNA 5DI3B 4EFMA 1LF5A 1W48A 4TSFD 2P6RA 3I1FA 1NN5A 1D2NA 3L0SA 3WNCA 2ZSEA 4HYYA 1I2MA 1G8HA 1RVDA 1NLZA 2PX3A 3LQQA 3P4YA 4NCIA 5BYJA 1EFRA 5JS8A 4QHYA 1CJKC 2ZAMA 2JDIA 1DADA 1S8FA 4LSGA 2CE2X 4KSBA 4V0ME 3LY5A 2F1IA 4LPKA 2WTUA 2C04A 2TMKA 3CZPA 5DI9A 3SYLA 2CHVA 4L5BA 1HA3A 5CJ2A 4KFTA 3QBTA 4QBFA 4AYWA 1DE0A 2BKUA 4Q02A 1XTJA 4ILEA 3VHXA 4QG7A 3CH4B 3ADDA 5L8VA 2BIFA 3DKVA 4DB4A 5LPNA 1XXHB 3EA0A 3RWMB 5KSYA 3GLHB 3I3SR 4O25A 4ARZB 3BRWD 3OEED 4MDFA 4A0FA 1KK3A 4FWTA 2JA1A 1WA5A 3TW4A 5KSZA 5H70A 4HLUA 4UNSA 3GEHA 4CEIB 2QROA 4LJAA 4DT1A 1US8A 3CNNA 5C1BA 4LX0A 3J81k 4C7OB 4PPFA 3RS4A 3CKLA 4PO9A 3HP1A 4HZUA 4XH9B 1GZSA 1AQYA 1ZP6A 1G8GA 4CT5A 2WSSA 1Z29A 1G7CA 3VR5A 4TMVA 4BLQA 2O5VA 5DN6A 3Q7PA 2JLQA 3AUYA 1NVVR 1F2UB 2KJQA 2WJGA 1IAQA 4BLTA 1KSGA 5JMTA 3NBXX 4B34A 4ZIRA 1U2RA 3KXIA 2VQSA 1EK0A 4A82A 1EFUA 1M2OB 1VYTA 1W44A 2HXYA 3HU2A 4R2HA 3U3MA 2XNSA 3ZVRA 4LYHA 4PSKA 3L0IB 2AHOA 1D9XA 3NC1C 3TJZA 5KNDA 4LYAA 2O8BA 4Q48A 3RC8A 3PEYA 1IN5A 4TMZA 4P33A 3RHFA 2WV9A 4CYMA 4M2LA 4PPQA 4Q4AA 4X8LA 4AG6A 4JLAA 1C4OA 4P4SA 1O87A 3CH5A 3KZ1E 3PUZA 3QF4A 4XTRA 3K70B 4JBXA 3B5JA 4ZDIA 2JJ2A 2QRZA 2GETA 4OQMA 3K9GA 3B9PA 4KYIB 2IEZA 4N0EA 3PEWA 4CF7A 4WZ6A 4HZIA 1NSTA 1T0JB 4HUQA 4DLYA 3WNBA 1KJZA 1OF1A 1R7RA 4HDQB 5TB5A 3T1OA 1S3SA 3I5YA 1H8ED 1TTTA 5LD2C 4TZ0A 5C18A 2ZRHA 2LWIA 1F2TB 421PA 4AURA 8OHMA 4HUTA 1VYUA 4V03A 4QOSA 1X8LA 3TQCA 4UNQA 2F43A 1N0VC 2P67A 3U3JA 4CT4B 1GL7A 4PO8A 5ANRB 3GLGB 3ZVLA 1OSNA 2WHXA 1U0HC 1YR7A 3BH7A 4FMDB 4TQ9A 1OHHA 2QTVB 1KI7A 2ODNA 4LV6A 2P6UA 1R4AA 3BERA 4D82A 1MO6A 3EASA 1N5JA 1SZPA 4IDQA 4Q47A 4D80A 1N0WA 3EPJA 1X1SA 2GCPA 4FN5A 5FL7A 3MG9A 1Z22A 3C7KA 1P9RA 3QKRA 4FMCB 5DH9A 5C2JB 3FKSD 2P5TB 4LJ9A 3B1ZA 2CK3A 4NCJA 4DBLC 3SU8A 3H84A 3IUYA 4M9ZA 1DBSA 5L3SB 1B23P 4IOLA 4Q01A 1ELOA 1YZUA 4IEIA 3U7GA 4CGZA 1FL9A 3WP1B 1I2DA 3TSWA 1KKLA 2A2ZA 2RKOA 2N1BA 4DLVA 4TLBA 1OHHD 3FWYA 3PEVA 2WICA 4BASA 1YZNA 1NLFA 4J0QA 2PT7A 4WIAA 3LX8A 2ATXA 2NO9A 4E09A 2REBA 4AYXA 2XZPA 3SYNA 4E22A 3O8CA 4IOJA 1NG1A 2GCOB 4JYBA 4POAA 1NY6A 4LJYA 2EFGA 1VIYA 4TMTA 3TRFA 1KJWA 2OAP1 2VTKA 4H9GA 3W3ZB 3RS5A 4P0TA 1G5TA 1E9SA 2OCPA 4NDZA 4DDUA 3THWB 2ZS7A 2FSIA 1H8HA 2BM1A 4CEJB 2Q9CA 1W4BA 3SR0A 5EXSA 4RD2A 2DFNA 4RZXA 4NONA 4FMBB 4PC6A 3QENA 5AUOB 1IQPA 1G9XA 1ZNWA 3HJNA 5AWFC 1R0YA 2O8CB 3U3OA 1A1VA 1ZJ6A 4A2QA 3R9IA 5G3ZA 3AF1A 1XMIA 3U4QB 2IBMA 4C2UA 1E1RA 2W83A 4PTLA 2J87A 3NWJA 1G16A 2OBNA 3RRMA 3CRQA 2YWEA 1BH2A 1K6MA 4NYMR 5JSZB 2ZITA 2VSOA 2QU8A 1Q44A 3KJHA 3BC1A 2UZIR 3C5CA 4L4UA 1LVGA 1DOAA 4Q4JB 4C0BA 1C1YA 2FF7A 4PAQA 4BUJA 4HZUB 3AF2A 1W47A 4W5JA 1CJMA 3AVPA 2WWGA 1N5KA 1QF9A 2VHTA 4F93B 4C0QC 1NY5A 4HAUA 1E2GA 3AKDA 4NP6A 4KYUA 3AB3A 5TY0A 3ZIAD 3QXJA 2BWJA 4M9SA 2FDCA 4C7OA 5FOXA 1EX6A 1YRAA 2XOKD 1GRQA 2C99A 3FMIA 4PC1A 4TL7A 3TVTA 3KQNA 2ZPTX 4UNPA 3GLHA 1UDXA 3QKSA 3SC3A 4AD8A 2RHMA 1OXSC 5FPYA 2IW3A 2GZDA 3FHOA 2YYZA 4NPHA 2KE5A 4L15A 3UG6A 1XF9A 3BK7A 3I62A 1VG9B 5FOTA 4YXWA 3TGPA 1IM2A 4HEJA 4WXPA 4A8JC 2DYKA 4WW0A 1LW7A 1M7HA 4WOPA 1YR9A 1IXZA 1XZPA 1WRBA 4QC2A 1KHTA 4Y0AA 3VR3A 2FNAA 4QJ5A 3VTKA 1KSHA 1T3LA 3B78A 3LFUA 4MKHA 5FR1A 1EXMA 3K0CA 3M1IA 4PPGA 5E7IA 3R9XA 4LCBA 4KO8A 3VAAA 2ZSDA 1GNRA 5DI3A 2R6DA 4IOMA 4N0DA 1LFDB 3DOFA 1Z0KA 2C96A 1NMYA 4MRVA 3LVQE 3B8HA 1ZMXA 4BQSA 821PA 1ESMA 3EIEA 5AUNB 3AVXA 1LB1B 5JRZA 2IYSA 1DAFA 4B75A 2HUPA 3JVUA 4AIIA 4AY2A 2Q6TA 1Q1BA 3RRYA 1WBBA 4QM6A 2JJ1D 5JJKA 4PANA 4UJ3A 1QHHA 4L9SA 3WNDA 3WMGA 1G3IA 2Q9BA 2RMKA 2A5GA 2NZ8A 4QGHA 3ZGXA 1VDZA 2FE4A 3LBIA 3VR4A 5JEEA 1KKMA 1XU4A 4EQ6B 1WE2A 1T4GA 2LCFA 4P32A 1E9RA 1DARA 4R2IA 3KKQA 3OFND 4NYJR 5D3QA 2WWHA 2BM0A 3R8CA 4JKYA 4BLOA 5JSZA 2IS4A 1XPOA 2RAPA 2AX4A 4LYJA 5GJBA 2W6IA 4PQYA 1U0LA 2IXFA 4UXIA 4A1FA 1D2MA 2QM8A 1G8FA 4M9QA 3LO5A 4IHQA 3PVSA 1OYWA 2O0HA 4Y0VA 4RVCA 4OI1A 1XBTA 4TT3D 3S1AA 1QRAA 3P20A 4Q21A 2WJYA 3I5XA 1Z06A 3IILA 3BGWA 2FZLA 2SHKA 2DB3A 3B13B 1K5DA 3B7GA 3TUIC 5B57C 1DAHA 4D0LB 1P4SA 3THWA 1UKVY 2L0XA 5K8UA 2QY9A 1G6OA 2C03A 2GCNA 4OHVA 1KI6B 4RFVA 4EQ6A 4GDFA 1R0XA 2QI9C 4PC2A 1VG1A 2GNOA 4TMXA 5JECA 1GRRA 2PJZA 3IKJA 1ZRHA 