2ZVQX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with pap and alpha-naphthol
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the broad range substrate specificity of a novel mouse cytosolic sulfotransferase--mSULT1D1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 106
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zvqX00
3H84A 2FH5B 3OIYA 1SVMA 4PANA 3FKQA 4G5QA 4LBWA 3SJCA 5J4YA 3PV0A 3SJBA 1DAFA 1OT3A 4LJ9A 1KI8A 1W48A 1GL6A 2ZJAA 3X1WA 1GRQA 3AKDA 4I4LA 2QM8A 1OXTA 1U99A 1G8GA 2F1HA 2WWHA 4HDCA 1UAAA 2CL6X 1NLZA 4JSTA 3L0IB 3WBKA 4DWJA 2CHQA 4WBSA 4Q1FA 4JYBA 1CEEA 4UXIA 4FCVA 2AK3A 4KSBA 1DELA 4HYYA 4AYTA 1SGWA 5JI2E 3K09A 1RRGA 1KSFX 5EP2A 5JJKA 1G8FA 1GOTA 2FV8A 4PAOA 2XEXA 3FFBA 4LK2A 1KNXA 4QFMA 3B1VA 2FE4A 4KJZA 4R9UC 3RRZA 1KKMA 4I1SA 4B35A 2ZROA 2FZ4A 2WWIA 4TLAA 4MUBA 4TQ9A 1IONA 1C9KA 1Z8FA 2WPDD 4TYPA 1T8TA 2A7QA 2FEMA 2IEZA 1E2GA 2GKSA 4DIDA 5FTKA 4URVR 2CCKA 3EPHA 2QAGA 1RJ9B 2ZSAA 3I4LA 4L4UA 4RFVA 1VYTA 3PUVA 4TMVA 4XVUA 1GP2A 4Q03A 2DR3A 4FWIB 2QBYA 1JQLB 4US0R 1X1RA 1KI7A 4A0GA 1H8EA 2KB0A 2P0EA 3BOSA 3KZ1E 4PAMA 5JHHB 5EQTA 3GLFB 1E96A 4JLNA 1Q3HA 2ORVA 3QI2A 2XB4A 1JEDA 3QF4B 2X2FA 3NH9A 1L4YA 1VHTA 3LXXA 4B73A 2PLFA 3CNLA 5LB4A 3RYTC 4HZUA 3PFIA 4A9AA 2H5EA 4XWAA 1GM5A 3IKJA 3OE7A 3KKNA 3Q7PA 3ZVNA 2IYLD 3FMIA 4LSGA 3PUXA 4FW9A 2OAQ1 1E9SA 1UBFA 3Q9LA 1O3YA 2JIZD 4IDHA 2ZVQX 1NN5A 3KXKA 4NYIQ 1A1VA 2V6IA 1U2RA 4LBZA 4ACAA 2WOJA 5B58C 4ZCMA 5FTNA 4A8JB 2C9OA 1QRAA 2QMOA 4LYFA 1E2LA 4U7DA 5H68A 3M1IA 1KAGA 1ZNXA 1CRQA 3C14C 1F48A 2GBLC 4IXMA 4KCGA 2R9VA 1S9HA 4WIAA 1C4OA 2WIBA 2F3RA 4Q7MB 3GLIE 1EXMA 2R6AA 3I32A 4LPSA 2QM7A 2V7QA 2DWOA 3F5FA 3N2IA 3QF7A 4OI4A 4QGAA 4NCKA 2DY1A 4DLYA 1P2UA 1IM2A 3WMGA 2HYIC 3GEEA 1OH8A 1Z6GA 2QGZA 3HDTA 2RGGA 2JLWA 1L2TA 2A5YB 3JVVA 4B2IA 1HT1E 5FBVB 3GJ8A 1G7TA 3G0HA 2CE7A 3T1OA 2PJRA 4RZ3A 1DEKA 4LWZA 2EYQA 2JCSA 5IF9A 4US1R 2ZRMA 3KTAB 1D8TA 1QHGA 2GK7A 3P26A 1OYWA 1HA3A 1TQ4A 2ZETA 5P21A 4D4KA 3LVRE 3TR0A 1ZUHA 4QHYA 4RD3A 4CW7A 4GOJA 3AVPA 2J3EA 5JWOA 1T9HA 2G0NA 3WRYC 2OFXA 1BH2A 3U44A 3OFND 4NTZA 4GZLA 4CEIA 2GAAA 2GCOA 3CR8A 5FR1A 1OXXK 2OCPA 3D7MA 2IHBA 1TX4B 2ZI5A 1ZAKA 3SS8A 5DI3B 4B47A 2QPTA 4AK9A 4TTPA 4DT1B 1GRRA 4URUR 5JHGB 4ASUA 1BYUA 3MWLA 4BEJA 3IPYA 2ZS9A 5K8LA 2IW3A 2DWPA 5DNYB 3T5DA 3MUFA 5CJPA 3GJ7A 1G18A 4ARZB 2V4ZA 2VO1A 1RRPA 1P62B 2P5TB 1ZVQA 1Z2CA 4BUJA 2UZIR 1CJUC 3VKHA 1AS0A 3E5HA 2REXB 3T34A 2YOGA 3KKMA 2QORA 4RCYA 5KNDA 3W5JA 2PT7A 2QMHA 4M22A 1HURA 4Y0AA 1GKYA 3GLIA 4IEIA 5TY0A 3RNLA 1XMSA 3GJ5A 3BAFA 3RVBA 4YQFA 1W0JA 2IHYA 2IWHA 4V0LA 3RABA 1NJGA 3SJZA 4YMUA 2NGRA 1R6BX 5E3HA 3PEUA 4RZXA 1TF7A 2NO9A 1TUEA 3ADBA 2AL7A 3UATA 3GFPA 3LVQE 1W46A 2RKOA 4B2PA 4M53A 2JJ8A 2I1QA 2JLQA 4B3CA 2IYSA 2V6JA 1I4DD 1GTVA 3R9IA 4P4UA 3QENA 5E7IA 3GLGE 2EU8A 2RGEA 5JECA 3NEYA 2ORWA 5E7JA 1ANKA 4NZYA 3ND8A 1DAIA 2NO7A 2ZRFA 2ZIAA 2CVFA 2ZJ5A 1TF5A 4A82A 3CRRA 1US8A 2AFIE 2B8WA 3BFVA 1NJFA 3V00A 2WJJA 4QGGA 1P9RA 2ZVPX 1S96A 2PZEA 1E9BA 1IY0A 2GVDC 2VP2A 1I4TD 5DI3A 4JZKA 3PEWA 2ZR0A 1XCGB 5KSPA 2OLKA 2CLCX 2VBCA 4WZAE 3VQTA 5JCZA 4TL6A 5TXGA 2J5XA 1P73A 5EE0A 2ZE7A 2WZQA 1GRNA 4H1VA 2V9PA 2L0XA 2NTYC 1IQPA 4PC1A 2ZI9A 4EFNA 4HB0A 2ZUBA 3RHFA 5JZVA 4MYTA 1JQJC 5K8UA 3BRWD 1G5PA 2V8OA 2WSSD 1Z0DA 2BHRA 1OHHD 5EE3A 1GILA 4OYHA 4BFZA 4Q5IA 4RSGA 4PPQA 4DIEA 3J81k 1WB9A 5IHPA 4F91B 3LRPA 4C0AC 3RC8A 3TR5A 1GSIA 2V54A 3NHBA 5IDVA 5JBQA 3AVVA 1XB2A 2VF8A 5FL7D 1M7HA 1G64A 1VDZA 4H9GA 4OK5A 4FMBB 2F1IA 2W2TA 3F0TA 1KJWA 1S3GA 2DFNA 3CPEA 2GETA 3LD9A 4JLOA 1E1QD 4DLRA 3QEOA 1AS2A 2EWWA 1NVWQ 2HCBA 2ZUDA 4RD1A 1S8FA 1D9XA 3MWYW 4MGZR 4DLUA 2ODWA 2N1BA 5EUQB 3VR1A 1UKVY 1SXJB 1F3OA 3X1XA 1UBCA 2ZITA 1KDPA 1ZYUA 1JEEA 2WBLC 4URWR 1U90A 2IA5A 3A8TA 2P6UA 4L8GA 3C5CA 3C5HA 3KQHA 2OESA 1OE0A 4IDQA 3AEZA 3VU9B 4DLSA 3CX6A 4CEHB 3KKQA 4C9BA 2ASEA 3K0FA 1P3JA 1NF3A 4BFVA 1UF9A 2IYYA 4R98A 1RYHA 2FSFA 4Q01A 1P75A 4OQMA 1E3MA 1KO5A 3CBQA 2HYDA 4IFEA 4A6XA 1D9ZA 2NOAA 2QU8A 4TT3D 1N5LA 1NBMD 2D74A 4E5UA 4M1TA 4QHSA 4HLCA 1KI3A 1YR9A 2VHUA 4S2EA 5B57C 3KUDA 3QF4A 4ZO4A 1NN1A 2BBWA 1U8ZA 3CRW1 1QHXA 1NG9A 1W49A 2CCGA 5F9HA 3K9NA 1O87A 4QKQA 3L0PA 3H2YA 3SC3A 3GFOA 1K5GA 3B78A 4MRNA 3Q3JB 5DYIA 3PCRB 2QT1A 4GMDA 1FFHA 1II0A 4TMXA 4NKRA 3BH7A 3ZS9A 4LYAA 5FUWA 4Q18A 2JASA 1EFTA 5HPYB 1NP6A 2QAGB 3ECCA 2C03A 1ZM7A 3X1ZA 3K0FB 5IK2D 3QOFA 2Q9AA 1UEJA 4LV5B 5B30A 5BWMA 3IILA 1P60A 2B92A 3QNUA 2OLJA 3LO5A 5KDOA 1V5WA 2R65A 3CWZA 3BS4A 4BZXA 5C18A 3MGCA 1J90A 5AUQA 2VP0A 1ZCBA 4G01B 5HE9A 3UXMA 3OE7D 5EUMA 1DARA 2WOOA 1KSJA 3U3MA 2E9SA 1Q21A 1QG4A 3WNDA 2F43B 2GZHA 3IGFA 3HPQA 1ELOA 3U2QA 5F98A 1GDDA 1NVVR 4ASUD 4KITB 2YVUA 3V4RA 3SYNA 4TYWA 5JRJA 4QBHA 4DCVA 4RY2A 5FOSA 2B21A 1XD8A 1E2FA 1E2JA 5EE5B 2CE2X 2IYQA 5BN3A 4G5SA 2BM1A 4EPTA 2IYZA 1CULC 1KMQA 2NQ2C 2KI5A 4PZYA 5FPHA 1LNZA 3A4LA 1E2NA 1OXVA 4BRWA 1Q57A 3CPJB 1AKYA 1AZTA 2W2XA 3CRVA 4KYUA 4TZ0A 4QRHA 1E94E 3GPLA 3OIVA 2PJZA 2MSDB 3SBEA 2HT6A 3QY0A 3WNBA 4DSNA 1RPZA 5DN6A 3RWMB 1RRCA 