2ZVVA

Crystal structure of proliferating cellular nuclear antigen 1 and short peptide from human p21
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
255
structure length
255
Chain Sequence
MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYIRYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Arabidopsis thaliana proliferating cell nuclear antigen 1 and 2 proteins complexed with the human p21 C-terminal segment
pubmed doi rcsb
molecule keywords Proliferating cellular nuclear antigen 1
molecule tags Dna binding protein
source organism Arabidopsis thaliana
total genus 59
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 2zvvA00
2IO4A 4L60A 3G65C 3I2MX 2HIKB 1DMLA 5IY4A 1UD9A 1CZDA 1B77A 5E0VA 2AWAA 5B7OA 3A1JC 3P83A 5E0TA 4D2GA 5DA7A 3V62B 1ISQA 3A1JB 3U60F 1UL1A 4YHRA 5HACA 3A1JA 2ZVLA 1YYPA 3U61F 3HI8A 1U76A 5CFKA 2OD8A 1GE8A 1RXMA 1RWZA 3GGRB 3WGWA 5A6DA 2IX2A 1RXZA 3HSLX 3LX2A 2HIIB 4RJFA 2NTIB 2ZVVA 3V61B 3GGRA 5DAIA 3U5ZF 2IX2C 3F1WA 2Z0LA 2HIIA 1SXJF 2NTIA 3GGRC 3K4XA 2IZOB 1AXCA 3AIZA 5IXAA 2HIIC 1W60A 1PLRA 2IX2B 2NTIC 2ZVKA 2ZVMA 5IWDA 3AIZC 4ZTDA 3FDSC 3P91A 4HK1A 2IJXA 5AUJA 1VYMA 2IZOC 3TBLA 1PLQA 5JNED 1IZ5A 3AIXB 5E0UA 4CS5A 2AVTA 3V60B 3VKXA 3LX1A 3GPMA 1U7BA 3FDSD 3GPNA 3AIXA 2HIKA 3G65B 3IFVA 4L6PA 2ZVWA 2HIKC 3A2FB 1IZ4A 2IO4B 1B8HA 3P87A 3G65A 1T6LA 5H0TA 1VYJA 4TR6A
chains in the Genus database with same CATH superfamily
2IO4A 4L60A 3G65C 3I2MX 2HIKB 1DMLA 5IY4A 1UD9A 1CZDA 1B77A 5E0VA 2AWAA 5B7OA 3A1JC 3P83A 5E0TA 4D2GA 5DA7A 3V62B 1ISQA 3A1JB 3U60F 1UL1A 4YHRA 5HACA 3A1JA 2ZVLA 1YYPA 3U61F 3HI8A 1U76A 5CFKA 2OD8A 1GE8A 1RXMA 1RWZA 3GGRB 3WGWA 5A6DA 2IX2A 1RXZA 3HSLX 3LX2A 2HIIB 4RJFA 2NTIB 2ZVVA 3V61B 3GGRA 5DAIA 3U5ZF 2IX2C 3F1WA 2Z0LA 2HIIA 1SXJF 2NTIA 3GGRC 3K4XA 2IZOB 1AXCA 3AIZA 5IXAA 2HIIC 1W60A 1PLRA 2IX2B 2NTIC 2ZVKA 2ZVMA 5IWDA 3AIZC 4ZTDA 3FDSC 3P91A 4HK1A 2IJXA 5AUJA 1VYMA 2IZOC 3TBLA 1PLQA 5JNED 1IZ5A 3AIXB 5E0UA 4CS5A 2AVTA 3V60B 3VKXA 3LX1A 3GPMA 1U7BA 3FDSD 3GPNA 3AIXA 2HIKA 3G65B 3IFVA 4L6PA 2ZVWA 2HIKC 3A2FB 1IZ4A 2IO4B 1B8HA 3P87A 3G65A 1T6LA 5H0TA 1VYJA 4TR6A
chains in the Genus database with same CATH topology
2IO4A 4L60A 3G65C 3I2MX 2HIKB 1DMLA 5IY4A 1UD9A 1CZDA 1B77A 5E0VA 2AWAA 5B7OA 3A1JC 3P83A 5E0TA 4D2GA 5DA7A 3V62B 1ISQA 3A1JB 3U60F 1UL1A 4YHRA 5HACA 3A1JA 2ZVLA 1YYPA 3U61F 3HI8A 1U76A 5CFKA 2OD8A 1GE8A 1RXMA 1RWZA 3GGRB 3WGWA 5A6DA 2IX2A 1RXZA 3HSLX 3LX2A 2HIIB 4RJFA 2NTIB 2ZVVA 3V61B 3GGRA 5DAIA 3U5ZF 2IX2C 3F1WA 2Z0LA 2HIIA 1SXJF 2NTIA 3GGRC 3K4XA 2IZOB 1AXCA 3AIZA 5IXAA 2HIIC 1W60A 1PLRA 2IX2B 2NTIC 2ZVKA 2ZVMA 5IWDA 3AIZC 4ZTDA 3FDSC 3P91A 4HK1A 2IJXA 5AUJA 1VYMA 2IZOC 3TBLA 1PLQA 5JNED 1IZ5A 3AIXB 5E0UA 4CS5A 2AVTA 3V60B 3VKXA 3LX1A 3GPMA 1U7BA 3FDSD 3GPNA 3AIXA 2HIKA 3G65B 3IFVA 4L6PA 