1IN6A 2OLJA 2IK8A 1O3YA 2XJ4A 1KAOA 2QQ0A 3MWYW 1Q22A 3WXMA 4G5GA 5J4YA 4PHTA 4A6XA 1NBMA 1Z0FA 2QRNA 4BLPA 2BJWA 3H4MA 4G01B 4MYTA 3BFXA 4B43A 2GJSA 1KMHA 3DMDA 3OAAD 1JALA 2JJ8A 1GDDA 2OFWA 1E2MA 2PH1A 2OFOA 1YR8A 5FTLA 4KI0A 4LHXA 1CJTC 3C16C 3QKRB 3QVVA 3SBDA 2OSBA 2ZYUX 3QG1A 1GKYA 4DJTA 3NTUA 4MKGA 2X8AA 2HF9A 4B47A 3P1JA 2P5SA 2FFBA 3EPLA 2FG5A 2JIZA 2QTHA 4C3ZA 2PZEA 4GP6A 3O8RA 2KSQA 2Q3MA 4PZZA 4D81A 3CR7A 1TL7C 4Q7LA 4F38A 1BO6A 2OXRA 2WAXA 5ELXA 1VG0B 1HUQA 3BORA 4KBGA 2J7PA 3U7EB 4NCKA 2V1UA 4PAOA 1I4TD 1TX4B 1T9HA 4JKIA 3EARA 4B48A 2GZAA 4HB2A 1KTVA 1VCIA 1G3QA 2XAUA 1G64A 4H1UA 3GJ8A 1WMSA 3H86A 3KXKA 4JL6A 1NVWQ 1P61B 4HLUC 3EWSA 4US0R 1AK2A 3VFDA 4DDVA 5FI1B 3EWAA 3IO3A 3MMPA 4FWIB 5FBLB 4HLDA 1SKYB 3EX7C 3HYTA 1CR1A 1GAJA 1G7TA 1FOEB 3MJRA 3ZS8A 1OH7A 3K9HA 4B33A 2IHBA 4W5HA 3AGPA 5AUPB 1QBKC 1Z28A 1FUKA 1XP8A 3N2EA 1M7BA 2GKSA 5AJWA 3Q8XB 1A2KC 2VHCA 1VTKA 1UBFA 3I73A 2PMDA 4IXMA 2CCKA 3EW9A 2AD5A 1OIWA 3HWSA 1JECA 1ZU5A 2BMEA 3PUXA 3MJHA 4C0KA 2ZVPX 2Q21A 4JT2A 3LA6A 3VKHA 3VR6A 4OK5A 3IO5A 2AL7A 3LW8A 2FSGA 2V6JA 3ZD6A 2OESA 2H16A 2PEYA 4ESVA 2OM2A 2OG2A 4DSTA 1KDOA 3VQTA 1AA9A 3T34A 4YQFA 1QHNA 5TVKA 1XNJA 5FBQB 3UMSA 3ZZ0A 3AP3A 5KUTA 3TVDA 2ZJBA 2O8FB 3LLMA 4MUAA 3NIBA 3WMEA 3EC2A 3A4LA 1GWNA 2VSFA 5JI3E 1P60A 3KDSE 4RJLA 3UXMA 2QMUA 4P31A 4I1UA 2VSXA 5DO9A 2OO7A 2DCUA 2W2XA 1E79A 3F0TA 4JLKA 2R6AA 4B2PA 3VX4A 4HAZA 4EPVA 4LUCA 4EFNA 2FWRA 5IHPA 2RGGA 3KJIA 1J70A 5TV2A 1MKYA 1E9AA 2ODEA 3QXCA 3ASYA 4C9BA 2ZE7A 4BRUA 3AVVA 5TDHA 3CPEA 3I8SA 3G0HA 4YMWA 5GVRA 2PX0A 2C5LA 1CKEA 1HH4A 2FFAA 2XZLA 2PZFA 5JJLA 1DAMA 3U3KA 2PCLA 1XB2A 2XSZD 3SS8A 4TYPA 3X2SA 1NG9A 2O8EA 3TR0A 4KLNA 1EG7A 1TAGA 2ZROA 4M1WA 1Q3TA 5E95A 1EWRA 1W36B 3MSXA 2J0UB 4OL0A 5LDDC 2BMFA 4CRWB 2QTFA 5F9HA 4HI0E 1ZD1A 3VU9B 3BFVA 2ZU6A 1M7GA 3PR1A 1PVOA 2FFQA 2AXNA 4HB4A 4B3BA 5DGXA 3LXRA 4K8OA 4B73A 4BFSA 4KXFB 1KMHB 1R8QA 2JAQA 5DNYB 1X1RA 4LHZA 4MRSA 3L2OB 3OIYA 5CIQA 5KPJA 3TAUA 4ASUD 4QHTA 2ERYA 3GLGA 3GPLA 2QMHA 2F43B 4PZLA 1OFIA 3Q3JB 2VL7A 3PQCA 2FFHA 1FNNA 3SOPA 1F2TA 2A78A 1ZNYA 1S96A 4PXAA 1KI4A 2PMKA 1S2MA 4LV8B 4B32A 4CEHA 4C4PA 1KAGA 2CDNA 4Z1MA 1MH1A 2CMKA 3GEEA 1OJLA 5CITA 3BWDD 1KI6A 3ZS9A 1E2IA 3HYRA 1IJFA 5KDOA 4URYR 1GP2A 4QRHA 5BN5A 1HT2E 2R6FA 4FW9A 1AS2A 4JVSB 4P4SB 4LK2A 4Q4AB 1VCNA 1IJEA 1E4VA 3BFKA 4S35A 1PJRA 4IVPA 5JRJA 4XIGS 3UMRA 2PZGA 2X19A 1E96A 2WPDD 3TH5A 2GF0A 3KUCA 3QEOA 4RCZA 3ZDQA 1E79D 4GNKA 2FH5B 4AKEA 5L3VA 4DCSA 1G3RA 1MRNA 1FMLA 1XD2A 2GILA 2R2AA 2IXEA 1E2QA 4JLOA 2H1LA 1KY2A 2W2TA 5FOWA 2GZHA 5TMPA 1KO8A 4IDOA 1UM8A 4OYHA 2B7CA 2MMCA 1F5NA 3JZAA 1E2KA 1G18A 2ZUCA 2ZJYA 1Q1ZA 2C9OA 1YZGA 2MSEB 4NE2A 2V9PA 3IPYA 1NJGA 2GF9A 2OLKA 4Z8XA 4QKQA 1JR3A 2UZ3A 5FTJA 1Z2CA 1CJVC 3O8BA 1OXXK 2QENA 4A4DA 1KI3A 2RGXA 3TR5A 3P4XA 2DPXA 4RD6A 4A0RA 2FV8A 4BGDA 3AKYA 1OT3A 2ZRBA 4D4KA 2ZI3A 3FMOB 1CR0A 1E2LA 1G19A 4A15A 3AVQA 2AN9A 1OFTA 3K70D 1GKIA 1JEEA 1PLKA 1KDPA 2IYVA 2IHYA 4DIEA 1AQUA 1GNPA 3QOFA 4I1VA 1OYYA 1N6KA 1D2EA 1D6JA 1N6OA 3K0CC 3SDZA 2NPFA 3DHWC 3W90A 3THYB 4D2IA 1KDTA 2CL7X 2EWWA 1U81A 3K0AA 1COWD 2ZYVX 2CLDX 1FX0A 5AJVB 3GMTA 2OILA 2RCNA 1Z8FA 4NYMQ 4EPTA 5KNBA 2JIZD 1J90A 5FUWA 2Z4RA 1AJEA 1E9BA 3UANA 3MCAA 3ZVNA 5EUQB 1AS0A 4JLPA 3A36A 5JWOA 1CXZA 1UBCA 1RYFA 2OEPA 2PL3A 5DE3A 5JWHA 1LV7A 4AKIA 1JJ7A 1JXMA 1FNMA 2CL0X 2XEXA 4K46A 5HTKA 5GADl 5CIWA 4LY6A 4DHEA 4XJXA 1V43A 2HCBA 2C98A 2ZI9A 2LKCA 1FP7A 1DS6A 4B71A 3WBJA 2A7QA 3QF7A 1GNQA 2X1VA 3Q9LA 2Z83A 3LAWA 1JPJA 3CRRA 2ZANA 3WY9A 4QHSA 4ZO4A 4R9UC 4JLBA 3HU1A 3CW2A 3GLHE 1VCMA 1DVRA 4LPSA 1G8YA 4P4UA 4Q4JA 4B74A 1YU9A 3MLEA 2DFLA 3QQ5A 4KCGA 5FL3A 2Z43A 4BLSA 4MRRA 1G5PA 2AFIE 1E2JA 1OIVA 1P62B 2BMJA 2VO1A 3NBYC 4R98A 4V0KA 4D25A 1MO3A 1FTSA 1U8ZA 1WF3A 2QAGA 4GFDA 1NRJB 5KO2A 3U4QA 1QVAA 2I3BA 3MUFA 4URZR 3FOZA 2PCJA 3RS0A 3SI7A 1OB2A 3L82B 1AM4D 2ZRAA 1NN1A 1NLYA 5K8IA 3EZ7A 1KOFA 3L8YA 5DYIA 1S9HA 5CLLA 5KOYA 2XZOA 1W4RA 3U7HB 2J7KA 1OFHA 3NBZC 1SULA 3F3YA 3BBPA 2J7PD 4KU4A 2IA5A 4M4SA 1N6RA 1G41A 3A8TA 3G82C 1XMSA 4JSYA 4EPWA 4MDEA 1CF4A 5EP3A 2NIPA 3SQXA 1T3HA 4BECA 4XVUA 2ZJZA 3D6TB 