4M9ZA 1P61B 4LHXA 2XX3A 4NONA 3B5JA 2IF2A 1NG1A 1GG2A 1VECA 2J0UB 2REOA 3DMDA 1XEWY 3UIEA 2QE7A 3W8NA 4OQLA 2FDCA 4XOIA 3R7WA 4C3ZA 2MSEB 5BN5A 5BQ5A 3ZS8A 5EP4A 2LKDA 5FUYA 2VQSA 4B44A 1DBSA 5J4HA 4GT1A 3LXRA 3I5YA 4EDHA 1MH1A 3ZZUA 1VPLA 4D26A 4N3NA 4OJQA 2AR7A 1WQ1R 3CW2A 1LF0A 1IBRA 1G41A 2YHSA 4RD2A 1TEXA 2GJSA 3D31A 1S1MA 2RGAA 1XEWX 1ZINA 5ELXA 1CR4A 3RSLA 3K9HA 4HLQB 1KI1A 2BBSA 2J59A 4B3DA 3I1FA 2OCAA 1LB1B 2AWOA 3AKYA 3LBNA 4TLDA 4CEHA 4LCBA 3B9PA 2GJ9A 3I3SR 4Q1CA 4ERNA 4WAUA 1OFTA 2XOKA 1MR3F 4UJ5A 1T3HA 3RRYA 4DCSA 4PX9A 4PHFA 2B7CA 4YMWA 2PBRA 3U4QB 2C99A 1P4SA 5EE9A 4EQ6B 4TTRA 4GRAA 1OH5A 2CLSA 4A1FA 4HLUC 2WVJA 3LQRA 3H1TA 4DB4A 5AR1A 5F2EA 1RFLA 3A1UA 5DGXA 3PUWA 2G1KA 4NU0A 3EPKA 1Q1ZA 4JT4A 4Q4HB 4ZPXA 3W8RA 1S3SA 2AKAB 2CJWB 3IIKA 5EXSA 4FD2A 2F9LA 2F9MA 3WYGA 4FMCF 4KFRA 4TL9A 1CIPA 1JXMA 5JEDA 2BIFA 5EXPA 4GFDA 1M6NA 3RDPA 1A5TA 5BXQC 2D7DA 3QG1A 1AZSC 3GCGA 4TYYA 2QTVB 4ZDJA 4TLEA 1T5LA 2E87A 4BLSA 4FWTA 2WJYA 1ONBA 4Q4AB 4EQ6A 3VHLB 4BGDA 1E79D 5G41A 2ZSBA 4LJ5A 3LWNA 5DO9A 1MABB 2BEJA 1EX7A 4C2UA 1OXSC 1P6XA 1JAHA 5DHAA 3FPAA 1G4AE 2O8DA 1HY3A 1AN0A 1W2HA 3T35A 1U0HC 2CJWA 2V1XA 1KJYA 1E9FA 3A1SA 5CLQA 2WKQA 4EPYA 3EX7C 2YC4C 3U3RA 1J8MF 1A7JA 1DAEA 1QHHA 5JS7A 2ZYTX 2VHTA 1NBMA 3KXLA 2W6JD 5JWRA 4EPWA 3THWB 3ETLA 2J0QA 4YDHB 5EZ5A 5GADl 3DPUA 3NKVA 1W7AA 5KO2A 2HXYA 1DTSA 4GDFA 2YWFA 2DCUA 4JYCA 4MH0R 5GJWC 4QGHA 4DKXA 1X8JA 4V0MA 3EARA 2FNAA 3QPWA 3TGPA 3O8CA 3A58B 1M74A 4H1UA 4DLTA 2ZR9A 4PO1A 5HKKA 5EXXA 1OSNA 2RGNC 4ESHA 3B1YA 3K0CC 1XEFA 5D3MA 4RJLA 3IIMA 3RS7A 3DKPA 1COWA 1WF3A 1YHNA 3HPRA 3EZ2A 1E2IA 3MMPA 2GCNA 4DBLC 5AUPB 3RS0A 4UNPA 2WJHA 1I2MA 4DLWA 1QHHB 2ZQ5A 1OHHA 3SOPA 3VX4A 1PJRA 1H8ED 2FFHA 4GP6A 1WE2A 2ZS8A 5TMPA 1YZQA 1Q0UA 3F3YA 3FYHA 4YMVA 3PEVA 3LA6A 5TVKA 1TQDA 5HCNA 721PA 4R2IA 2VTKA 3K70C 2ZYWX 1G3MA 3MWKA 4PSAA 4MGKR 2AD1A 5LD2B 1GIAA 4OI2A 1E1QA 5A4JA 1YRBA 1Y63A 4Q7KA 1HTWA 4LBVA 3BGWA 3IIJA 3VAAA 2ZRLA 2RGXA 3WMFA 4FMDF 5AUNB 5HR5A 4GI7A 3QXSA 5FBLB 1E2PA 4QBIA 2Q0HA 3CH5A 4A6PA 2FF7A 2VP9A 4KFUA 3GLFE 4JKYA 2WWGA 4Q9HA 1CR2A 1VCOA 2WWYA 2W6JA 2FJUA 1WBBA 3QXJA 5FPSA 3AKEA 1G5RA 3KL4A 3IDQA 3EIEA 3RRNA 3ZVRA 5L8VA 2XSZD 2GZDA 2WAXA 1F2TA 2PZGA 1MRNA 3BC1A 1LTQA 2C78A 3VR3A 1GVNB 3IQXA 4PZLA 4P31A 1U9IC 4B74A 1GKUB 2OILA 4QBGB 3SHFA 4ARZA 1RKBA 4G0NA 3LBHA 1OXUA 1XMVA 3WMEA 2CL7X 4IKEA 4AYWA 1NY6A 1EK0A 2AWNA 4QL3A 4L15A 5GJBA 2BDTA 4MGIR 2FU5C 4AKGA 3Q7QA 5FOWA 1X6VA 1KOFA 2VHJA 4W7SA 3L43A 3UK6A 2O52A 2WKPA 1W0KA 5K8IA 1T0HB 3IBYA 2GK6A 1AQYA 4NCNA 4XWOA 4X8HA 5FFMA 2KJQA 4JLDA 1IJFA 2OG2A 2VF7A 3SHWA 1EFUA 4NMMA 4Z54A 4JBXA 1JJ7A 1IHUA 1F2TB 1Z29A 1FP7A 1NKSA 2HDNB 4NBSA 1G17A 3AH8A 2RHMA 1WMSA 4W5HA 2D4HA 2ZRAA 2IK8A 4IDOA 1SHZA 1FTSA 1CJKC 1SVIA 2CHGA 3IEUA 3RAPR 1NSTA 2ZI4A 2JA1A 3MJRA 2J7PD 4GZMA 1M7GA 2IXFA 4ITRC 4OK6A 4AG6A 2BJVA 2ZU6A 4IEEA 3EWAA 3FKSD 4U00A 1KI4A 1XCMA 1BO6A 4FIDA 2XXAA 4MYUA 2BWJA 1ZM3A 2AX4A 1OJLA 2WMOB 3T1QA 1Z63A 3NBYC 2PCJA 3W9YA 3QUSA 3UANA 3VU9A 4Z1MD 1MT0A 2QP4A 3R7WB 2NG1A 1OF1A 4Q00A 1G3IA 3IPXA 3VHXA 3IUYA 2DFTA 4L9SA 4XVRA 5AJVB 4MITA 3KKOA 3GD7A 1K8RA 4IJMA 3SN6A 3TSOA 3TW4A 1A4RA 3AF3A 4D0NA 3AP3A 2VHCA 4HATA 1ZC4A 4Q21A 4BASA 1N0WA 4JMPA 2BEKA 3BXZA 4JLKA 4MRPA 2GRJA 3LX5A 2VL7A 2G88A 3Q8XB 5L3RA 1D5CA 4C4PA 1OIVA 1KZGB 3QIAA 4G5GA 1AM4D 2PMDA 4JLBA 2Z0MA 2O8CB 3A1VA 4QNMA 3PEYA 2XZLA 3THYA 3EZ6A 1NBME 1E2MA 5FOUA 1TTTA 2XB2A 4TSFD 3HU1A 1NNEA 1XD2B 4NPHA 5JWHA 3NDPA 1RJ9A 4BLOA 4OHVA 4LC1A 2IT1A 5TB5A 5CIQA 621PA 3A4NA 1TQ6A 3BH6A 3EZFA 4PPFA 2FPKA 2QZ4A 2FX3A 4XD7D 5BYKA 1TUIA 2OE2A 2BOVA 3BERA 2YC2C 5CK5A 5H70A 1SVLA 4X8LA 5KDLA 3W3ZB 5HZHA 1EWQA 5J5CA 3DO6A 1U8YA 2XTNA 3DMNA 5GJVC 2WIAA 2V3CC 1ZNYA 1ZC3A 1CJVC 1VG0B 3CX7A 1G3RA 1Q1QA 4KHZA 1SXJD 2ZREA 3T61A 3UMFA 5A5GA 4YMTA 5HCIA 3QVVA 3E70C 4PQYA 4PSVA 1OW3B 2GA8A 2XOKD 4HZIA 4LJAA 4PPNA 4HUTA 4K81B 2XTMA 1KYIA 4EPXA 5IRCD 1D2EA 5EJEA 1CBUA 3KFXA 2G6BA 1KK2A 3K0AB 3QPUA 3O8DA 5BW8A 3A6PC 1W4AA 4JL5A 4KV9A 3SBDA 3AUXA 4ZKEA 1Q3TA 1E0KA 3Q5EA 1E2EA 4KBFA 3U4QA 5UKDA 1G1MA 2YZ2A 4PQFA 1W47A 2ZSEA 3R9WA 2WJIA 1EESA 2GJKA 1BMFA 3ZVMA 2ZRIA 1DO2A 3JZAA 3T1VA 1D6JA 1X86B 2O8EB 1XTSA 4DSUA 5JFGA 2DWQA 2REBA 1E0SA 5CLLA 3DHWC 1YE8A 1CU1A 1E4YA 5G3YA 3TSWA 4B32A 5DN6D 4BRUA 2VIIA 1N6RA 3WNCA 2ZI7A 4A2PA 1E1RA 1L7VC 1P9WA 1SXJC 1TMKA 4FCWA 4CZ2A 1BS1A 2O0JA 3UMSA 4Q1EA 4NYJR 4C30A 1F5NA 1Q44A 3C15C 3TSZA 2Z4SA 1E9AA 2IC5A 1CS4C 1CP2A 1EFHA 1UEIA 5JS8A 4A92A 2VP5A 3VNUA 3C8UA 4IVRA 2W0SA 1PLJA 4MQBA 3BH0A 4MGYR 2I4IA 3AF1A 3FMFA 4UNNA 2HLDD 2W6ID 3KKPA 5C46F 1M8PA 2F1JA 1SKYB 1Z0AA 1EX6A 1TQ2A 3CLVA 4OL0A 1G7CA 5CM8B 1XZPA 2QI9C 3RSOA 4LBYA 3QBTA 4F92B 3RS5A 2HXSA 3PITA 4R2HA 3TQFA 4GL2A 1KI6A 1YU9A 1BIFA 3G82C 5H1YA 1UKYA 2XAUA 1UKEA 5LPNA 2QROA 1Z07A 2ZJZA 4CEJA 1YR7A 4UKDA 1XTRA 4W5JA 1NLYA 2RGBA 4Q19A 4POAA 1CR1A 2WMNB 1W5TA 2JDIA 3BB4A 1JI0A 2D62A 4Q7JB 2HF9A 1Z0FA 1NMYA 4QBFA 3VR6A 3NIBA 1IXRC 2DHRA 2GESA 5CDFE 2DB3A 3AVQA 2XJ4A 4M21A 1CJMA 3DL0A 3LX8A 4D80A 4LX0A 3CRQA 5HKKD 3V4FA 3QE0A 1XJQA 3OHMA 1TNDA 2IYWA 1D2MA 2HT1A 1KKLA 2OT3B 2QA5A 4B33A 1KDRA 2AHOA 3GLHE 4A15A 1GFIA 1VG9B 4A2WA 3AGPA 3VR2A 1ZUIA 2ZM5A 4TMWA 4P4SB 5GJCA 1FNMA 3NEJA 4JBWA 3E2IA 3CZPA 2GZAA 4ACBA 1KHTA 1G7RA 2QNRA 4Q4AA 4LUCA 5EP3A 3U3JA 1NRJB 3FGNA 3HJNA 5KNBA 4PFSA 4RFSB 2WWXA 4PO9A 3TAHA 1YR8A 1KO1A 2KBEA 4AI6A 3P20A 5B2ZA 2OBMA 4YMSA 3KX2A 5KPJA 1S4QA 4J0QA 1Z28A 2YWHA 3DDCA 4PR0A 4L9WA 1I2DA 1AGPA 4M8NE 2XXAB 4KVAA 1JR3D 3PUZA 3VKWA 1HQYE 4HAZA 1OFUX 4M9SA 4FI3C 3CB4A 3EWSA 1NIJA 2GDJA 3FTQA 2FFAA 2G77B 5JMTA 1XF9A 2IYUA 2ZJYA 1XCPA 4LJ4A 2H1LA 1CJTC 1GUAA 1G16A 3S1AA 4LI0A 3LAWA 5CYOA 3K9GA 3D6TB 4GBMA 1UJ2A 1R8SA 4DDTA 2X1VA 4LJ7A 2C9YA 4BFUA 2GILA 1RYFA 2CHVA 3KDSE 1AK2A 4B3BA 4ESVA 3BFXA 5FUVA 5JRZA 4JLAA 2C77A 5TDHA 3GJ3A 2BMFA 3MRSA 2C04A 2O8DB 2RH5A 4CT5A 1SKYE 5DH9A 1F60A 3CRMA 4RKEA 4WZBE 1N6KA 3EC1A 4TTQA 3THOA 4JLMA 1FX0B 3EZ9A 4M1SA 1KMHA 2Z83A 3OAAD 3ZYCA 3W3AA 4N0DA 1RW4A 1FW6A 1VKJA 4DUGA 5JSZA 3PXGA 1MO4A 3TE6A 2VA8A 2P6NA 3FDIA 3K53A 1L4UA 2P2LA 5F3WB 1DS6A 4NYJQ 4CIDA 5SZIA 1KJZA 2MMGA 5SZKB 3T5GA 4F4IA 3TBKA 3U7FB 3AV0B 3KB1A 4HAXA 4P3YA 3QKSA 4LJ6A 4QOSA 5AJZA 1IAQA 3FVQA 3AVYA 1N0UA 4DDUA 3EIHA 4M1OA 1Z2AA 5FOTA 2FSHA 3AGQA 4B43A 2CMKA 4GOKA 4XTRA 5L3VA 2ZRCA 1VCIA 2CVHA 4O2LA 1T3LA 4I1OA 1RRFA 3ZH9B 4DC9A 3RRMA 2HCJB 3QKTA 4V0NA 6Q21A 2KWIA 4DLXA 2E1RA 4HAUA 4U02A 2LWIA 4Q1AA 4W5WA 1T91A 2LCFA 1LY1A 1T3SA 3U60B 3NC1C 3G5UA 4QJ5A 1MV5A 1ZU5A 2PX3A 3CO5A 4Q9IA 5C2JB 1EWRA 2V7QD 4NE2A 1GKIA 3BK7A 3LY5A 4Y0VA 3OZXA 1SQ5A 1RVDA 2JLSA 4JLPA 3R8CA 3P4YA 3KJEA 1KI9A 3B2EA 3HP1A 5G53C 2Z5FA 2XSZA 2X77A 4Q4JA 5CB8A 2QTFA 3HR8A 2VHQA 3OIWA 4MYCA 4A0FA 3THYB 2EQBA 3NTUA 821PA 2GXUA 2ZE5A 2VEDA 4LPKA 2JLRA 2FFBA 2WM9B 2JATA 2CDNA 5KU1A 3D8BA 5DYGA 2LKCA 3RS2A 4K46A 3DEFA 1UFQA 4OKSA 2O8BA 5FI0B 1AKEA 3A37A 4P4SA 2GVZC 3SYKA 1N25A 1LS6A 1ZIPA 2OCYC 2JAQA 1YKSA 1SZPA 2BJWA 3W90A 2VLIA 3MSXA 4I99A 2GNOA 4WXRA 1H65A 2YINC 1VCMA 1P72A 3SQWA 4LHWA 1UPTA 2H18A 1CLUA 1HE1C 1FZQA 2FEOA 1II8B 5KYKA 4EIWA 2BC9A 1W5SA 4LZZA 3ASYA 3TH5A 1EFRA 5JJLA 1HQCA 3QKUA 4F4CA 1JALA 2ZR7A 5CM9C 4ZDKA 1DVRA 2ANCA 4AD8A 1NY5A 1DG3A 2R6CA 4CVNA 4D6PA 1YZLA 2PMKA 3PIRA 2OBLA 2WJVA 1XXHA 1IN4A 2JDID 1NI3A 2NO6A 2QQ0A 2FPLA 1BOFA 2GBLA 2BBOA 1N6IA 3TW8B 4HB4A 2CK3A 3Q85A 3KQUA 2IS1A 2DFLA 3DOFA 2BMDA 1W36B 1G8YA 1N5KA 3EZ7A 2VH5R 2B7BA 1T5IA 3VR4A 4DJTA 3B13B 4QM7A 4LYJA 4QC2A 1E2HA 4KYIB 4XVQA 4UXJA 4MRSA 3NBXX 1N6PA 2GJ8A 4CDGA 1AJEA 2PX0A 4QXAA 4MRVA 4KSCA 3EG5A 2FSIA 4WZ6A 1B23P 1KTVA 3PENA 2NMVA 2F3TA 4Q4LA 2WTUA 1VMAA 2YOFA 1SULA 3NWJA 4TN1A 4TLBA 4NYMQ 1U0JA 2BM0A 2WAYA 5JJIA 2IUTA 3ZZ0A 4NCHA 3UKDA 2R6FA 4R71A 3K70B 3MLEA 3U7HB 2P6RA 2WPDA 4F4JA 3OEED 4MKFA 1NVVQ 5DIFA 4IOLA 1NKTA 1LFDB 3CUEF 4GOXA 3T15A 2IBMA 4RZUA 1DG1G 4C0LA 1ZD9A 1XEXB 2QG6A 1W4RA 1CF4A 2GEVA 1Z6AA 3M6AA 4MYHA 2QAGC 4PZZA 1QZXA 3ZD6A 4IOMA 2DBYA 4DCNA 4IDNA 3ADKA 2OV2A 3SYLA 4IRUB 1QDEA 5L3SB 4YONB 2G0TA 2P3SA 4FCTA 5JLJA 3ICQB 4TWZA 1OB5A 3VNVA 1QHNA 1VTKA 3DKVA 3FHTA 4TMTA 1FMJA 4Q9KA 4IXNA 1NLFA 3AP2A 3LFUA 4NCIA 1XRJA 1YRAA 4KU4A 1XTQA 4CEJB 3W6OA 4MA4A 1N6LA 1R2QA 4LHZA 1M2OB 3K09C 2BBTA 121PA 4ZV4A 1NN3A 2F1RA 1S1CA 4HAVA 1ESMA 1II9A 1PUIA 4HDOB 4DLZA 3EPLA 4HB3A 1JAIA 1WRBA 2FFQA 2F55A 1DAMA 1XEXA 4LHYA 4QHTA 3SE0A 4C0SA 4BEBA 2IS2A 2F43A 2J0UA 5FL7A 2QTHA 4Q4HA 3WP0A 1E2QA 4DUGD 1AQUA 3O8BA 4A4DA 1UADA 1OPXA 4M9QA 1ZU4A 1HUQA 3NVAA 5SZJA 1D2NA 2QUZA 3WXMA 1F2UA 3K0CA 2XZOA 3AF2A 3PVSA 5BYJA 1G19A 4OHYA 4XD7A 5E7MA 4DSTA 4C0HA 3K0SA 3EC2A 2GXAA 4PTLA 5CIWA 1XTIA 1E9DA 3OEEA 1E98A 4TSFA 3O47A 5HTKA 5JCPA 3CH4B 3GLGB 2J7PA 5FTMA 1DOAA 4WA7A 4JVLA 2J9RA 2FWRA 3FMPB 2NPIA 4QGFA 1VCNA 3VFDA 4YDSA 5JI3E 3F8TA 3GEIA 4TMKA 5J4KA 1U0LA 4Q4JB 4XWKA 1Q1BA 2H57A 2ZE6A 4DB2A 1HH4A 2C95A 1XTJA 2TMKA 2IEYA 4XSHA 1GL7A 3AVUA 2R44A 1E4VA 4JLJA 2PT5A 2NZJA 2SHKA 3KJHA 2Q3FA 1OB2A 4G1UC 3SJAA 1WBDA 3PQCA 3Q5DA 1N0VC 2FSGA 4WOPA 3AB3A 1YR6A 3D3QA 3OFNA 2RB4A 1AA9A 1H8HA 5CJ2A 5HE8A 3WHLA 3W34A 5KSOA 1ZP6A 5A0FA 1OIWA 3W5IA 4QM6A 2RCNA 3QKRB 5IT5A 2QPAA 1N6NA 3L0OA 2NZ8A 1VYVA 1JNYA 3UMRA 2EVWX 3PR1A 2GTPA 4TZ6A 1TADA 3GLHA 3QG5A 3RWOA 2ATXA 4K8OA 4YXWD 1UDWA 3GEHA 2ZUCA 4EPRA 4PC6A 1R0XA 4KO8A 3GJ6A 4XJXA 4MKIA 4FMDB 1B0UA 4PPGA 3U6KA 4XIGS 2D7CA 1KO4A 1XDBA 2Y8EA 1IOZA 1G5TA 2D06A 2R2AA 3IO3A 3TUJC 1NMXA 1BMFD 2IYVA 2ZXUA 2C9CA 3L2OB 1DAGA 1QG2A 4BPBA 4ZI2A 1JXOA 1MOZA 1W4BA 2PH1A 1XXHB 3CNNA 4UNQA 3U7EB 3KQLA 3RC3A 1E9RA 4TMZA 4WVFA 4Z8YA 1P2SA 3SFVA 3Q72A 4B2LA 4S35A 3MAAC 3MCAA 2HJGA 4HB2A 3OEHA 5KNCA 1JR3E 3WRXC 5LBIA 2ECKA 3ZD7A 4PO8A 3MD0A 2FZLA 4LGMA 2RMKA 5G40A 1W2GA 2FOLA 1IY1A 1K5DA 2YNMA 2FN4A 3LLMA 2PEZA 3M4YA 5D3MB 2IUSA 4PHTA 4UNRA 4C2TA 4B71A 2JEOA 2P65A 1EFCA 4Q47A 5DI9A 2B6HA 5CK4A 2QRNA 4PAQA 1Z83A 1Q22A 4JVNA 4OJKA 3REFA 1ZBDA 1GZSA 3RLFA 2ZRBA 1R10A 3U6BA 1YQTA 4G5RA 4B48A 1PLLA 1JECA 2ZE8A 2IXGA 2AKYA 4B3GA 2OBNA 4O2RA 4YXWA 4HI0E 2Q6TA 4BFTA 1HYQA 1CRPA 1W44A 3GLFA 4FMCB 4B6EA 2WWWA 3IBGA 4PQRA 2JLVA 2A3RA 4NP6A 