4EDHA 4GI7A 2YZ2A 1KO4A 3B2EA 2B92A 3KKPA 4Q9JA 2CNWD 2AD1A 2GXSA 4BFTA 4BFXA 1RPZA 4Q4HB 4TMWA 4GL2A 2N46A 4RZ3A 1KI8A 4DXAA 2NZJA 3WYFA 1UDWA 2QPTA 4BFZA 2CHQA 2RGNA 2WIBA 2P3SA 2WWFA 1W2HA 4MGKR 4QBHA 2AKAB 4MITA 2YINC 4AYTA 1RC8A 3OAAA 2WOJA 4MRPA 1M8PA 1OIXA 2E1RA 2HEIA 2VRWA 3KJEA 1JI0A 2Q3HA 4B35A 1N2CE 1KY3A 1P5ZB 3OHMA 3WYGA 3PIRA 1J99A 2FU5C 3CPHA 3QEJA 4NH0A 4PHFA 4NU0A 4U7DA 3M4YA 2A30A 2WMOB 2A9KA 2O8EB 2XXAB 3H0KA 3T5GA 4BRWA 2ZQ5A 4W9MC 3GFOA 4LRWA 2WKPA 3QXHA 4NCHA 2UVQA 4KJZA 4LHYA 4DCUA 1X3SA 2QUZA 3QPWA 3JVVA 5FPHA 2FPMA 1OXTA 1KZ7B 5CB6A 2IYQA 4LBWA 5FUXA 2GXUA 1HE1C 4YMTA 5EXXA 4XVQA 2HXSA 1NMZA 3AQ4A 4U00A 1RZ3A 1OLOA 1M1YE 1ZM7A 3FHCB 1JQLB 2CLCX 4TLAA 1KK1A 2GK7A 2GBLA 5P21A 3RABA 4CIDA 1R2QA 4D4MA 1Z08A 2CVFA 4DLTA 4Q03A 4HLCA 4UXJA 3CZQA 1GIAA 2CXXA 4HAXA 2IX3A 3CRMA 2ZS9A 3F5FA 2YJTD 3SJAA 3K70C 2HV8A 5D3MB 5FFMA 5EP4A 2W6ID 3FTQA 1J2JA 4LZZA 1IN8A 4ZDJA 3PEUA 1CRQA 1CP2A 3EXAA 4IRUB 4PHHA 2GXQA 2PBRA 1VECA 1XD8A 2GK6A 1G6HA 3DL0A 4KHZA 4Q00A 1X8KA 1XX6A 2QAGB 1S0UA 1OW3B 1NJFA 2IYTA 4MGIR 4MYUA 5E7JA 3ZQJA 2HF8A 3R8FA 4PQFA 4YLGA 4C0HA 2QBYA 2A5DA 2OCBA 1NN3A 3R20A 4Q1EA 3KUDA 1A4RA 1ZINA 2Q9AA 4DVGA 2NO1A 2JJ1A 1ZU4A 3CIOA 5HZHA 1IY1A 3RS3A 1E9EA 3KTAB 4R71A 3KKOA 1NSFA 4URWR 2IYUA 2IYWA 4G5RA 3TBKA 2ZRCA 2R44A 5B2ZA 2QSYA 1AKYA 1NL3A 2FPKA 2VYFA 1P72A 1BIFA 1KNXA 3N2IA 2ODBA 2FA9A 1OFUX 1X8JA 1T8TA 4US2R 4Q1CA 4Q9IA 4PHGA 5D3MA 4AG5A 1F60A 1ODFA 2W58A 4HAWA 2CHGA 4QBGB 1N25A 3FMPB 4WAUA 4P3YA 3HR8A 1NIPA 4L8GA 1FMJA 4BWYA 4OQFA 1FFHA 4LDJA 4OK3A 5J47A 1FX0B 2D7CA 4OI2A 4OI4A 3K9LA 2QEQA 2WKQA 4B2LA 4X8HA 1KIMA 4YXWD 2CBZA 1OXUA 4DLWA 2WVJA 3RRZA 3VX3A 4U5XA 4QJ3A 4Q1DA 5HKKD 4TZ6A 1EESA 2D74A 2AK2A 1GSIA 2D2FA 1W0JD 2Z0MA 3BD9A 1CR2A 3SN6A 2ZR9A 1II8A 1E9DA 2D06A 2WWYA 3RSOA 5K8TA 2QT1A 4ABYA 1YJ5A 1CR4A 3B6EA 5A5GA 3NHBA 5E4FA 4BFVA 1PZNA 1ZW6A 2OXCA 2C78A 5FOUA 3ZIAA 4JMPA 3KXLA 3UWKA 2YV5A 3ECCA 2Q0HA 2J46A 3PUWA 4MKFA 1Q3HA 1SVSA 1TU3A 3RC3A 2K5UA 2DHRA 2YOHA 2GWHA 2XNDA 3KL4A 4A9AA 5FPSA 2ORWA 5HCNA 1NP6A 2RH5A 3ZH9B 4B76A 5JEDA 4BZPA 2GJKA 4DLSA 1QHIA 1HE8B 1SVMA 1KSJA 4ITRC 2CLSA 4DUGA 4HAYA 4XWOA 3LRPA 2QL6A 1MR3F 5LB4A 1WDTA 2YC4C 4BZQA 2BKEA 2ZYTX 5E3HA 2HCJB 2AR7A 2WKRA 5C46F 4FMCF 4NYIQ 3GFTA 4BFUA 2VEDA 2R6GA 5FOVA 1G4UR 4GOXA 3NDBB 1ZM2A 4PZYA 2QP9X 1Z6AA 4PQRA 3Q5DA 1XTRA 2FJUA 3S1AB 1RE0A 3TK1A 2BBTA 4TL8A 3NBFA 3TLXA 4YMSA 2A5JA 4QL3A 4M22A 4GMXA 4I99A 4XD7D 4RCYA 5KSPA 4XD7A 4MYCA 2QGZA 4OQNA 3QIAA 3WHLA 2ZRGA 2EQBA 4IVRA 3MAAC 1TADA 2B8TA 1PUIA 3MGCA 1DAKA 4TYQA 3SNHA 2G6BA 4DSUA 3KQHA 4CEHB 2J0VA 3W34A 3ICEA 2NMVA 4I1SA 3MWKA 4IFEA 4B2IA 1TF7A 4YMUA 5JCPA 2G3YA 2VA8A 2ANCA 3WYAA 1S1CA 2O8DB 1L2TA 4M1SA 5FPKA 1HTWA 2GEDA 4TYWA 1M34E 3C41J 5H1YA 4FCTA 1R6BX 1SXJB 3FYHA 3EPKA 2WIAA 2WMNB 3LX5A 5FL7D 1ONBA 5HR5A 4IJMA 3A6PC 4QGGA 4KODA 1QDEA 1FTNA 4ACAA 1XJ0A 5DN6D 2XNDD 5KYKA 4PSVA 3BXZA 3IQXA 1ZC4A 3VU9A 1LNZA 1IN4A 1QHGA 1SXJE 2AXPA 3TW8B 4IKEA 4UNNA 1Z0IA 3DKPA 4I4LA 1J8MF 1Q1EA 1I4LD 1TQDA 4IDPA 4IDHA 1DPFA 1P9WA 3K0AB 2KI5A 2NG1A 4L9WA 2VP9A 4DDWA 5H68A 1F6BA 2HLDD 4LJ7A 3I32A 2ZM5A 3GLIB 1YZKA 1HY3A 3G5UA 1F48A 3K53A 3GLGE 4OHXA 3FPAA 4Q66C 1JR6A 2O8CA 1U94A 1E0JA 5F98A 1FZQA 2NTYC 3H1TA 5EP2A 3IBGA 5HKKA 1R0ZA 1RW4A 1VG8A 2N42A 3CF2A 4TLCA 4FI3C 3FFBA 4A8JB 5LBIA 2ZRJA 5EJEA 1VHTA 3V9PA 2OAQ1 2JJ2D 4IOKA 3LBHA 3UG7A 1UKYA 3NG1A 1WP9A 5BN4A 1XZQA 2P2LA 4PC7A 4PC3A 3MWJA 2QORA 5CLQA 3EPHA 5IT5A 4PO1A 2GEVA 3X1YA 1OH5A 1G5RA 3A37A 3NKVA 5L3QA 3RWOA 4G5SA 1EFRD 3FHTA 4KFRA 1E0KA 2G9NA 4QGAA 1E3MA 2FSFA 3W3AA 2ZR0A 2VBCA 4LI0A 2JLWA 4DEXA 4HB0A 2OCYC 4UXHA 3LDAA 3EZFA 2GVDC 5CK4A 3HPQA 1VPLA 3LV8A 5DISB 4DLXA 1U9IA 1HQYE 1P73A 1XTQA 3WMFA 3TUZC 3ZD7A 2QQEA 1UPTA 3TQFA 4K81B 4PPNA 3D7MA 1GOTA 4FINA 2WSSD 1M6NA 1YHNA 2FX3A 4Q9KA 3V4FA 1D5CA 4WBSA 4EFLA 3CWQA 1E1QA 2O52A 2HJVA 2WWIA 1XDBA 2QAGC 3AVTA 2ZI7A 4V0NA 3E1SA 1JBKA 521PA 4TTQA 1XTSA 2ZE8A 1Z47A 3GJ4A 1KYIA 1KI1A 3OEEA 1UKZA 1JB1A 2IYYA 4WA7A 2H8KA 3FDIA 2G77B 2XB2A 3N5CA 5SZHB 2BCGY 2J0QA 3CR8A 1GILA 2W6JA 4ZDKA 4O3MA 2D62A 2QPOA 2VH5R 3B1XA 1KI9A 1J7KA 4V0MA 1UEIA 2ZI4A 4A2PA 2ZJAA 1GM5A 3LD9A 1YRBA 2H7VA 1JAIA 3EIHA 3T06B 3W9YA 2BDTA 4EJSA 1T0HB 1EFHA 3PG5A 2RGNC 4FXPA 4O2RA 4AKGA 5L3SA 3ETLA 2ZRNA 1XMVA 1T5IA 3K0FB 3T1QA 3EAQA 4TSFA 4Q18A 4ZCMA 3GJXC 4O0MA 3KKNA 2JLYA 2BEJA 4QXAA 2PJRA 2ZYWX 1XPUA 3AH8A 3ZVMA 1IN7A 4G3XA 1VMAA 4LV5B 1H65A 1W1WA 2NPIA 2R62A 4XOIA 3W6PA 3AVYA 4OHYA 2CCJA 1NIJA 3GJ7A 4XSGA 2QM7A 1KK0A 3EG5A 4JYCA 5CB8A 1KO1A 1RFLA 1UKEA 2ZRDA 2ZJOA 1DEKA 3IQWA 4B6FA 4O2LA 2I4IA 2P0EA 1DO2A 221PA 2IYRA 1TUIA 3MRSA 4NBSA 3ZZUA 1AZSC 1BKDR 3I92A 1NVUQ 3CRVA 1Z63A 2IC5A 2J5XA 3IIMA 4MRNA 2GRJA 4KVAA 5JWRA 2ZAOA 4G5QA 5G53C 2GBLC 3B1YA 4X8MA 2ZETA 4CDGA 5LD2B 1X6VA 3P26A 1KNQA 1ZNXA 2WSMA 3Q5EA 2I1VB 1BMFA 1BOFA 3M0EA 3QF4B 4HAVA 4RD4A 4OBEA 5IRCD 3ZLJA 4KBFA 1Q12A 5EE0A 1HT1E 3AUXA 2PT5A 1G3UA 3QKTA 4H1VA 4NZYA 5EE9A 5FTMA 2Z6VA 2DFKB 3CPJB 621PA 2AFHE 1IY2A 2BBSA 3AKEA 2JGNA 1IONA 2CCGA 2OCAA 4OJQA 3UKDA 5AK0A 2ZS8A 1PLLA 5CYPA 4BZXA 1UJ2A 5M04A 1E1QD 4AWXA 4ZIRB 4F7WA 2A3RA 4B44A 3GLFB 1GVNB 4DIDA 1U8AA 3W8NA 4DC9A 1DELA 2ZRLA 2CEAA 3VR2A 1DO0A 1W46A 1LS1A 1QG4A 4GPTA 3K09A 3U3RA 1W0KA 4GMDA 1A2BA 1QVRA 3WBKA 2CL6X 4JBYA 4F92B 3BB3A 2PLFA 3GLFE 1T3SA 1JJVA 5AR1A 2IF2A 3FKQA 1XMJA 3TNFA 5HE9A 2J0SA 5IK2A 3TIFA 3QXSA 1TU4A 1CTQA 1W49A 5KHOC 1ZC3A 3BB1A 5JCZA 1RRCA 4CEIA 1PLJA 3T35A 2QSZA 3IDQA 5DHFA 3OIUA 3SBEA 1RRPA 3BIFA 3L0PA 5IDVA 1QHSA 3Q7QA 4JLMA 3EZ6A 3IIJA 4DCVA 3BB4A 2QNRA 1XXHA 1XEXB 3EZ2A 4DSNA 2VP5A 3QSYA 1HURA 1ZUNB 4N3NA 5L3RA 4TYYA 1DTSA 4FIDA 4LC1A 2ZXUA 3WRXC 1RRGA 5JZVA 2YWHA 5DYGA 3GLIA 2EFEB 1M74A 2WWWA 2F3TA 4C0JA 1R8SA 1G17A 3THYA 2OT3B 1XCMA 2YOGA 4V02A 2ATVA 4W5WA 1II0A 4ZPXA 1CRPA 2EFCB 3LW7A 2HLDA 3VNVA 3AF4A 1ZD8A 3CBQA 2C9CA 1ANKA 1G8PA 5BWMA 1WQ1R 1Z0AA 2ZSFA 1W36D 3REFA 3QKUA 3AEZA 1XEXA 3KKMA 4Z8YA 1OPXA 1VYVA 4I81A 3GP8A 4TL9A 1Q21A 3UATA 4C2TA 2IYLD 4IXNA 1II9A 3IIKA 1KZGB 2GJ9A 3OE7A 3RSLA 4ZKDA 3U2QA 1IOZA 1QHXA 3KB1A 3SZRA 3X1XA 1JQJC 3THXA 4M53A 1IHUA 3I72A 3OESA 4KLZA 1P6XA 1SXJC 2F3RA 2IF0A 1UAAA 1E0AA 3E2IA 2IYXA 1P2TA 1XTKA 3OEHA 4X8OA 2ORVA 3DZDA 5DLQC 4OI0A 1GFIA 4ZCIA 3OIVA 2GVZC 1AIPA 1T5LA 1KMQA 4KAXA 4DDTA 4JLVA 3T1TA 3SQWA 4MQBA 4E07A 5FBVB 2QMOA 2OV2A 4WXRA 3Q85A 3PITA 2RHDA 3LNCA 1QZXA 1U8YA 3KJGA 4LJ6A 3DVLA 1OV4A 5JHHB 3RVBA 2IWRA 2G1JA 2YKGA 1Q1QA 2NQ2C 3A1SA 1CEEA 1XD2B 3QY0A 3QI2A 5J4VA 3IHWA 1ZIOA 2FZ4A 4JJZA 4RSGA 3TE6A 4B3GA 1E2EA 5HPYB 3SYKA 3HR7A 1LS6A 2ZTSA 2JASA 4P4TA 1OE0A 2NO6A 2GA8A 2REOA 1DG3A 1EGAA 1TEVA 3H2YA 3QE0A 4JJKA 4TMKA 4GZLA 3SE0A 3W6OA 5BYKA 3V00A 4CEJA 2HT1A 3L43A 1Z2AA 2V4ZA 5FTNA 4TWZA 2BBWA 1UF9A 1Z6GA 2RGBA 2GTPA 2QMEA 3VMFA 2QT0A 4HLQB 3KQKA 1E69A 2P6NA 1OH6A 5F9FA 4D4JA 2ZRFA 2OHFA 3QNUA 1OH8A 4S2EA 2NO7A 1SHKA 3DZ8A 3GQBA 2HYIC 2JLRA 3HDTA 1NMXA 2BCJQ 5FBRB 3ZZTA 3K9NA 4AC9A 3SHFA 2JLZA 1HV8A 4ASUA 1GG2A 3RDPA 3C14C 3ONWA 2XB4A 4DUGD 3CWZA 1NVXQ 2DBYA 4KFSA 2QAJA 2Z4SA 3GLIE 4A2WA 4DCNA 3P27A 1TMKA 5A4JA 1Z5ZA 4GRAA 2ZI5A 1KGDA 4IVQA 3SJZA 5EZ6B 2EW1A 4LGMA
chains in the Genus database with same CATH superfamily
2VHQA 3ZJUA 1WV0A 2QZPA 3AI3A 4Q1AA 2QE7D 1HRDA 2VK8A 1U1DA 5LR6A 4C29A 1IUOA 4BAZA 3IIIA 1L0BA 2R8RA 3CW9A 3DEIA 4QAJA 4EVSA 2CJWB 4HY3A 4IXDA 4DMHA 1MO4A 2DR3A 2Q41A 1YE3A 1UJBA 2K7FA 3K4PA 3PUKA 4FDVA 4BO3A 1UK7A 3PA6A 4QDZA 3QJGA 2IJGX 3EIQA 1HZZC 1T2AA 3OTHA 2GYYA 1HFKA 1XA0A 3UJPA 4JBIA 3BMCA 4GI1A 3ZHYA 4UBMA 4GBED 3DUFA 2FLWA 3K96A 4AF6A 1GRCA 4MRAA 1EWTA 2H3HA 4GOKA 2XCOA 2XZTA 5DHUA 2PZMA 2A9PA 2B7BA 4UVDA 5EGSA 1IY0A 2GARA 3B3JA 1NC3A 3DYVA 3KHUA 5DX8A 1NNEA 4BXOA 4FFOA 1P0FA 2AZMA 4GYKA 4D5GA 4Z4HA 3U6KA 1P1CA 1KYWA 2QX7A 3JX9A 4DM7A 1V25A 1SRQA 5D7NA 5EKUA 4BNDB 4WN9A 4PX9A 4LWZA 2QXTA 5EVCA 4XSVA 1K75A 2QTTA 5BOVA 4RKFA 1UPXA 5H59A 4Q6BA 1NUHA 5B37A 5HZKA 2P9FA 2JFBA 4U7GA 3GFRA 3G2LA 4ZMBA 3CF0A 4II7A 1HRKA 1XU9A 4EW3A 1TVEA 3U4DA 4IIFA 1U9IC 2ONKA 4O2BB 2EIXA 2WWVD 1H2YA 2WU3A 3NFYA 5EZ5A 3FLAA 3WLQA 3DPUA 3RS7A 1AN0A 4Y9SA 2I3GA 2IUUA 4M46A 3N8KA 5AKEA 4DV4B 1H5NA 3K2BA 5EE3A 5G0VA 2B21A 3ABZA 2VQDA 2F7SA 2I3DA 1OZ0A 2LKDA 3W79A 4D99A 2O19A 1A4IA 5DMXA 4E7OA 4EFDA 3K9BA 5K7SA 4ND7A 3LUKA 4GP7A 2BKLA 2YWBA 4P81A 3P32A 