4X8MA 4B3XA 4BFWA 1KAOA 4JL6A 3R20A 1EG7A 3SDZA 1NL3A 4BFSA 4ZDWA 4OHZA 3ADDA 3R9XA 2A30A 2IL1A 2QT0A 4RD6A 4C0BA 4QJ3A 2X2EA 3UG6A 1KIMA 1ODFA 4QJ4A 1CTQA 4B76A 4GSYA 1XMJA 2H16A 2ZRJA 1Z0KA 2ZJ2A 3AUYA 4P32A 3P4XA 5EZ6B 3WP1B 2OM2A 5KHOC 4V0KA 2J41A 4AKEA 4EFMA 1F2UB 2UKDA 4D25A 2AXNA 4HAYA 3FOZA 2WSSA 5C4GB 1E99A 3DVLA 1YZUA 1KO7A 4GP7A 3AVTA 3I61A 5DE3A 4AG5A 1J70A 1ZNZA 3T12A 2J87A 3BJIC 3U7GA 4MDFA 3T1TA 3BFKA 2AK2A 2OCBA 3GJ0A 2ZTSA 4F93B 3ZGXA 4M1WA 4I1UA 3FFAA 3MG9A 4KLZA 1ZUNB 3FKSA 3LW7A 3CIOA 1LVGA 1Z0JA 2P5SA 2EFGA 1QVRA 1A2BA 4V0ME 1C1YA 1Z5ZA 1EFRD 2AN9A 4Z8XA 3L8ZA 5J47A 1U8AA 1GNQA 3AVOA 1ZD8A 2ZSDA 4DSOA 1OH7A 2GHIA 3HU2A 3IQWA 2IUUA 4BECA 3NBFA 2ZPTX 3DM5A 4URZR 1ZM4A 2G1JA 2ZYVX 4HLDA 1CKEA 5FR2A 1TU3A 2X8AA 4NHOA 5J4VA 4I81A 4IOKA 3JVUA 1U98A 1WDTA 5CITA 2VSOA 421PA 4PC2A 5LB2A 4A8JC 1BYIA 4JLVA 1NMZA 3MWJA 5J40A 1M34E 1L8QA 3I5XA 3OIUA 3GLHB 4ZI3A 3VKGA 2XTZA 1GL9B 1MO3A 3U44B 1BKDR 3QBVA 4PHGA 3FB4A 2QMUA 3FE2A 1WA5A 3BE4A 2I3BA 221PA 3GMTA 4P4TA 4OBEA 3ZZTA 4C0JA 2JLZA 5KSZA 1ZD1A 3L0SA 1FX0A 2YYZA 2AXPA 5ANRB 3AKCA 4Q7LA 3HU3A 1S9DA 4KXFB 4OI0A 1UDXA 3GJXC 3TAUA 4BLQA 1PV4A 4P0TA 1Z6XA 3EASA 3KTAA 2O8FA 3GQBA 1W4CA 4RD0A 1OH6A 3KFVA 2IXEA 2Q9BA 2R6GA 3NXSA 1JPJA 1G7SA 1XTKA 2W00A 3EW9A 4KAXA 3CNOA 5AK0A 1JB1A 3TMKA 1U81A 3TNFA 2RGDA 1X8KA 1FUUA 2JLYA 3R8FA 4F38A 1T4GA 1Z47A 3L82B 1SXJA 3EXAA 3LBIA 2OFOA 4BQSA 5KPDA 5KOYA 5E95A 1CXZA 2QN6A 3GLIB 1G3QA 1ZNWA 2C98A 4LOAA 2J1LA 5L3QB 2X19A 3LV8A 4AY2A 2F7SA 1PZNA 4TQUS 3GP8A 2JJ2A 5JEEA 2ZS7A 4DCUA 2QL6A 2O8BB 2DFKB 5FPTA 1QF9A 3S1AB 1XNJA 2Z6VA 1N2CE 4BZPA 3AVWA 3W6PA 2JLUA 1AS3A 2C8VA 4O25A 2ZJBA 2I1VB 3EA5A 4BZQA 1ZM9A 4N1AA 1TPZA 4TYQA 3AF4A 4D4LA 2OAP1 1QBKC 1FP6A 2OXRA 3I92A 1DPFA 4D4MA 1KY3A 4CT4B 2XJ9A 4Q02A 1DO0A 2ODEA 2D2FA 2YWEA 2ZRKA 2IWRA 1PVOA 4FN5A 3IHWA 4LRWA 1GNRA 1E69A 2WKRA 4LYHA 2ZJ8A 1Z6YA 5FOVA 5FH9A 3SQXA 2Z4RA 3MJHA 3TLXA 2HEIA 1US8B 3QXCA 2BKUA 3VMFA 2NO1A 2EWVA 4JJZA 3KB2A 2VYFA 2VSXA 3T06B 4FXPA 1KI2A 3C41J 4OQNA 1GITA 2N46A 4UQOA 1COWD 1R4AA 2ZRDA 2CCJA 2J0SA 3MFYA 1AGRA 3UWKA 3VR5A 5AJWA 1P2TA 4JBYA 1VYUA 1PLKA 2JJ1A 3WBJA 1DADA 5GVRA 1R5NA 2OXCA 1KNQA 1XU4A 3SR0A 5FI1B 4BLTA 2YWGA 1LS1A 2Q9CA 2HUPA 4IDPA 3U61B 2EFDB 3NH6A 4LHVA 1Y3AA 2Q21A 3IHLA 3ZIAA 4DEYA 2FA9A 2ANBA 2GCOB 4QNRA 3U5ZB 2HV8A 4B34A 1HV8A 1DAHA 1MKYA 3A1TA 3B1ZA 4P33A 4A2QA 1DE0A 3B85A 2AD5A 4LJ8A 5DSZA 4OHWA 1G3UA 3KQNA 1XX6A 3CKLA 3B1XA 3TVDA 4LDJA 2GF9A 2W58A 4DRZA 2EFCB 4BFYA 1S0UA 1ZIOA 2WV9A 4AKIA 3DM9B 4UXHA 3SZRA 4RCZA 3ZVLA 5K8TA 1XPUA 4LV8B 4BFXA 2BMEA 4OQXA 2CNWA 4W9MC 2EYUA 3P27A 4AYXA 2AFHE 1UM8A 2A5JA 3X2SA 3CF0A 2W2VA 3BIFA 4IFBA 4JL8A 4N0EA 2P67A 2WJGA 3QXHA 4DZZA 4EPVA 2IS6A 1KO8A 2JGNA 2KE5A 3N5CA 4Q48A 5FTLA 2ZI3A 5TV2A 2Q3HA 3DZDA 3A1WA 4D0LB 2J46A 2QPOA 3QVUA 1YVDA 2DPXA 1P9NA 1E6CA 4EKDA 1FQKA 4JJKA 1T8UA 1X8LA 2W83A 5DHFA 1N5IA 3TRFA 2XGJA 4US2R 2BKEA 5IK2A 2GJAA 4KFSA 2B8TA 3CF6R 3BB1A 2G9NA 2A2ZA 2HF8A 3K9LA 3UPUA 2V1UA 2QBYB 1JR6A 2QP9X 3I8XA 5C4MA 3LH5A 2RAPA 4ON9A 4BE7B 1T6NA 2ERXA 2Z43A 2IYXA 2PCLA 2J45A 3I73A 5EE1A 3WYFA 4MRRA 1NVUQ 3GFTA 1W1WA 1ZJ6A 2R6DA 2O0HA 2VP4A 1FMLA 3U3OA 5CB6A 1J7KA 1II8A 2IF0A 1FPMA 1DAKA 2WICA 2HLDA 2W6IA 3A4MA 4R7ZA 3TQCA 2OUKA 3TUIC 5M04A 3FHOA 1YZGA 3LW8A 5AJYA 2YV5A 4PXAA 2OO7A 4CEIB 2Q3MA 3B9QA 1XZQA 1QHYA 1WXQA 2O0KA 5G3ZA 4LY6A 4BLRA 2OHFA 3ZQ6A 4Q1BA 2NPFA 3U3KA 2JJ2D 4KBGA 4CYMA 2O8CA 5L3SA 1TL7C 1Z6TA 2UZ3A 4II7A 4M4SA 3TJZA 2ZRPA 4D81A 1OIXA 5FTJA 1KZ7B 1U9IA 1SVOA 521PA 2CNWD 1UBEA 1W36C 2YKGA 4ILEA 1QHIA 1U94A 3LLUA 1CR0A 2A78A 4LV6A 4Q9JA 4MDEA 1E2DA 2EW1A 1SXJE 2GCPA 3SI7A 2ZI6A 1KSGA 2O8EA 3ONWA 1IY2A 2C2HA 1HT2E 2EFHB 4DHEA 3CX8A 1IN7A 4U5XA 1G21E 3ZDQA 4EJSB 1GWNA 3QXXA 2OZEA 3VTKA 2IX3A 5KTYA 4JVSB 4CRWB 1G291 4B75A 4WXPA 4IHQA 5FPKA 1ZM2A 5SZHB 3DZ8A 3HYTA 4A0RA 2ZRHA 4PC3A 1W0JD 3HYRA 3KJIA 1KDOA 2C5LA 1KY2A 1R8QA 1EGAA 1P2VA 5CYPA 3ICEA 4NYMR 4HUQB 4DDWA 4NL4H 1Z06A 3P1JA 2KBFA 1YZTA 1SVWA 1IXSB 3GLGA 1SVKA 2QMEA 3FMOB 3KJGA 4RKFA 1XPRA 2XNDD 2GAOA 3ZIAD 4GNKA 4G5OA 4CF7A 1AIPA 3WYAA 3GJ4A 2QP3A 3H0KA 3TK1A 4XSGA 3AQ4A 1NIPA 2FGKA 1XBTA 1G8HA 3IEVA 1E32A 2XITA 3X1DA 2BVNA 2RGNA 3K1JA 5JSZB 2J0VA 3N2EA 2NO0A 5D3QA 3RS4A 5EXTA 1N5JA 3C7KA 1VG1A 3B82A 3AM1A 2ODBA 3BWDD 1M1YE 3QSYA 2CBZA 3K8YA 4JSYA 4M1YA 2PLRA 1R0YA 1G6OA 4I1VA 4JIMA 2WWFA 4M9XA 3AVXA 1E1RD 3O8RA 3HR7A 1Z3IX 4KVGA 1N3BA 2VSFA 4EAQA 4UJ3A 1E2KA 1IN8A 3H86A 3NDBB 4TLCA 1H8HD 4E03A 3BD9A 2VRWA 2RGCA 4GMXA 4C7OA 2FMXA 3VX3A 1LF5A 1S2MA 3A36A 3FHCB 1W36D 2PZFA 2H92A 3NHAA 5AUOB 2F6RA 3K0AA 3OESA 3RS3A 1MO6A 4IW3B 4D2IA 1R5OA 2J7KA 4D0GA 3TUZC 1SHKA 1FOEB 3OEHD 1VIYA 4HDQB 2XNDA 3THXB 1ZW6A 2A5FA 2YOHA 5KSYA 2ZRNA 5C1BA 8OHMA 1E9EA 4HUQA 5FBWB 4JS0A 1KK3A 2QE7D 1RZ3A 2R8RA 4RVCA 4D4JA 1Q20A 1ZCAA 2IS4A 4MKHA 2FPMA 2H17A 2QEQA 5DISB 4M0LA 4NH0A 1F6BA 1N6OA 4TL8A 2PL3A 4A36A 4G3XA 3HWSA 1VHLA 1R5BA 2QGNA 3IO5A 4E09A 3K70D 4QG7A 4KI0A 3LDAA 3QQ5A 2CK3D 1UBGA 1JPNA 2DYKA 1Q1EA 1OFHA 2N42A 1Q12A 1KMHB 3P32A 