2ZE6A 1IBCA 1A9ZA 2WD9A 4OOFA 4LC0A 3FVQA 1SUSA 4MIYA 2PT9A 1A04A 3HPRA 5AQEA 5HWSA 1O0CA 5D6NA 3ZHTA 1IXSB 4V0RA 1E98A 3DT8A 1A5BB 2C2XA 4GC9A 2F9LA 1XU7A 4B09A 4HNVA 2QE6A 1KAHA 4ME6A 1Q92A 4LZJA 4D0GA 4B3CA 1DU4A 4B31A 3ICWA 5SZKB 3GFPA 2VH1A 1A82A 2ERXA 1J2EA 3E7XA 5TT1A 2FRDC 3F5SA 3RRJA 1Z62A 1N8SA 3V1MA 1XZEA 6AT1A 4TRNA 1TW2A 4JP5A 3KBOA 3WZMA 2PKCA 4KITB 2R4TA 1WUIS 1DDOA 1O96B 1Z4OA 3NOVA 3OX4A 1JAXA 1B0UA 2H48A 1E3JA 1F4PA 1TQ4A 3IHTA 3SD7A 3WK9A 2OD9A 1HL7A 1ZOLA 2EEPA 2R11A 2ASEA 4XCQA 2BFMA 4B7XA 1NATA 3SC2A 2D7DA 1A1SA 2R5WA 4W7IA 1Z6QA 2NYAA 3INRA 3QUQA 3N75A 2UZ4A 1W7AA 2Q3DA 2ZR8A 1P2UA 4A0GA 2YXNA 3LC1O 4E5PA 2XUKA 2NXNA 3U3XA 1V9LA 3DZFA 3GJ3A 4ARBA 3QEMA 4FDTA 2GYWA 3E9YA 2PX5A 2XXAA 2YQ5A 1J9EA 3QLVA 2YHSA 2EYQA 2BELA 1PS8A 2JKYA 2R48A 1JILA 4PY2A 4WESA 3F67A 1ZX1A 5JSUA 3N28A 2WM3A 3I45A 4U02A 4I3HA 3KKEA 4TKLA 4KWCA 1J0BA 3F73A 3BGDA 4WA8A 3VISA 4EMSA 4F9FA 1XJQA 2CJWA 4QBIA 5IABA 3L8FA 5FI0B 4PINA 1X87A 1C7EA 3LBNA 2P30A 3K73O 3LG2A 5ITWA 1PV2A 3JS5A 3ND8A 5FNVF 3E8XA 5KZMB 3DR5A 4D97A 2H52A 4CIYA 1V9CA 1XJCA 2AOTA 3I6QA 3M9XA 2XTMA 3UUFA 1T4CB 4MI6A 3CLSD 3JPWA 3NEJA 3DNMA 4G1UC 1VJCA 3WGGA 2WFMA 1S9DA 3AG5A 2Z1NA 3H4VA 4NK4A 1MC5A 2CNWA 1BMQA 3LNTA 4LHWA 4YV0A 2O8DA 2YNMD 3ZE0B 1NTRA 5JMOA 5ALTA 1B4DA 1G5HA 1SUPA 1R10A 5FA8A 3QSGA 3GGJA 1D03A 3HDQA 4MYSA 4AL4A 2A14A 1NDUA 4HUQB 4DAEA 5CDFE 2WSBA 2BSQA 4RIGA 1G4AE 2A5FA 2ONJA 3R4CA 3O26A 1KXZA 3K9QO 5HGJA 2ILTA 5K45A 3Q3CA 5I7HA 4BN5A 1ACJA 4B5KA 4YMLA 1ETUA 1L8QA 3DLTA 3K4HA 5TRTA 3OICA 2D4HA 4QLOA 1G5FA 1GRNA 1ZFNA 2FR1A 3U0BA 1P45A 4ID9A 4XYEA 3ZD8A 3NHAA 1KPIA 1X7ZA 3C74A 1U02A 1ZI6A 2J6HA 1LTQA 1QIEA 1QP8A 1RQPA 2ZI6A 3PQDA 3Q2KA 1L7PA 1EFLA 1K5GA 1J5PA 1OAKA 1R18A 1RD4A 2BHRA 1N5LA 4P82A 3ZWAA 4AUNA 4F9TA 3ICQB 4OFBA 3LCRA 1CEXA 1P3JA 3UIEA 1Y7LA 3ZI0A 4WCDA 2H5EA 3BGVA 1GA4A 5J2TF 1ND5A 1Q7GA 2HZBA 2AG6A 5FTKA 1AV7A 1KH3A 1SBNE 3GJ0A 3ZUPA 4DDKA 2FOLA 4DR3B 1CK4A 1Y1RA 1BNCA 3HCRA 2A67A 3C4JA 4MAAA 2BLNA 2CL5A 3P9QA 1ES9A 1UK8A 3JY6A 3MIIA 4RHTA 3V5NA 3K9WA 3FJOA 4QOHA 2CE7A 3H2JA 3JR3A 2BDEA 2C92A 3MVEA 1HYQA 1IHYA 3W6ZA 4IAOA 5FWXB 3KVVA 3DBHA 1PHPA 1YS2X 3CKKA 1NFFA 3NU1A 3NOQA 3AJEA 3NB0A 1EXWA 5SYNA 2ZCVA 2ZWIA 1SXQA 4N54A 4ND5A 4I6GA 1Q57A 5A4FS 5JJKA 1EBFA 4EA7A 1QHHB 2FMIA 2QVXX 3WQHA 4BIMA 4HADA 2IIVA 5ILGA 2QX6A 3GHHA 3VR1A 4PGHA 5KTRA 3FVRA 3KKLA 1CS4C 1Z38A 3G5TA 3V4VB 3AY0A 3FMVA 1YE8A 2DKNA 3CVXA 3AP1A 2O0LA 2E6UX 2ZJ5A 3SG0A 5HXAA 1P29A 4J0KA 4Y6LA 3TSOA 5F2EA 2AFIB 1ZM3A 2YY6A 4TS4A 2NVUB 1SOAA 3OLWA 1QCYA 3W5IA 4WJLA 4DE5A 3ABIA 1J2UA 1PL6A 3AI1A 3BE5A 4BEWA 3D4OA 3DONA 3REGA 2IS6A 3T5DA 2MHCA 1YQTA 2QUJA 3WK4A 4B5LA 4WVFA 1M2WA 3IP8A 3ED5A 3S81A 3QUSA 5T7BA 3WYEA 4MA0A 2GYUA 1CDZA 5FFNA 4M36A 5FULA 4B6JA 4O4HB 1YI1A 4NU8X 1FMCA 3EEIA 3QFFA 4WBXC 4GUDA 1RKXA 3ZV5A 1UXKA 2ZAGA 1BFDA 1QR2A 5TMDA 1IL0A 1DJPA 1SKYE 2JLXA 2CVPA 4Q19A 3WRYC 2QMQA 3B1WA 2VF2A 4CLRB 1I7SB 1YBVA 5JROA 2BD0A 2Q3LA 2UAGA 5FDFA 2WJVA 3SPXA 4XEUA 1EVQA 3ZDRA 4DA0A 3U13A 4B45A 2XPCA 3BOSA 4LJ8A 3TOVA 3TUJC 5HX7A 3H1BA 1T5TA 2XOKA 3RRXA 5LMUB 1RCTE 4EPRA 1H6CA 2YWGA 3JQPA 4Y1RB 2G7MC 2COKA 3P7MA 1GL9B 5BP7A 2ZKLA 4D0NA 2MYTA 2DE0X 1GLGA 4LSWA 3W5JA 2VUIB 1ENPA 5G41A 1SBZA 4OXXA 4UMFA 5K0LA 3LXXA 5FB3A 3KAQA 2FR8A 3MFQA 4H17A 4A6PA 3B1VA 3ZYZA 5I4IA 5J23A 1DCTA 1DPGA 3IYLW 5MFPA 4RMIA 1CUFA 4M1MA 1V2HE 4XGRA 3I53A 1HM5A 1RZRA 5F2OA 2ZT8A 1E2NA 1NBIA 3OZXA 4Y2PA 2QD2A 3L8MA 4HGNA 3VO9A 1N3BA 3EMBA 1N2BA 1G6KA 2DHDA 5C7YA 2CFSA 3B5EA 2HSEA 2WIGA 1C0EA 5CFMA 4M7RA 1LSSA 2JGEA 1PR6A 3Q2IA 2K2WA 1J20A 1PNTA 2YOFA 1YNSA 4GE0A 2R60A 1CZHA 2RIRA 5F73A 4OU5A 1TEXA 3UT5A 4FI3F 3VGJA 1OXVA 4C08A 1NNUA 2AIRA 3X1ZA 2EAUA 3AERA 4ZKEA 4M8LA 1RKVA 1HLGA 4ZGGA 2RKBA 1L7DA 4J3NA 2O4CA 5KKAA 4BTEA 4XIJA 1LDBA 3IXLA 4I50B 2X0RA 3DMRA 3C5WP 2WSLA 4OLHA 4RX1A 3SHTA 5IU6A 1E32A 1QM5A 2W71A 1L5VA 2Q46A 4LYFA 3MJCA 4FC6A 3WAJA 2HOQA 3RUEA 5JNWA 5HUQA 1G1MA 1XEWY 1WLYA 4FONA 3L4KA 4Z1MD 2JHFA 4E5KA 1MGOA 4LYYA 4TTRA 3HB7A 5B64A 5ITZB 3TSYA 3IAS6 3QV1A 1H2ZA 1O58A 1CUJA 1RDFA 4RVUA 5ALXA 4DA6A 1JR2A 4OCZA 4EG1A 1KYQA 3HWX1 5K3BA 3PQ4A 2IXAA 1PS9A 1VMKA 4OQXA 2HJRA 5AOAA 1L5QA 3QLEA 4FOLA 2JGFA 3CUEF 4NTZA 2GCOA 4E6PA 2B7LA 3KPUA 4Q5IA 5A3SA 2L18A 2G0NA 4BLRA 3FFXA 4M1KA 3W2GA 4L3VA 1JHZA 1TYZA 2ICAA 4IDNA 4ZEOA 4NYIR 4I4TB 1Z4MA 2CLFB 5IUNC 1IXYA 1YWGO 1KQOA 2XH8A 2JLVA 1Q20A 2R84A 5IJ9A 2CK3D 2C2ZA 3KEGA 3M89A 3L0YA 5LQUA 3C6ZA 2H18A 5IVKA 3DAHA 4TKUA 2OBYA 3OEYA 2F1JA 5FBWB 4OHOA 3ZWXA 1PEDA 3Q7SA 1XNGA 2CJYA 3EVTA 5K3AA 2X2EA 3UOWA 1U0SY 4H7JA 4CKEB 3CURA 2R6CA 1WG8A 1GZDA 2O2EA 2FUNB 4C20A 4HT3B 1HZZA 4RQUA 4UKDA 3RIGA 1F8UA 3LLVA 4I4TA 2ZBRA 2XNKA 4QSMA 2C2KA 4CCSA 4CLOA 2AWNA 4NOLA 5ALIA 3RS2A 2R7KA 2NGRA 1A8QA 5D7BA 3HCEA 4JVMA 1P7WA 3I6ZA 3DM5A 4P9NA 4PSUA 5AOBA 4XD2A 2Y3IA 1KO5A 4FDUA 1JGTA 3A3OA 4YQEA 1WMEA 2AN4A 4RMHA 1GFWA 4OFXA 4G8CA 3VAYA 4CVNA 3ESZA 5JNLA 4N9QA 4E5NA 1N6NA 1KEZA 3I4FA 1N2CA 5CHEA 2AKYA 2Z3VA 2JI9A 4FS3A 1QK5A 4ZT5A 1KEWA 1D9ZA 1TCCA 1PFWA 3C0KA 5U4QA 1T26A 1T0PA 1U11A 3W8RA 1I7LA 3PNVA 1UXJA 1N32B 4G8DA 1GD1O 4GSYA 1FDTA 1K97A 1EX7A 2QQGA 5EJGA 2D5IA 2QZSA 4QNRA 1T8UA 5G1OA 1P80A 2VQ6A 3PR2B 3EAGA 1E3WB 1TM4E 1ZL0A 3FWPA 4D26A 1UBOS 4FCWA 5EWLB 3N59A 2B9EA 1ODKA 3T6KA 3PVZA 1G20E 4A0HA 5MN6A 4GKKB 4FHDA 2DFTA 2OHGA 5GJCA 1HI9A 1DG1G 5HSGA 1VIMA 2RGWA 2PD3A 1Q77A 2Q5EA 3B3GA 1LPMA 1ZSVA 1WCV1 1D8TA 1S01A 1JXQA 4GBJA 1MO5A 2PWBA 3ITEA 3U61B 4GOJA 1Z4LA 1YR6A 3T15A 3WYCA 1ZAKA 3C3CA 3V7WA 2VXYA 5AOVA 1XNQB 3BBLA 4TQUS 1U98A 1IBSA 1GPWB 3CLRC 1QQTA 4TWRA 1M1UA 2O0JA 4RWZA 1FS5A 4NAUA 3RFXA 4QFMA 3R3JA 2Q3FA 5AVUA 3AM1A 5T3UA 3RWBA 2GN9A 4ENSA 2J9GA 1F2UA 8ATCA 3T4XA 4GECA 2A5LA 3RSGA 5KYUA 4D4LA 2RG7A 3WIDA 1Z83A 2E87A 5DW0A 5LA6F 2FRDA 3D0RA 4BU1A 5CCXA 3AV0B 1WXQA 4Q24A 4H6VA 4IJ6A 4X93A 3UJCA 3ND5A 2C7GA 2VPPA 5GOZA 4QQFA 1K5PA 1P75A 3BGIA 1YB7A 3PWZA 3QMMA 1RLUA 1T1IA 5CM8B 5L3QB 4XVRA 3L0OA 4HGRA 2FUEA 3GBSA 1P4JA 3GLTA 2C4TA 1FMFA 5LU9A 2O2GA 3DQZA 5TS2A 5CD1A 3MLBA 1BDHA 4FSXA 3C3YA 1A9XA 1JU4A 4EO7A 1GNSA 2O5CA 1Y7HA 4PIMA 4HNUA 5LDHA 2H4ZA 1TUEA 1U8UA 2PYDA 4G1CA 4OQQA 3KYCB 2IY9A 3U7QA 4A8JA 1QQAA 2VJPA 4Z0TA 2OYCA 1KWKA 4FGUA 3CLTD 4HTFB 4BO2A 4BQIA 2QP3A 1MABA 2B98A 1YZLA 2IP2A 2QR5A 2NUPA 1PR2A 5CW2A 5AKKA 4COOA 4FGWA 4QEKA 4JI1B 4I6JA 2R8OA 3ADBA 2OUIA 1CETA 4G0UA 1YJCA 2HNAA 3OJXA 2ZRMA 1TJPB 1Z0DA 1U3TA 2QG6A 3M6AA 4TMYA 4ZOEA 2ZK7A 1FTWA 1O6FA 2H1IA 3B52X 1R8JA 3D8BA 4YP1A 1BWRA 3ZU4A 5IT0A 1RJ9B 2BEKA 5M5BA 3O84A 1QWOA 3PXBA 2XYGA 1KOLA 3UK1A 3VZPA 3RVKA 1J49A 1Z5NA 3BJEA 1Y37A 4DXDA 3LF2A 1J1UA 4I66A 4I55A 1W0KD 3D6FA 4P80A 3OCJA 4EAQA 3LU1A 1NBOA 2X41A 3VR2D 1MRSA 2NU8A 4YMHA 1XCGB 4QDTA 5SZJA 3SCZA 2V3CC 2ZLBA 1V26A 4HNTA 2WABA 3HVJA 1W8DA 3D1JA 1E3QA 1GL6A 4HN4B 4PSCA 3LLUA 4AN0A 4DLAA 4LGCA 3SZGA 1XUOA 2CNBA 1ZD5A 2ZVQX 4CMGA 4R01A 1NC1A 3U44A 3QXXA 1GTJ1 1GZUA 1YDGA 2FSPA 1P7YA 3B82A 4UU8A 4ARCA 1Z4QA 4IJQA 1EEHA 3NV9A 3PYLA 2CGEA 3GGOA 1G2IA 1X19A 3I64A 4I5DA 3TKAA 2E49A 2KMLA 5CLGA 2QTCA 5GJVC 1WO8A 2C8VA 2XKBA 3BIWA 4LJSA 4WKNA 4BFWA 1UFQA 2IWHA 1BMFD 2Z6UA 2V6FA 5JXHA 3SJUA 3UYKA 2O2CA 4ZRDA 4DSZA 3FDZA 3WFZA 2JATA 4DSAA 3E58A 1CU1A 2QUKA 5TC4A 1VB3A 4M1TA 3IUBA 3AFHA 4DN6A 1LD3A 4YJFB 3BE4A 5SYAA 2O2XA 3HA5A 2W0SA 1Y3FE 1KYZA 1A9PA 1B6SA 2R9VA 4YDHB 2X9QA 4WKOA 4ZVKA 3KOZA 4DKXA 1JXOA 4GM1A 2IEYA 3CTPA 4WFQA 4BO6A 3BULA 3ZPXA 2HMUA 1GFZA 5HFJA 2FJ0A 4JIMA 1MJFA 4JWKA 2GEUA 3THXB 4YMVA 3V2HA 3FROA 3N70A 4EKEA 2ZTUA 3MWLA 3RF6A 4FHGA 4RY2A 1NT2A 2G06A 1MT0A 1ZUHA 5CLHA 4ZTUB 2FUCA 1NQUA 2OECA 2V1XA 3G2OA 2G83A 1TLLA 4KMOA 4B4DA 4OB6A 4BQRA 3GEGA 1TDJA 1V5WA 2XDYA 5DHQA 4I55B 2QP4A 3DOEA 2HQRA 5AW9A 3O4JA 4EEXA 2K6GA 2B1IA 2HTEA 3K1JA 4EFMA 1W48A 3NRJA 4IR7A 3I1FA 1WSDA 1D2NA 4KE6A 4EX6A 1V7CA 2EP5A 4HQFA 3IVCA 1VE3A 3TN7A 1RQRA 2QLBA 3DD5A 1I2MA 1ZSYA 2ILVA 5TPWA 2PX3A 4NCIA 1XJWA 4J0DA 1EFRA 1F38A 2HIAA 4OD0A 3CVUA 2ZAMA 4R2XA 4GPZA 2JDIA 3T41A 1QOPB 1AHHA 1S8FA 1BRTA 4KSBA 3D1VA 3TRHA 3AETA 2W2MA 4X91A 3DGFC 4JJ4A 5K8CA 1H6BA 2V5VA 2OFFA 3F2IA 5DI9A 4QQ8A 5CJ2A 1XRMA 4KFTA 4QBFA 4R40A 1W75A 2GQ0A 3PDWA 1XTJA 2CLLB 4MROA 3VNRA 1J0AA 4A0SA 1YB2A 1MFZA 3LX4A 2PTHA 5DLPA 3DKVA 5CGZA 1N7JA 4DB4A 5KKNB 2FXVA 3WRYA 3V7NA 3RWMB 4YPVA 1ZN7A 2WKWA 1V4VA 2PQ0A 