1OKKD 2GXQA 3LQQA 1G9XA 3NBZC 4M2LA 1XFAA 1PUJA 3I72A 1XJCA 4HLUA 4KFTA 2ZRGA 4A8JA 2A5DA 1VIAA 3REGA 2MSCB 4LJYA 5TARA 1KDTA 1YZNA 2JIZA 3V9PA 4O3MA 4L16A 1OFIA 5FUXA 2BCGY 3BBPA 1G4UR 1UKZA 2ATVA 5E4FA 2QQEA 1Z22A 3AP1A 2XNSA 3CM0A 2OFWA 4HSEA 2BV3A 2ODNA 2D3WA 4DCTA 4TYNA 4TQAA 4B3FX 1SVSA 4Q66C 2ZSFA 5FPYA 1MRSA 4AIIA 5AWFC 1QVAA 1FNNA 3EPJA 1N6HA 2CLDX 1IN5A 1T0JB 1JJVA 2EFEB 3EIQA 3TKLA 4M1KA 3X1YA 4BLPA 3PJRA 4DDVA 2IYTA 2QAJA 3AF0A 2QSZA 5FOXA 1TU4A 4IOJA 4PHHA 3W6NA 4ZIRA 1NN0A 1TAGA 2IYRA 5EP1A 1IJEA 2H7VA 3NC0C 2H8KA 2WSMA 1KK1A 2O5VA 1RIFA 2XZPA 3CWQA 4Z51A 4Q1DA 3EA0A 1ZRHA 1R0ZA 4KODA 4NYIR 5HZKA 1NSFA 4IVQA 3UWOA 4Z1MA 4GPTA 4AURA 2MMCA 4EJSA 2NIPA 4DXAA 4TT3A 1MO5A 3ASZA 4YC7A 3OF5A 5H8WA 3EAQA 4ABYA 2PEYA 1A2KC 1E79A 1A82A 2FGJA 1XD2A 2CEAA 2CL0X 1OKKA 3M0EA 3NG1A 3QEJA 2ZEJA 3I8SA 4RD4A 4YLGA 4DEXA 3CZQA 1JR3A 4E22A 3CF2A 2C96A 2G3YA 2YJTD 3N70A 3SU8A 1WP9A 2A5GA 2W0MA 3B60A 1R0WA 2ZANA 4X8OA 2D2EA 4C0KA 1E0JA 1FQJA 1V43A 2FG5A 1Z0IA 2QENA 3ADCA 3CPHA 3TIFA 4ZKDA 1WCV1 4C0QC 1P5ZB 4EUNA 3PG5A 4OQFA 3JZMA 1I4LD 1E9CA 1HE8B 4HEJA 1SKQA 1JBKA 1J2JA 4HZUB 2A9KA 3QJYA 4O0MA 1XPOA 4PC7A 2GWHA 1FUKA 3SEAA 4DVGA 1FL9A 4TL7A 4BWYA 1KI6B 5KUTA 4JKIA 4MUAA 5FBQB 4L5BA 2ZJOA 2QRZA 2ZYUX 3ND9A 4B6FA 5CDFA 2R62A 2GXSA 4PSKA 5LD2C 5B64A 1ETUA 4AWXA 4Q9LA 4NDZA 3OAAA 1TF2A 4M1MA 2JLXA 3UG7A 3H4MA 5FBRB 1OYYA 4OI1A 1QHSA 1R7RA 2K5UA 3BORA 1G6HA 1K6MA 1XXHE 4NCJA 5AJXA 5KDDA 3C16C 5FL3A 1GNPA 4ZCLA 2VPPA 3WY9A 4ZCIA 3I62A 1E0AA 1G8PA 2HJVA 4XTCS 4XH9B 1YJ5A 5L3QA 4C7OB 5DLQC 4AKHA 3B1WA 1RE0A 3ZJYA 4V03A 1LW7A 4EJSC 4A0HA 1HEIA 1OV4A 4DLVA 4JT2A 4D82A 5GVSA 1OLOA 2RHDA 1ESNA 1ZMXA 1TEVA 3CONA 1VG8A 2ZU0C 3ZLJA 3QPVA 5LDDC 3SNHA 2OSBA 1X1SA 4OK3A 3RANA 4EFLA 4ZIRB 2GEUA 4KLNA 3QKSB 4HAWA 1XJ0A 4FINA 1J99A 3QKRA 1GAJA 1XD9A 4IVPA 4WW0A 4URYR 1XP8A 2QY9A 3KXIA 1KGDA 2ONJA 2ZAMA 1FTNA 1MABA 4URXR 4RFSA 4F7WA 1J8YF 3C4JA 1X3SA 2BCJQ 4MKGA 1IXZA 3SFZA 2CXXA 4ZDIA 4CGZA 1G20E 2V55B 1M7BA 1XWIA 1KK0A 3KQKA 4AC9A 3ZQJA 5F9FA 2G83A 1LV7A 1YZKA 2KSQA 3FWYA 4OHXA 3BB3A 3LNCA 1KSHA 3B7GA 2GEDA 1W0KD 3E1SA 4LC0A 3WHKA 2GF0A 4DT1A 3THWA 2UVQA 2ZAOA 2JJ1D 2ONKA 3B8HA 4E07A 4V0OA 1RC8A 1IN6A 1Z08A 2VP6A 3DOEA 2ERYA 3L8YA 2ORIA 3K0EA 1P7CA 2OEPA 3B6EA 2QSYA 3CR7A 3THXA 2O8FB 4JVMA 5BN4A 3KUCA 4RZ2A 2BMJA 1NVXQ 1XMIA 2WHXA 5J4LA 4UNSA 3PUYA 4V02A 3TVTA
chains in the Genus database with same CATH superfamily
5F2KA 1NKVA 1OLUA 3C6QA 4BVJA 3IPRA 3WSVA 5B1IA 2PV7A 5TLSA 1R6AA 1GFWA 1KMIY 4WINA 4G5QA 4LBWA 3SJCA 3P9KA 5LYYA 4CMKA 4LMPA 2DKFA 3OQOA 2QVZX 4G8BA 1NXVA 5DLDA 5JPDA 2DPMA 5AKGA 4HDCA 1SQ6A 2J9FA 1UAAA 4KMSA 1GZ6A 2VH1A 4UDXX 3WBKA 1FJGB 2Q5IA 1DPGA 4N9WA 4JYBA 4WBSA 2IPOA 2R751 5CW1A 5B6IA 4F6LA 2V03A 3S81A 2QX4A 4HYYA 1SGWA 3QBJA 5JI2E 3K09A 1V1RA 2ISCA 2OAEA 3PNYA 5IHXA 1J2YA 1Y6RA 4EGJA 4YMHA 3HP4A 3MA0A 1JRLA 1T6XA 1FP1D 2AFVA 2FE4A 2WDZA 3QFSA 4KJZA 1I6WA 1H4TA 2ZAGA 2A1TS 3T7DA 1WSDA 3UJ3X 1DU4A 3VU0A 4CU5A 1QS0A 4CLOB 3L7KA 5C52B 2GEJA 2XQFA 3NYIA 4IXDA 4LQCA 1ODLA 2H1FA 2IEZA 4DIDA 4OAQA 4ESEA 1YB2A 1ADCA 1S3IA 5KEIA 1NSYA 2JFWA 5KYYB 4DQXA 4H7DA 2QS9A 4B84A 4L4UA 4RFVA 4OGGA 4XA8A 3U37A 4NULA 3EUFA 3QUQA 1DEOA 1GP2A 1J07A 5EMNA 2QBYA 1JQLB 3C48A 3PHCA 1C0PA 4D92A 1N7JA 2QIPA 3D3EA 3GLFB 5EHQA 3MT0A 3LT0A 2XGJA 4L2IA 3PQ2A 5LQNA 2GPJA 2LNDA 3JQDA 1NVGA 2ORVA 2YXEA 5DEIA 1JEDA 3BK1A 3ZH2A 4Z7JA 3AU8A 2IEGA 5TPWA 4MLCA 5ALIA 4IQ0A 2JHFA 3CINA 5DNCA 2PUJA 5FOQA 4EF5A 3VHQA 1WVGA 1O9GA 2C9ZA 1P4AA 2OYRA 2Y0PA 4EY5A 1Z5OA 4ZVLA 5GOZA 5ADHA 1LBSA 4IY1A 4NBRA 5IAOA 4IHJB 1CUWA 4GGMX 2OG1A 4FW9A 1E9SA 2EDAA 3D8SA 1JHVA 1XHFA 2Q2QA 3VZSA 2C97A 1GEEA 4E4TA 1ADGA 4YT8A 5HOQA 2UYQA 3KEGA 1UM9A 2GZ3A 2W4QA 2BRUA 2W9XA 1XEAA 1OBHA 1BWRA 4IDFA 4L4SA 1JYFA 4E2ZA 4ACAA 1A9TA 1CS0A 2QTAA 2X9QA 3COSA 4ZCMA 3K20A 2J6IA 1K5PA 4A8JB 1LI7A 1S2GA 2G25A 2C9OA 4UCQA 2EZ9A 1BZYA 4I55A 3BGVA 3ZHUA 2X7XA 1L1QA 5IVHA 3M1IA 1KAGA 4JJIA 3WLEA 3GZNA 1ZNXA 5DPMA 2C3UA 1LI4A 1H4SA 2GBLC 5JIBA 3HJRA 3PC2A 4KCGA 4Y0NA 4CCYA 2ZBRA 2G5CA 1JKFA 4YV0A 1L4GA 4Q7MB 4BJ3A 3GLIE 2GN2A 1EXMA 5DLYA 2OCDA 3L0BA 1M1ZA 3U4GA 1WCIA 3K16A 2XUDA 3N2IA 4QGAA 3GCWA 4NLLA 1JHAA 2DY1A 1O4VA 2G1UA 3HJFA 2HYIC 1OH8A 4CFZA 3S44A 3U40A 1I6KA 3TI9A 5BNTA 2JLWA 2IPMA 1M6YA 4B2IA 4QTXA 1HT1E 1KYVA 1QIGA 1ZGCA 1NI5A 5IDWA 4YJFA 4IIJB 4K8RB 1K2WA 3AFNA 4JLPA 3UAZA 5IF9A 1Y3DE 1PJ4A 2OGWA 2ZRMA 1KFKB 3KTAB 3L02A 3D3JA 3PKIA 4ARVA 1D8TA 1QHGA 2X0KA 3KAPA 4PHCA 1ZI6A 3KR2A 5KOIA 1TQ4A 5CAEA 3AOEC 4LVUA 5IEJA 1JHQA 4QHYA 1IBCA 1SOWA 1WMEA 2YHUA 2J3EA 4FOSA 4C14A 4ZGBA 1T9HA 3HCBA 3WZ2A 4D9EA 3WRYC 3RVDA 1TYAE 3AR9A 2OKGA 3OFND 3LL4A 3QOWA 1E3WA 3OZTA 3RV4A 1PW5A 2GAAA 2GCOA 3O9MA 2GN1A 2AW5A 4MHOA 5FR1A 5ICCA 1BHQ1 2J3KA 3D7MA 4CTKA 2XMPA 5I7WA 1GR1A 1TX4B 1WIWA 2ZI5A 4PZUA 5DI3B 3L18A 3DVQX 3H75A 2BY4A 4HH4A 1ZR4A 5D85A 5L4NA 5JAMA 2GPBA 4GEKA 2GBFA 1ULSA 1MN6A 3BHJA 4FOOA 1DUIA 5CR9A 5T6BA 3NDRA 3F49S 2JCGA 2CKMA 3PLNA 2ZS9A 2PJDA 3NTQA 4TV9F 4AJ4A 5LZ4A 2IW3A 5JH7A 3PA6A 