3I3SR 2NAPA 2CUZA 3PGLA 4ARZB 4X7BA 1F9AA 4A0FA 1KK3A 4FWTA 4H3SA 2ODPA 4R5MA 3TW4A 1LPOA 5B55A 1EB8A 4UNSA 4WZBB 4TTJA 3ZW7A 4CEIB 1G8AA 2EDAA 2JKZA 2QROA 4QDOA 1X0VA 1VM6A 1Y8RA 3CNNA 1WHSB 3V3TA 2YIDA 3J81k 4C7OB 4PPFA 5KTMA 3AEUB 2JFYA 3HP1A 2O59A 1K98A 3ROMA 1GSAA 2FR8C 1W73A 2A1UB 4AFNA 1G8GA 2JCGA 4PZ0A 4EF6A 4BLQA 1UUFA 3L8CA 4CM9A 5DN6A 1RHJA 16PKA 2A0WA 1NVVR 2H5LA 4X84A 1F2UB 2Y0CA 2WJGA 1U6IA 4Y1GA 3CLRD 4YTEA 2V7EA 3IT1A 4QEDA 1KSGA 3REQB 1SA0B 5KC8A 2NT3A 3DTYA 2Q3BA 3ISJA 5IC5A 1BMDA 3KXIA 2YXBA 4GW3A 4YLEA 3ZWWA 2FVXA 1H3FA 1FMTA 1O8CA 3OJLA 2IU0A 3SLKA 2C2WA 2XIQA 1EFUA 1SCUA 4R2HA 4RVDA 5CH3A 4XQ0A 5ALWA 3EOZA 4PS0A 4DYVA 3TECE 3PDHA 1PVVA 2R79A 2QN1A 2YMQA 1WJGA 3NC1C 3T54A 3TJZA 2HMYB 4LYAA 4MMXB 5KNDA 5M29A 4TTTS 2HRQA 4DPKA 4HDRB 2XZDA 4P3KA 3PEYA 1IN5A 1ESZA 4UU1A 1T8RA 5C3UA 2XMZA 4MPJA 1RXCA 4X8LA 5AKHA 3RTEA 5CDHA 4P4SA 2QV7A 1A8PA 2JJ2A 2HA5A 4P3OA 4K3VA 2GETA 4MAMA 4OQMA 2FK7A 3RKUA 1JG2A 2W2PA 5MN5A 4L27A 3PEWA 1E7MA 4CF7A 2BFFB 3IRVA 3CN9A 3RJTA 3KSAC 5JANA 2GI4A 3WNBA 2ZBQA 4BB9A 4CQLA 1P39A 1H8ED 2BMVA 1A27A 1P1RA 1PGNA 1V6CA 5ICCA 3I5YA 1F2TB 1OVGA 4XFJA 2HGSA 4AURA 1VYUA 4B80A 4UTXA 4YK7A 4YAIA 1HG0A 3WHIA 2P67A 4Q9DA 4PO8A 1OSNA 2ISSD 2WHXA 4IEFB 4CDNA 4X1KA 4FMDB 3SAJA 2EP8A 4KIUA 4FGKA 2GOYA 3OZCA 4Q37A 4ZHQA 1R4AA 1OC4A 2E0IA 4RPGA 4IF4A 3S5UA 4MUFA 1MO6A 1N5JA 1IB0A 1IZ9A 1SZPA 1VE9A 2DHEA 4Q47A 4D80A 1C3EA 1K9SA 4U7TB 3OZAA 3QPAA 4RPJA 4PYLA 4ZALA 5HF9A 1ZQ1A 1P1JA 1KBOA 2GCPA 1B73A 2ZT7A 5FNZA 5HMLA 4FEAA 5K03A 2FLVA 1QP0A 4V1CI 1L1EA 1PUXA 3QVGA 5ALKA 4BAUA 1Z22A 2VNKA 1P9RA 3D8HA 1UOOA 3W2FA 3ANYB 2WF8A 1MNAA 4P34A 5LJIA 4O08A 4DBLC 5EIOA 2H5IA 3D6MA 2GB4A 3OBBA 4ML3A 3H84A 3TCNA 4BCDA 4Q4CA 7GPBA 5LQCA 2A0UA 1NF8A 1DQSA 1RAAA 3GEPA 5CBPA 2VJKA 1I2DA 2Q45A 3TSWA 1D1SA 4F5YA 3C39A 4G8BA 3R9KA 2MU1A 2GA9A 4TM7A 4LQDA 3PEVA 3KALA 4BASA 2R0QC 3O9VA 1S7CA 3IP1A 1GXSB 3LX8A 1OD6A 2HREA 1F8FA 2QN8A 2D59A 3GQBB 1WZ2A 3SYNA 3OUTA 4E22A 1GEEA 5KJ6A 4Z99A 5LMZA 4IOJA 2HU2A 5AIBA 1BE8A 1U4NA 4JYBA 5IWCA 4LJYA 5CLFA 1KVQA 1O7JA 2CNOA 4H9GA 5IW8A 1WMFA 2H0QA 3T9FA 5A1JA 3TXAA 3X3HA 3W5AA 5ICFA 4KGZA 2QW0X 4WLVA 1TCAA 2P11A 2P9YA 5D5HA 2Q3JA 2DFNA 2VDQB 2E4ZA 1BCSA 3IDZA 1BTOA 1ZGAA 1T29A 3EG9B 4RQTA 4FMBB 4OFWA 4F4FA 5AUOB 3LPLA 3WB0A 4ZEVA 3J80A 1IVNA 2E3JA 1G9XA 3PFHA 3HJNA 1O0SA 3LSTA 4I50A 2V5UA 4LOJA 4AX8A 1CUDA 1QH8B 1XHLA 4RY9A 4URFA 5HF6A 4D9FA 3PTAA 1ZJ6A 3ZEIA 5KJ1A 4A2QA 3R9IA 1A1VA 2D2XA 1X7YA 3AF1A 2R1VB 2WAAA 3DWIA 2IBMA 3EGOA 1P33A 4PTLA 1A9QA 1JIJA 1DC3A 1G16A 1E18A 2WW8A 2X40A 3KV1A 4MWZA 3CRQA 2M6KA 5AI0A 2YWEA 1K6MA 4NYMR 5F7JA 4ZP1A 4ZC1A 5JO9A 2ZITA 5E1OA 3VPSA 3WLNA 5AESA 1Q44A 3U3ZA 3K6RA 2FE1A 3C5CA 1HDZA 1WPXA 1PTJA 1GJRA 3M2TA 1UMKA 5AHRA 3KKKA 1VPWA 2WUFA 1HEYA 1DXYA 1ZA2A 4HZGA 5KVVA 2AEFA 4HZUB 3MUOA 4CM9D 4W5JA 1CJMA 1C4KA 2XDQB 6CHYA 4L75A 2WVGA 4R8VA 2J5QA 1WXDA 3BQMB 3O91A 4U2CA 1NY5A 4HAUA 3H3JA 1E2GA 3R7BA 4NP6A 2DX7A 5TY0A 2QYHA 4MMYB 4BNTA 4F6RB 4EQZA 2FDCA 1M2JA 3OIDA 1GPYA 4W5NA 4RLSA 4DNQA 1IZ0A 2ETXA 1WXHA 2QSJA 5BN4B 3VC1A 1QYCA 2ZPTX 4X85A 3R7LA 3KQNA 1UDXA 1HG1A 2O23A 3Q6NA 1H66A 3BICA 1KYYA 4R6WA 3ZJ4A 4P4LA 4POOA 1NW9B 5JS8A 4P1ZA 1B42A 3VO1A 1HK7A 2YYZA 3CC8A 4L15A 1VOTA 4R0VA 3BXEA 1RAGA 1X1TA 4LDQA 4TOIA 3K35A 4YXWA 5MFZA 5M3BA 4FS8A 5A6SA 4V3CA 4ZQIA 2C97A 4A8JC 4EYEA 1LLQA 1M7HA 3IV6A 4KXWA 3T3NA 1EUQA 1YR9A 2IPAB 5IM4A 4C6SA 3VR3A 4GX0A 5LP6B 4Z9YA 4D3SA 1GUZA 3VV2A 4MKHA 1AQJA 4Y30A 1NR7A 4LGYA 3EODA 2B1GA 4MAFA 5E7IA 2PAAA 3OKFA 5FI5A 2R7AA 2NU6A 3AYXB 4L78A 5K9ZA 2DAPA 3R9XA 1T9ZA 2ZSDA 3DEHA 1SELA 1XROA 3IOCA 3WLTA 2R6DA 3EW7A 4A8TA 1LJUA 3RVSA 1FQOA 5I7SA 3DOFA 1Z0KA 3BRQA 3NHZA 3EIOA 2C96A 1XZNA 2ACEA 2FAXA 5CT5A 5FTWA 5B2FA 1RAIA 4KAJA 1ZMXA 4D8WA 4BQSA 2W6OA 1X1CA 1ZJYA 5FJIA 2PMCA 3RUPA 1M1XB 2Z3ZA 5KYWA 4C78A 3A32A 4PAGA 3AZOA 1K63A 3ZUGA 2IYSA 5E3JA 4KVZA 4LRUA 2KW5A 3HXPA 5L4LA 1WBBA 1EUZA 1IQ0A 4X6UA 1D7AA 2AG5A 4QM6A 5TNXA 4HRAA 1TCBA 4L9SA 5LM3A 4YUAA 2Y93A 1NDQA 1XRRA 2ZIWB 4D4IA 2AR9A 2GFIA 2Q9BA 4K3UA 4HMQA 1WABA 4OOEA 4TV8B 2NZ8A 3HFSA 4QGHA 4X7RA 5BWCA 2C4WA 1RLTA 1RWPA 2GFHA 3H9CA 3LBIA 4FYWA 5T6BA 1KKMA 4LGVA 3VR4A 1X1DA 1XU4A 2WDZA 2WIDA 1WE2A 5B5SA 3RADC 1TW3A 3OJ0A 4MEBA 1G38A 1TTPB 4ENPA 1E9RA 1N3LA 3HFGA 3KKQA 4QUBA 4R2IA 5E1MA 3GAMA 2WWHA 2BM0A 2GM5A 1GG8A 4LXXA 4JKYA 5HFAA 3R8CA 4XASA 1FUIA 1XPOA 4G5HA 4LYJA 1ML4A 2HBYA 1L8LA 2AR0A 4PBRA 5I7AA 3H2SA 1WZUA 3QX9A 3T0IA 3U4GA 1U0LA 1NW6A 2QM8A 3LOUA 4M9QA 3LO5A 4RHCA 3PVSA 5C35A 3ZBQA 1IZZA 5KQRA 2QX9A 4PZUA 1SRRA 1QRAA 3WWCA 4JCCA 3I5XA 1IJBA 1LV8A 4AMZA 2DB3A 3B7GA 2ZQZA 2IVFA 3TUIC 5B57C 1BX0A 2YFQA 4U6QA 2O6HA 4HBZA 2NQ8A 4D0LB 4R69A 4E4YA 3BWCA 5JZSA 4FN4A 5L4NA 1E1LA 3HABA 1G6OA 1F8YA 4XVCA 4NY1A 4UATA 4OHVA 4NRDA 3TLJA 4J1SA 4DLBA 1VZ3A 4EECA 5CT6A 5J2UA 4RPLA 4I9UA 4G6ZA 1TVMA 1VBNA 2B0JA 3BMNB 3RAEC 4KR6A 2PJDA 2WC1A 1GPLA 1VIDA 3M9WA 1ZGGA 4FLFA 4L6CA 3L6UA 3ZCVA 2CJPA 2EKQA 2RC6A 4RFLA 2OLJA 3D5TA 1WHTA 4R9NA 3WXMA 2XTAA 2JD1A 1UWKA 4BE4A 3IP5A 3LP6A 3NT4A 4A6XA 4KNYA 2FRVA 2Q27A 1NBMA 3UEOA 1Z0FA 3OE1A 2BJWA 5CCBA 1SQGA 4TWAA 4LYEA 3S8MA 4KNVA 5FWYA 3DMDA 1YCGA 4L0DA 4N4AA 1GDDA 2JJ8A 2PTGA 4G07A 1CY4A 3E15A 2PH1A 1IIBA 2OFOA 3INTA 4RLHA 4HDSA 4NBUA 1FVXA 4KI0A 5GONA 5JYDA 1P2FA 2HA7A 4QGBA 6REQB 3L79A 4OQ4A 4YCLA 1ECBA 5FORA 4WK6A 2XQGA 1TFUA 2PUGA 2X8AA 3O94A 4RF4A 4EA6A 1CQIA 3EPLA 2QTHA 3P9SA 4C3ZA 1N2OA 2W42A 3KQOA 4PZZA 3OPNA 4F38A 1BO6A 2Z2JA 5ALPA 3RROA 4A8HA 3P9YA 1Z39A 4CR6A 2JF0A 3STHA 5E6SB 4R2JA 3U7EB 2ZYAA 1QVWA 4E4RA 4JEUA 2RKWA 1TX4B 4U9UA 5CCEA 2GZAA 5K8VA 1DG9A 4HQ6A 4C89A 1QCCA 1WMSA 1NVWQ 1P61B 1VKZA 1E1DA 4RESA 2VDJA 4LXUA 4RA9A 1ZZEA 1AK2A 4US0R 2P2SA 3FSEA 2G9VA 5LDGA 3BG5A 3E82A 3VFDA 4DDVA 4JK3A 5I7UA 2EZUA 1Y5LA 4LRQA 2R1TB 5KTNA 1PJ3A 3MQFA 4OBBA 3HCFA 3KLMX 4NHEA 2XCLA 4FWIB 1M3SA 4YUZA 4BGUA 1BRMA 1GAJA 3QFCA 1GGMA 3HY6A 2GO7A 2LIPA 4QU0A 2P0AA 5JQGA 1XALA 3N8NA 4CKBB 1XGKA 3DKRA 1IDN1 4ZVOA 4ZHQF 3X44A 2ZJ4A 2IHBA 2YBEA 3AGPA 2SICE 3OQIA 3AR4A 4IO1A 1QBKC 1Z28A 1FUKA 1U9ZA 4Y2QA 4Y2VA 4EB0A 3Q8XB 2VHCA 2IPNA 2Q1WA 1VJRA 1RQLA 1V8DA 2GF2A 2ZDQA 4E4TA 4EOGA 2CCKA 3PUXA 2AD5A 3Q7QA 3NJ4A 5G0WA 3JSAA 3FWNA 3MJHA 2ZVPX 5FP0A 3PDIB 4JT2A 1N2GA 4H0FA 3JRNA 1K7YA 1YC5A 2O7QA 3OPQA 2PEYA 1O2DA 4DUYB 1JIKA 2OG2A 5HS6A 2I7VA 3K6JA 5A04A 1AA9A 5D3KA 4BMSA 1QHNA 4UPVA 2BGWA 5L7WA 3AP3A 1JU9A 3WMEA 5BYAA 1XHFA 4V38A 3A4LA 1GUFA 4MRMB 3GUUA 1V8ZA 2Q07A 3C8ZA 4RJLA 4UTNA 4FGJA 2QMUA 3PHLA 1FDRA 4I1UA 4MI3A 1SCJA 5DO9A 5G4KA 1X2EA 4AX4A 1OBOA 5HRUA 4DA4A 4O4LB 4JLKA 3VX4A 1XWWA 4HAZA 1AXRA 3IUQA 1W5BA 2OPBA 4EB8A 3VZSA 5CA1A 3U49A 1WSWA 3S70A 4B8ZA 2RGGA 2I29A 4IG4A 2ZW9A 3C3PA 3FIUA 2DPMA 4KYVA 5EESA 3QXCA 1QJCA 1QIIA 4G9BA 4NAHA 3CPEA 2E7ZA 4JB0A 4ODIA 1U7WA 4D44A 4YMWA 3VPXA 2ZOSA 5KOHA 2HI0A 3BFJA 4QYIB 1H2EA 2YIVX 4TWBA 4WNYA 4ER7A 3EUWA 2XZLA 2NP7A 1F12A 2PX6A 1DAMA 3U3KA 1XB2A 2XSZD 3GW8A 4ZT2A 1IEQA 3SS8A 4BP8A 1L7AA 1E1CA 1TLFA 2IZ6A 4Z2AA 5KS2A 3RYFA 4ZC8A 1E1YA 1NG9A 1PR1A 4J91A 2ETVA 4JP8A 4FFSA 2ZQYA 3VC7A 2A9OA 4L8VA 1WDLA 1E4OA 1EG7A 2ZROA 3DP7A 4M1WA 3ZE7A 3GD5A 1P4AA 4HN9A 3QELB 1J0EA 2ZUTA 4E12A 2J8ZA 3C8MA 3OOSA 1EWRA 1NLMA 4B7UA 1W36B 5JATA 1YQ9A 2J0UB 4W9NC 1NWCA 3O3MB 1NXSA 3EZXA 1QS0B 3IMEA 3WKDA 3EXFA 2QTFA 3M3HA 3MEQA 5A9SA 1VRCA 1T9BA 4GVLA 4HI0E 2PUEA 2GEJA 3FSRA 2ZU6A 1M7GA 3PR1A 2FEAA 2Z9DA 3NTOA 2KYRA 2RB5A 3L1UA 4CM3A 4HB4A 1N8TA 1U5BB 2J6BA 3I05A 1QYIA 3LXRA 3ZU3A 4QUHA 3RI3A 4JLWA 4PTZA 1I7QB 1X1RA 3ZHBA 3P5SA 1SBIA 2FQYA 4HC4A 1T1JA 3CB2A 3QU2A 3OIYA 5KPJA 4KKVA 4ASUD 1RHQA 3I83A 1U6JA 3ONVA 1ZISA 1EINA 1SBTA 2F4NA 1VC2A 3LOPA 3LHSA 3Q3JB 2FFHA 2VAPA 3SOPA 1F2TA 4QFCA 3CCFA 4AU1A 1HDCA 3E9EA 4F3NA 1I0ZA 3EGXB 4XDZA 3WTBA 1KE1A 1AO3A 1XYGA 4LV8B 1EP1B 1JQAA 1F0NA 2FW1A 1KAGA 2OG1A 3QLUC 3GL9A 4V3BA 3K2QA 1MH1A 2I87A 2CMKA 2CXPA 4K9OA 2C8JA 2P2DA 1WB5A 1KI6A 1IJFA 3NAZA 4YJFA 1ABBA 5AJUA 4FNOA 4JI6B 1NNLA 5CXXA 3AERB 4QRHA 1HT2E 1MA3A 2R6FA 1SIBE 2Q1SA 1ARZA 4JVSB 3UWMA 4UZFA 1VCNA 3AJAA 3TI7A 1IJEA 1E4VA 4IIBA 4S35A 4YGYA 5JRJA 1QANA 4DCPA 2EGUA 1I24A 4BCCA 1NOIA 3A6DA 3BSSA 4TLMB 4NV3A 3ZTWA 2WPDD 4CMIA 3SX2A 4DQDA 1DB3A 2LZ0A 2YXDA 5AJHA 4GNKA 3WL7A 4BJ3A 1GUBA 2BF7A 2RCYA 1MRNA 4QICA 2GILA 3R8XA 1GGVA 3R77A 5IKPA 5HFNA 3QJ5A 1PTJC