3ZBPA 3M4XA 2RHOA 1D7AA 3TAXA 1OGIA 3PYMA 4BNIA 1JKIA 2V4ZA 1L8LA 1H1TA 1RRPA 2B36A 2X4GA 2BEVA 2TMGA 2C3OA 1Z2CA 5B4UA 3CVJA 3ZKWB 1VJ1A 4ENUA 1Y6FA 2REXB 3PI7A 1RZRD 2YOGA 4CR6A 3KKMA 5KNDA 3HDYA 3W5JA 1G60A 3GRAA 4J90A 1M5TA 4IEIA 2PPLA 2VF2A 3KTFA 3P0JA 3N86A 3RABA 5JV5A 1K7XB 1R1DA 3WA6A 2FXVA 5A04A 2NGRA 5E3HA 4L78A 1U7TA 2DC1A 4MPRA 2NO9A 1TUEA 3T3HA 4AQDA 3ADBA 3WC4A 4DIMA 1BDIA 2AL7A 1FTQA 2C1ZA 3UATA 2H2DA 3OZDA 4LZOA 1H94A 2GUGA 5EFOA 2QLBA 4QECA 5ESWA 5LP6F 1KMMA 3CLUC 2Q8NA 4PFKA 2GN6A 4ND5A 2JLQA 4CW7A 1WW8A 3FWPA 1I4DD 3HRIA 4BMDA 1UODA 3B36A 5E7IA 1E62A 3GLGE 3L46A 2EU8A 2MINB 1JG1A 1S2OA 2I34A 1TJNA 2C3YA 3F90A 5D8DA 1OREA 1ANKA 3JQEA 1O6FA 3RSQA 4NZYA 3UGQA 4J9UE 4UOZA 2CF5A 4UPEA 5I7EA 2ZJ5A 3OPNA 4BQEA 3X1KA 3STUA 1UC9A 3HBFA 5CXXA 1H2FA 1WKVA 1OLXB 4NS1A 4CMGA 3TZQA 2VRCD 1NW9B 2R1UA 3O2JA 2OK8A 2B8WA 2O7NA 3I8OA 3KPUA 4M38A 3V00A 3U56A 1ZR2A 3PP8A 4TUYB 3M1LA 2ZJ3A 4U2KA 1QYDA 5AI6A 4ZAYA 4C7XA 2LIPA 2VP2A 2AI2A 2P75A 5A5DA 3PEWA 1W2WB 2L42A 1C1DB 4DIOA 4OQZA 4NOMA 2AT1A 2ZBDA 4AJEA 2V45A 4PYNA 1C3EA 4YS6A 4AJHA 4EF6A 2VJCA 3LXMA 3O6VA 1J0BA 3F1KA 5L95A 2V9PA 1GCUA 2NTYC 1IQPA 1QX4A 4G0YA 1GZUA 1PKEA 3RE1A 3VVCA 4IPTA 4BRZA 2H4XA 4G8JA 3RHFA 3F5SA 5LYJB 2J3IA 2AC7A 1E63A 1PKXA 4FCCA 4Q34A 3SG0A 4MGEA 3ZWXA 1JP7A 1QUEA 4D8TA 3Q6IA 4PW0A 1RLIA 2V8OA 5C8YF 2AN3A 2DQZA 1OHHD 2Q49A 1W5FA 3HO8A 1DEHA 4NENA 1F17A 3KOOA 4BFZA 3AJ9A 3RC2A 1YJ8A 5IHPA 1WB5A 1PZEA 3SKVA 4C0AC 4Z9AA 4JLSA 1KMNA 2X86A 4KO4S 1T0IA 1WULS 4EY8A 3BK2A 2DFVA 2JRCA 2HLPA 3FPLA 2VF8A 5DRYA 2B3TA 2PDAA 3UFXA 1NRXA 4B0PA 2XCOA 3GLSA 1W87A 3OSZA 4FMBB 3CUSA 4RO0A 1XTZA 4WGGA 4DBVO 1S3GA 5B7QA 2GETA 2OGTA 1JHUA 1AS2A 1M2EA 2WJWA 3UTCA 2EWWA 4G1BA 3S2SA 1GLVA 2NUPB 2XF8A 2ZUDA 1JFSA 2G9RA 1PDVA 3OA2A 2FAXA 4DLUA 4KQ2A 3SYTA 3VR1A 1BFDA 4HGOA 5J2TA 3TVYA 1BA2A 3RV3A 2QQ5A 3QTTA 2NZYA 3WYEA 1YOVA 1RE1A 3P19A 1DMRA 1JEEA 1UUFA 2IA5A 4WASA 4A10A 1KEKA 4EHAA 1IK6A 3C5CA 5BVHB 3KQHA 2OESA 4DLSA 3OJLA 1TYCA 3HZZA 3JASB 3OZSA 3KKQA 3FPBA 1O77A 3FWKA 5IMSA 4BFVA 4TTSA 1U5AA 3ISJA 2IYYA 2C5EA 2QK4A 4R98A 4LK3A 3OG9A 1RYHA 2FSFA 1X7HA 1P75A 1BHO1 3N2ZB 4AX4A 1VIVA 4IFEA 3ZDCA 2EKPA 3U1BA 1L8XA 1VSUA 4WZAA 4S2EA 4ATNA 3U5TA 3D4OA 4XOUA 2J5BA 1FDVA 4GYKA 1RRMA 1GQOA 1NN1A 5ENZA 1XYGA 3MK31 1BSVA 1U8ZA 3CRW1 2QMZA 5HILA 3TTTA 2CCGA 5IM4F 2D8MA 3G8BA 4QKQA 2V4UA 1V6CA 3CLKA 4W8OA 1A5BB 3H2YA 1GQQA 3GFOA 4GKBA 1BS9A 3Q3JB 4MB0A 4TS1A 4PIMA 4NX2A 5EYPA 1XHEA 3CU5A 4TWIA 1VIDA 4GMDA 4M0PA 1FFHA 5JAHA 1LPAB 2EAUA 3JD0A 1YL7A 1CC1S 4LYAA 3GJQA 4MROA 2JASA 4UATA 5ICMA 1LBHA 4EO4A 1NP6A 2GM9A 2QN7A 3DCYA 2E18A 3ECCA 3B5IA 3M2PA 4IM7A 1M5RA 2X5KO 3K0FB 1C9JA 5IK2D 1VE1A 4LV5B 1EM8A 1MX5A 5IVKA 2ACEA 3IILA 4PE5B 1WXIA 4BGEA 1O6CA 2B92A 2XW6A 4TUYF 4D8WA 4ZGGA 4QQRA 3EEQA 3ZU2A 1V5WA 3T95A 2MYNA 3H13A 5LDGA 4BZXA 3OCWA 2BFWA 4IWNA 1J90A 4ZYLA 1XROA 5BSGA 5HIKA 4KOAA 4P38A 3UXMA 2F64A 4F3TA 2ILVA 5EUMA 1DARA 2WOOA 4MULA 3L1KA 3U1VA 2RHLA 4JJ8A 1FFCA 5HFAA 5GIOE 4H7JA 1NMEA 1SK9A 3DHEA 3WNDA 3SXPA 2WFLA 2P9EA 5L6LB 2AFHB 2JCVA 5A9RA 3M9LA 3N8IA 1Z34A 2YVUA 2WJ3A 4LECA 1V8DA 4TYWA 1JEJA 3VKUA 4PVDA 3TNLA 2B21A 5KWIA 1I4WA 1E2FA 1E2JA 5DHTA 4AS3A 3HUEA 4QLAA 2CE2X 2IYQA 5AKZA 5KAMA 2BM1A 3FYTA 2ONYA 2EXXA 3JYQA 1UBSB 4ER5A 3UGTA 4GRIA 3RRFA 1NFRA 3EXHA 1CULC 1MTOA 2R7AA 2OQVA 3WRXA 1E3IA 3WLQA 4ETNA 3A4LA 5F64A 1QGOA 1LDBA 3OU7A 5DWVA 1M76A 3OWOA 5LQKA 4UMDA 1NQXA 3ECSA 2PJZA 2HTEA 1TW2A 4ZALA 1AQIA 1Q50A 3PGKA 3RREA 3VZPA 4S1VA 1RPZA 5DN6A 3RWMB 2Y92A 3ITNA 2H00A 2R97A 3P9ZA 4UEOA 4DILA 4YUWA 4M7RA 4W5OA 4HUJA 4UW9A 3B5JA 4FKMA 3INYA 4RMGA 3T0FA 3FXAA 1GG2A 1FYDA 1VECA 2X2OA 4E5SA 1J2UA 3KJFA 3HZRA 1FDUA 2R66A 1HKUA 3R3YA 4PX5A 3LUBA 4WADA 1MG5A 3BXFA 1XQ9A 2PUVA 1BFUA 4V0RA 3ZS8A 4C7BA 4RULA 2BYTA 4CQMB 2WMDA 4IZIA 4B44A 1KZYC 1GFSA 2WM3A 2NSLA 4H59A 4BGIA 1LX7A 1B3RA 3AEKA 3JQGB 4GT1A 3LXRA 3UB4A 5MN5A 2X9NA 5I7HA 1ECFA 5EPUA 4D26A 1ZA2A 4NJMB 5DCWA 4F9TA 3JQ8A 1C0IA 1SQ0A 3EHDA 4Y2QA 4GQIA 2NLOA 4D6YA 1I1NA 7REQA 1DCTA 4DGSA 5H3HA 5KJEA 2JVKA 2Z58A 1D2HA 1LK0A 4LDNA 3TRJA 3P0IA 2CSXA 2GJSA 1VJ5A 3FZEA 1E1LA 1XEWX 3A9SA 2WZDA 3LWDA 4ZANA 4MVJF 4WGFA 4PNEA 4CKYA 4BL5A 2AXEA 4QQNA 4UHKA 3DMTA 2C5GA 3S2IA 4RDXA 2HD4A 3EEFA 4MVCA 2PRZA 3CNHA 4TLDA 5LNK1 3FZNA 4CEHA 4LCBA 3B9PA 5K3EA 3I3SR 4R16A 2YNMC 3H04A 4AY3A 3MIIA 3EIFA 3KSZO 3G23A 5DBEX 3MWDA 3TDKA 3TSAA 1SUCA 2GASA 2P2YA 4DCSA 1BEZA 2QN1A 1S89A 1I6LA 1U7DA 3O8QB 4LGCA 5HF9A 4YMWA 4RQTA 2C99A 2BGNA 4ZI7B 3ZKAA 4ZYZA 1BHSA 2OBBA 1ES9A 1VZ3A 3AUAA 4HLUC 3ZGYA 1Y8RB 1JEQA 3KQMA 2DHEA 3HKDA 3LQRA 4RF5A 4RS4A 1I94B 5U4QA 4RLFA 1Q1NA 3FMVA 5DGXA 3IOYA 4B83A 1OA1A 1Y34E 1ZUNA 4Q4HB 2V7XA 2IHNA 2F1KA 1HRKA 3NYQA 1BXRA 2AKAB 1KPHA 2AZTA 5K0TA 4FD2A 2R0QC 4FMCF 3UENA 4IDBA 4IXWA 2O5CA 5TT0A 4LF8B 3BE6A 5EXPA 1M6NA 3RDPA 4Y9DA 3Q11A 1EHIA 2D7DA 3QG1A 3IAS6 4W82A 2NX2A 2XUKA 5K3BA 2NUTA 1ORVA 4N40A 4UHFA 2P69A 1GPDG 1DI0A 3WO0A 3AHJA 4KB5A 2ZSBA 3JALA 2HRZA 3BFPA 4JWKA 1W59A 2BEVB 2JAXA 2ZOSA 4R1OA 3ZXXA 1CQIA 1EX7A 4C2UA 3LBYA 4QUJA 3EWNA 2AG8A 1QP8A 3IQZA 3IR6A 3D0QA 5DHAA 3MMSA 1PDWA 3OF3A 5DGHA 1N9KA 3IESA 3A2KA 2O8DA 1HY3A 1AN0A 4XPIA 4D9FA 5E9QA 1E9FA 2BUCA 3QVTA 3BGDA 4FYVA 1YBFA 3R74A 2V5VA 2WP0A 1EQUA 3S68A 1L5ZA 2GM3A 3AHGA 1GXSA 5BUCA 3TQQA 2ZYTX 4J6EA 2EJUA 3IDFA 2W6JD 4XDGA 2K87A 1DKRA 3GOHA 2JJMA 4P4GA 1FYVA 5EZ5A 1USUA 1U1CA 1I3OA 4OJTA 1W7AA 5KO2A 3QY9A 4I9UA 4M7PA 4FR2A 3NMUF 4KRGA 4RTQA 5HGXA 4QGHA 1UBUS 1Y4UA 3RUPA 4BO0A 5MFPA 1SZCA 5YASA 4DA4A 2FNAA 3TGPA 1JX6A 4DR4B 1E3TA 1BTOA 2OHJA 1XRSB 3EG9A 3UJPA 3E22B 5EJFA 5EXXA 1PGQA 3VA7A 3QWFA 2RGNC 3JD4A 3B1YA 3K0CC 1XEFA 3EY4A 5TEVA 4MIYA 5D3MA 3KQWA 5DXJA 2UXBB 2PWBA 2PZ8A 4WOBA 3UHOA 3U4IA 3RVQA 4W63A 3OKFA 4WNAA 4O0LA 1O54A 2YWRA 1UWVA 3PQ8A 3DKPA 1COWA 2DFDA 4HADA 5EFZA 4JV5B 1W5AA 4PFJA 4CFSA 2YY6A 2B83A 3LL7A 3OPYB 3LUCA 4Q6BA 5CTJA 4DLWA 2XQKA 4F2GA 5IKOA 4AJOA 3VX4A 2PGOA 1N8SA 2WR8A 5TS2A 4BY9E 2FFHA 5CVJA 3KYDB 4O5AA 4F12A 1W52X 2IYEA 4YP9A 4KQEA 1YZQA 1Q0UA 1ZVKA 3DOCA 1T2CA 4ZMSA 1E6KA 3PEVA 5TVKA 3IB3A 3K5HA 2GFQA 4M0KA 5F4BA 1SC6A 2EJVA 3IP5A 3PRHA 2B94A 3K70C 3RYFB 1NM5C 4NZNA 1SD1A 1NZDA 2OYSA 5ELLA 2AD1A 5LD2B 1E1QA 4BAZA 1Y63A 1BW9B 1HTWA 1OZGA 1L4NA 3TEJA 3OSUA 1J22A 3VAAA 1WU8A 3WMFA 2PX2A 3UV7A 1JQ5A 5C3MA 1U9CA 2Z8YA 4ZARA 2J9YB 4OLBA 2VSQA 2ZIZA 4DFDA 5FBLB 3KEMA 3V4OA 2VP9A 3WFJA 4KFUA 5B1YA 3MRVA 4BLUA 3L41A 4EI2A 5BURA 4RENA 1CR2A 1HDZA 2MR5A 4J49A 2PNJA 4B6GA 2WWYA 3FGZA 4XQCA 2C4MA 1PJ3A 2AFRA 4F45A 4W5QA 3RRNA 1G5RA 3U7GA 3EIEA 3IIEA 3JS5A 3IOCA 3HDQA 4RMHA 1KEUA 1I3KA 5CPBA 1H93A 2GZDA 4ZHQF 5D2CA 3IUEA 2E1PA 4B1FA 4BP1A 3BC1A 1LTQA 3VR3A 1LRJA 1V8OA 4LF6B 4CCYB 1Z0ZA 1NBWB 3PGXA 4ZI7A 3HXLA 1JR4A 1Y98A 1GKUB 5IEBA 2OILA 4QBGB 2G80A 3WISA 3K15A 3L4BC 4G0NA 5COBA 4Y9TA 4K2AA 5J5VA 1OXUA 2F8LA 1PD0A 4PYRA 4CTNA 5BNZA 4K9RA 2UU9B 2AWNA 1E7RA 2C7QA 2ZAIA 1V8BA 5CVVA 1MX1A 3Q7QA 4GC9A 4LMAA 4AKGA 2P68A 4MJ7A 5IJ0A 2O52A 2XVMA 4XR9A 1X0XA 3D59A 1Q0QA 4C5CA 1FW8A 4XWOA 5KYYA 3PTLA 3BWVA 5DZSA 2PRJA 4XSVA 4R1TA 1XXLA 3TNJA 2VF7A 3F46A 4DAEA 1KP3A 3HFGA 4YP6A 1LBQA 5FA5A 3ZGOA 3I9NA 5FIUA 5CFRA 4HFRA 1LK7A 1NKSA 1YMQA 2HDNB 1SG9A 2R8OA 2CLFB 2NZ2A 4EABA 2O19A 2IK8A 4PGHA 1H3FA 3DEJA 1NFFA 2WG0A 5G1PA 4C3UA 3DLHA 1SVIA 3IEUA 3WGMA 1GCIA 1NSTA 2QPLA 3WK8A 2ODQA 4AG6A 5A4IS 4YAKA 1WUTA 3D5TA 2BJVA 4IEEA 3FMGA 4EG7A 1YCHA 3VU3A 1IVSA 1YV9A 2NT4A 5LQUA 1AGXA 3ZUGA 2E89A 1ZBQA 1ZQ1A 2NQTA 3QELB 3S2UA 3UKJA 2D4AA 1OJLA 1MRZA 2BKXA 3E3LA 4AP6A 1U8EA 2PCJA 3QQPA 4INAA 3R0ZA 3VU9A 4DSZA 4Z1MD 2CD9A 5DM0A 4RHEA 1MT0A 2JPDA 2QP4A 3R7AA 2NG1A 3V32A 3QHPA 2O0MA 3MIZA 4AMGA 3IPXA 3S70A 5CA1F 2I6UA 3L8HA 4FR0A 4HBGA 4JJEA 1OZFA 1JILA 2QRKA 3IQFA 4K9LA 3DLAA 4ML3A 1JB9A 3GD7A 1K8RA 3LUJA 1V6AA 2FPRA 1R15A 4IJMA 2VZ0A 1A4RA 2WVGA 4L0QA 3AF3A 5JVDB 3RU9A 2VJLA 3AP3A 4GZ3A 1PNQA 2VHCA 3PWTA 4HATA 4QICA 4BASA 2AOWA 5JXIA 1NRWA 3BXZA 1NDUA 1PHRA 2PIAA 3I1YA 3HRHA 2QD1A 3BXHA 3UUFA 3CTMA 1C2YA 2PTGA 3Q8XB 5L3RA 3R4VA 1D5CA 4Y9RA 4ZV7A 3OOSA 4L74A 3NPMA 1AM4D 2PMDA 1AD2A 2O8CB 5DN9A 3THYA 5GWXA 2QN8A 1TTTA 4XVCA 1GG9A 4JB0A 2OENG 2ZTLA 1NXOA 3ABIA 4CM9D 2R8EA 3AJRA 3FCYA 1STOA 1WSWA 2HA4A 4BX3A 2WU0A 3OLCX 2QWXA 4IR7A 5L7YA 2G9QA 2I3GA 4K6OA 2A0UA 3DC2A 1F3LA 4F0JA 2A8YA 4H7PA 2FX5A 2IT1A 3LBAA 1POXA 4H4CA 4MQ6A 1NF2A 1P5JA 2IYFA 3H9GA 5KCMA 4OXNA 1SUWA 1ZH2A 3U9SA 1GLNA 2FP4A 3Q9SA 3IXLA 2QZ4A 1U1IA 3E4CA 3OIDA 4MVJG 5DASA 5DCLA 3VR5D 3AHCA 1OGJA 1PNVA 4XD7D 3OFSA 1D1SA 1A88A 4QU5A 3GUCA 2BOVA 1G38A 5AJHA 1A95A 2JNWA 5H70A 2D8AA 1UIRA 3W3ZB 1HTTA 1EWQA 1ZSYA 2HHJA 4ND3A 3WL5A 1F51E 4H18A 3TOCA 4G0WA 1ZNYA 3OO0A 1CJVC 1VG0B 1U2GA 5BOSB 1G3RA 1HLPA 1Q1QA 3EA4A 2IUEA 4ARSA 3CVXA 1ZGAA 5FUMA 1G8MA 5FHQA 2HCRA 3SD7A 4UULA 4XGRA 5HCIA 4JQSA 1M8KA 4E5MA 5J58A 4X92A 4AKTA 2GA8A 2XOKD 4HZIA 4LJAA 3SM9A 1M8JA 5TQJA 3TMAA 4K81B 2J32A 5L9AA 4EAAA 4RZQA 5EJEA 1BQEA 4GYJA 4X97A 4BNKA 5BW8A 1MAHA 4GR5A 4ZP1A 4FI3F 3VVMA 2AUNA 4JXXA 2P7HA 3B7PA 4MUJA 4ZKEA 3NOVA 2D1FA 3D81A 2M9MA 5U1PA 1KVUA 1E2EA 3VXKA 1JW9B 4LF9B 3FTFA 4J29A 3NV7A 1W47A 2ZSEA 3QUCA 4KDCA 4CM1A 1VL0A 1DGQA 1BMFA 1T35A 1VBNA 2B78A 3I12A 4L50A 1C0LA 2ZRIA 2J07A 4OKIA 1DO2A 3JZAA 3R9XB 3OKPA 2O8EB 4RLSA 4WLUA 3QVWA 1E1MA 2QD3A 4QOGA 5FWXA 5JFGA 3MINB 3GDGA 3AUTA 3A6FA 3DTTA 2PVCA 1X94A 3LUKA 4GKVA 1CU1A 1E4YA 5IUJC 2HQ1A 1E3JA 3NKFA 1WX1A 5HG0A 4BRUA 2EEZA 1UMBA 2VIIA 3FYCA 4CETA 3A26A 3RADC 2H06A 4CCAA 1E1RA 2ENUA 3CV3A 1D4FA 1PZGA 2BMWA 1ZITA 5I9SA 1B8OA 4CZ2A 3KPJA 2B4RO 2ZTUA 3ROQA 3S3TA 1XU9A 2O0JA 1EZ4A 4C30A 3LQKA 2BHSA 2K4MA 2DSTA 3ZLTA 1PNTA 4XX1A 5JS2A 3PQEA 2PFSA 3TSZA 1AMOA 1MMFB 4Q3BA 5BPFA 1YB5A 2QM0A 4LTMA 2JGMA 4UTRA 1CS4C 1CP2A 1K63A 3FPJA 3H1EA 5BWCA 3U09A 4A92A 4C76A 2TS1A 3JARB 2R60A 1XJ5A 1Y1LA 3V8PA 1MTZA 4IVRA 4KMOA 3TYXA 1PLJA 1I1HA 2PBFA 2WKSA 3R7DA 4OQDA 2ZB8A 3TB4A 1AMUA 4PN7A 3H8SA 4M8KA 4UNNA 3AOGA 3WLTA 1A69A 3R5XA 2WRZA 2F1JA 2CDBA 3RTGA 1SKYB 5C46F 1TQ2A 4OL0A 4P3KA 5CM8B 5E9JA 1IJBA 1XZPA 3WDLA 3HN7A 2DT8A 4IYRA 3QU2A 3QBTA 2Y77A 1T15A 3VR4H 5DGTA 3I42A 3DUWA 1E60A 3PITA 1KI6A 2HJRA 3ZHOA 1VLLA 1Z2DA 3G82C 3PNKA 2JF0A 4DA9A 2ZUFA 1J24A 4KR2A 2IRWA 1UKEA 1AHHA 3AUSA 5KQPA 2IU6A 2QROA 4ZOQI 1Z07A 2OGUA 5LPNA 1GAXA 2PD3A 4EJFA 2EX4A 4DV5B 1XRLA 1RJEA 3QVKA 2IHJA 1EFDN 2PD4A 5FWYB 2RGBA 3PT9A 2EL9A 4Q19A 2IHKA 1BQ3A 4Z7OB 1LRKA 5JNLA 5PNTA 5K99A 2HF9A 4LMBA 3UOAB 3VR6A 3F2IA 1SELA 1FZTA 3NIBA 3K05A 2ACWA 3AM4A 3GZTB 1POWA 2ONZA 3BCRA 3BDIA 5CDFE 2UVPA 1I5OA 3O75A 4F3YA 1KJJA 4MVXA 4ECAA 3SLKA 2PGJA 1HR0B 3FCCA 4MR7A 2IYWA 5E7QA 3MAGA 1NBEA 1XR3A 2OT3B 4KZPA 3IRUA 5K3SA 1CW2B 1TIBA 4MUNA 4G07A 2AB0A 3L8MA 5K0CA 4G8DA 2A9OA 1XVAA 5CJJA 3U60B 4RZHA 1RQ7A 3IERA 1J0CA 1T9BA 3KOWA 4FE7A 2G40A 3NEJA 4P4SB 5JSHA 2OBFA 4FHCA 5U9CA 3GGJA 4UUNA 2XTJA 2QNRA 2MSLA 1XNGA 3D7KA 4FDMA 4WNYA 3WGVA 5LKAA 4GPZA 4JHXA 1J0EA 1L7AA 1V8ZA 2DHDA 1TUGA 4RABA 5ERXA 3SF0A 1ZCJA 3AVYA 2AHRA 3MN1A 3UA4A 1VL2A 3TAHA 1TVMA 1NI4B 4K6FA 5D5QA 4AN1A 3P20A 1O96A 2QRJA 4RHTA 4IFTA 5J63A 3AL0C 1ZKDA 2R5NA 1TZCA 3I05A 2OHXA 3QUAA 4JUBA 3WR5A 3V6MA 2A1UB 3L1JA 3A32A 2R6JA 3IVMA 4I5GA 2Y68A 4HH1A 5ER6A 2JGDA 1WPGA 4UE3S 3F6BX 3F67A 4OYLA 3ZC3A 4EA6A 3K4PA 5HKBA 4NCXA 5FO1A 3DHYA 3HI6A 3R3XA 2ZIWB 2JHGA 2ZJYA 1XCPA 2CN1A 4WY5A 2Z2KA 3CSSA 4HZGA 1CJTC 4QDXA 5K0EA 1XMQB 3S1AA 4CEIA 3A9WA 3MGBA 1A98A 1ODTC 2O14A 2V74B 3LAWA 3OPMA 5F3RA 3TQIA 4EHJA 3D6TB 1TO2E 3AG5A 1TUBB 4GBMA 4HNRA 3S8EA 2XLCA 4WZAB 5EGNA 2GILA 3KZOA 3WJAA 3Q0EA 5CA0A 1Y1TA 3PDWA 3NWEA 1E5LA 4I3GA 4JLAA 2O2ZA 2XF2A 4JBIA 4MKXA 4ZN6A 3UV3A 1UAYA 4ENSA 1V5GA 3MRSA 5FWXB 2O8DB 4ID9A 1CNMA 1T2NA 2DPGA 2RH5A 3E7WA 3CH6A 3NJ8A 4YJ3B 4CT5A 4FSXA 5GINE 1C7JA 4WZBE 4BNUA 4Y9UA 3JRXA 3EC1A 4IILA 4MUKA 1RAHA 2AOVA 4JLMA 1INLA 4NJOA 4XW2A 5T6MA 2YBDA 2Z83A 1LKZA 2ZQZA 2H2FA 1E5VA 3O2NA 5LKRA 5HW0A 4FTWA 5JSZA 3OP1A 3PXGA 1MO4A 2VA8A 3EJWA 2X22A 2XWBF 2P6NA 2ZWAA 4U2FA 2ES4A 3DFUA 4DMGA 1QQ6A 4NC9A 4E32A 4ZQEA 1KJZA 4CLRB 1L8AA 2VK8A 3CURA 3F7TA 4G0VA 2OY0A 1EVQA 4B80A 4P3YA 3U49A 3QKSA 1OYOA 4ZC1A 1I9GA 3H05A 2GAIA 5AJZA 2PL1A 3WX0A 2WF9A 1TGVA 3E7XA 1GN8A 4ZCTA 2ZR8A 4AL4A 1SU4A 1L4BA 1PJ2A 1YULA 3PXDA 4URHA 3ZDEA 3UAXA 5FOTA 1R0RE 2HNAA 3KD3A 2B99A 4HL6A 4ED9A 2P1RA 1IZ8A 4GOKA 5DWQA 3AHEA 1WNTA 3H5OA 4XARA 1L3IA 5H0IA 1E7MA 4I1OA 3NIGB 3DEIA 3C85A 2I7VA 2QRHA 5E3IA 4X90A 1U2ZA 1IHYA 4L07A 2KWIA 3PHBE 2E1RA 4O6VA 1TVEA 4JBNA 3RVMA 4Q1AA 3T9FA 1XKLA 1T91A 2LCFA 3UVEA 1LY1A 1YRWA 2J0EA 3W06A 2D5BA 3ZIUA 1T0UA 4N49A 3QWAA 4QJ5A 1J42A 1MV5A 1Z4IA 1ZU5A 3CO5A 3VU1A 5JQGA 4U7JA 5C2JB 1EWRA 1L7XA 2V7QD 2XTAA 3PDJA 1DRUA 4WRRA 1DDGA 1L4LA 3KJEA 3HL0A 1KI9A 3FM9A 1WSBA 2X77A 4Q4JA 4RKQA 3ASVA 2WG2A 4A0FA 1G4HA 3MBOA 3THYB 3P5SA 3PNQA 4IZ6A 2UYCA 3CE6A 3B6IA 4WOKA 1Z6ZA 2PR7A 1NPTO 1V11B 2HA2A 2JFXA 2QUBA 2V7WA 3GVPA 3HDVA 2PMBA 1KTIA 4U2BA 4JROA 3VPCA 4OBWA 4R68A 2IZZA 5JADA 1VLVA 1BKSB 2QD2A 3D8BA 4D41A 1B41A 4DR6B 2LKCA 3K1YA 1AG9A 3DWGA 3HVUA 3E84A 1E6MA 2GVZC 2HA0A 4EHIA 3HTXA 2AGVA 2CV0A 1M6EX 4AM8A 2QVXX 2RH4A 3IKLA 2D1YA 4LRSB 4YQZA 3NIWA 2K2QB 2VLIA 2Y71A 1K3FA 3ZCRA 4YVFA 4I99A 2D6FA 5K8JB 4TPKA 2G63A 5FHRA 1VCMA 1P72A 2LZ0A 4LHWA 1G98A 4KXUA 4TTTS 1XTBA 1LWOA 1X1QA 1ZZEA 2YZNA 5H7XA 4EIWA 1W5SA 1CB0A 3ASYA 3TH5A 1PJTA 1KFBB 4DG8A 3A05A 3MZ0A 3SHVA 5KI6A 4CR8A 4CKCB 2BFNA 4KAJA 4F4CA 4C05A 3BZWA 3ZWVA 1JALA 1NASA 4ZDKA 4UVDA 3BJZA 4D6PA 2R6CA 1JLSA 1LZKA 2H8GA 4FHGA 4LY9A 4XGKA 4N01A 1A8PA 1XXHA 2B9EA 1ZGZA 3PE4A 3VZBA 1IN4A 1PFUA 5AM0A 3ZHQA 3I76A 3QVJA 4P98A 1VLMA 4GPEA 2FZWA 2C4WA 5AVOA 3SSAA 4MS4B 4HB4A 2BR3A 2FPWA 2WZBA 3KQUA 5B36A 1JR2A 3WRVA 2DFLA 5LZ7A 1VIMA 5JD4A 5FF9A 4EENA 2V3VA 2VCHA 1G8YA 3EZ7A 5FBKA 1IY9A 4ZK2A 2R47A 2VH5R 3KE8A 4EATA 1T5IA 4C29A 3AM5A 4CIYA 1D1TA 2VJOA 2W8BB 1G0OA 4DJTA 3HXKA 3P9QA 3B13B 5AK4A 3ZGLA 5ESDA 1FLDA 1Y9DA 4D96A 1PR5A 2WU1A 3OLXA 4XVQA 1QFZA 2W22A 2NO4A 1N6PA 3O8OA 4XUCA 1JKJA 4PGGA 5MFZA 2PX0A 4QXAA 4E5KA 1O89A 4KSCA 4WJZA 2H4JA 2ZVJA 4GOLD 2Q7DA 1B23P 3PENA 4D3ZA 5FWDA 2UZ1A 3NQ41 5B12A 3F78A 4RA9B 5BSTA 2R79A 3MQFA 3SM3A 2EBFX 4NYMQ 3U13A 3UICA 2PUBA 3DFMA 3PPYA 3O7MA 5C32A 5DGIA 3VH3A 3UQZA 4R71A 2XBMA 3WDKA 3EFOA 1CUVA 1LRLA 2WPDA 4F4JA 3WK9A 3OEED 4TRNA 3C6MA 4NECA 3U39A 3R3SA 5ITZB 1LFDB 1ZKMA 2Q0XA 2PGDA 3T15A 1JMVA 4HVCA 1S2NA 3H65A 4FZJA 4IGFA 1YWGO 4C0LA 2SCUA 1CRWG 1V7PC 2O2YA 3LRXA 3HNPA 5JY6A 5BSHA 2VHXA 3HADA 3VYRB 1LSOA 1MDFA 1V5FA 2PL9A 2QAGC 4PZZA 3IE2A 4MW4A 4PAMA 4YCLA 5IC4A 2P11A 1THGA 4IOMA 5LQMA 3OU6A 1L7NA 1NONA 4IDNA 9ABPA 2NVBA 3ADKA 1LZLA 3SICE 5DHRA 1ADYA 3DO5A 2HU2A 3ETHA 1K4YA 1QDEA 3SYLA 5LDHA 4IIVA 4FYKA 4C06A 1PWXA 2P3SA 3HCCA 2Z5GA 4G8CA 5JLJA 2H1IA 4TWZA 5AI8A 3GBPA 2VRCA 3DKVA 2DAPA 4TMTA 5AKJA 3DL2A 4NNOA 4JY7A 1XRJA 4D9KA 1CQWA 4ADSG 1UDAA 1ECLA 1FLAA 4MA4A 2XDWA 2YDYA 4K6HA 2HIHA 4GWGA 1KF0A 4LHZA 4O59O 1M2OB 4M9CA 4N76A 2EL7A 2BBTA 4ZV4A 5C0OE 1S1CA 2AYXA 1G55A 1NP7A 2VDOB 5I3CA 4ENQA 1PFQA 4K2HA 4DLZA 2OQRA 1NLMA 4MSUA 4HB3A 3TD6A 5FEUA 3HCFA 1JAIA 1VKHA 1M67A 4FGUA 3RPEA 1XEXA 1LVHA 3HKEA 4WZBA 5EESA 5IMBA 4YGYA 4BEBA 1RXVA 1P1RA 4WXHA 2J0UA 3EC7A 2QTHA 5FL7A 3T9EA 1E2QA