2ZVWA 2HIKC 3A2FB 1IZ4A 2IO4B 1B8HA 3P87A 3G65A 1T6LA 5H0TA 1VYJA 4TR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO4 A;  4L60 A;  3G65 C;  3I2M X;  2HIK B;  1DML A;  5IY4 A;  1UD9 A;  1CZD A;  1B77 A;  5E0V A;  2AWA A;  5B7O A;  3A1J C;  3P83 A;  5E0T A;  4D2G A;  5DA7 A;  3V62 B;  1ISQ A;  3A1J B;  3U60 F;  1UL1 A;  4YHR A;  5HAC A;  3A1J A;  2ZVL A;  1YYP A;  3U61 F;  3HI8 A;  1U76 A;  5CFK A;  2OD8 A;  1GE8 A;  1RXM A;  1RWZ A;  3GGR B;  3WGW A;  5A6D A;  2IX2 A;  1RXZ A;  3HSL X;  3LX2 A;  2HII B;  4RJF A;  2NTI B;  2ZVV A;  3V61 B;  3GGR A;  5DAI A;  3U5Z F;  2IX2 C;  3F1W A;  2Z0L A;  2HII A;  1SXJ F;  2NTI A;  3GGR C;  3K4X A;  2IZO B;  1AXC A;  3AIZ A;  5IXA A;  2HII C;  1W60 A;  1PLR A;  2IX2 B;  2NTI C;  2ZVK A;  2ZVM A;  5IWD A;  3AIZ C;  4ZTD A;  3FDS C;  3P91 A;  4HK1 A;  2IJX A;  5AUJ A;  1VYM A;  2IZO C;  3TBL A;  1PLQ A;  5JNE D;  1IZ5 A;  3AIX B;  5E0U A;  4CS5 A;  2AVT A;  3V60 B;  3VKX A;  3LX1 A;  3GPM A;  1U7B A;  3FDS D;  3GPN A;  3AIX A;  2HIK A;  3G65 B;  3IFV A;  4L6P A;  2ZVW A;  2HIK C;  3A2F B;  1IZ4 A;  2IO4 B;  1B8H A;  3P87 A;  3G65 A;  1T6L A;  5H0T A;  1VYJ A;  4TR6 A; 
#chains in the Genus database with same CATH topology
 2IO4 A;  4L60 A;  3G65 C;  3I2M X;  2HIK B;  1DML A;  5IY4 A;  1UD9 A;  1CZD A;  1B77 A;  5E0V A;  2AWA A;  5B7O A;  3A1J C;  3P83 A;  5E0T A;  4D2G A;  5DA7 A;  3V62 B;  1ISQ A;  3A1J B;  3U60 F;  1UL1 A;  4YHR A;  5HAC A;  3A1J A;  2ZVL A;  1YYP A;  3U61 F;  3HI8 A;  1U76 A;  5CFK A;  2OD8 A;  1GE8 A;  1RXM A;  1RWZ A;  3GGR B;  3WGW A;  5A6D A;  2IX2 A;  1RXZ A;  3HSL X;  3LX2 A;  2HII B;  4RJF A;  2NTI B;  2ZVV A;  3V61 B;  3GGR A;  5DAI A;  3U5Z F;  2IX2 C;  3F1W A;  2Z0L A;  2HII A;  1SXJ F;  2NTI A;  3GGR C;  3K4X A;  2IZO B;  1AXC A;  3AIZ A;  5IXA A;  2HII C;  1W60 A;  1PLR A;  2IX2 B;  2NTI C;  2ZVK A;  2ZVM A;  5IWD A;  3AIZ C;  4ZTD A;  3FDS C;  3P91 A;  4HK1 A;  2IJX A;  5AUJ A;  1VYM A;  2IZO C;  3TBL A;  1PLQ A;  5JNE D;  1IZ5 A;  3AIX B;  5E0U A;  4CS5 A;  2AVT A;  3V60 B;  3VKX A;  3LX1 A;  3GPM A;  1U7B A;  3FDS D;  3GPN A;  3AIX A;  2HIK A;  3G65 B;  3IFV A;  4L6P A;  2ZVW A;  2HIK C;  3A2F B;  1IZ4 A;  2IO4 B;  1B8H A;  3P87 A;  3G65 A;  1T6L A;  5H0T A;  1VYJ A;  4TR6 A; 
#chains in the Genus database with same CATH homology
 2IO4 A;  4L60 A;  3G65 C;  3I2M X;  2HIK B;  1DML A;  5IY4 A;  1UD9 A;  1CZD A;  1B77 A;  5E0V A;  2AWA A;  5B7O A;  3A1J C;  3P83 A;  5E0T A;  4D2G A;  5DA7 A;  3V62 B;  1ISQ A;  3A1J B;  3U60 F;  1UL1 A;  4YHR A;  5HAC A;  3A1J A;  2ZVL A;  1YYP A;  3U61 F;  3HI8 A;  1U76 A;  5CFK A;  2OD8 A;  1GE8 A;  1RXM A;  1RWZ A;  3GGR B;  3WGW A;  5A6D A;  2IX2 A;  1RXZ A;  3HSL X;  3LX2 A;  2HII B;  4RJF A;  2NTI B;  2ZVV A;  3V61 B;  3GGR A;  5DAI A;  3U5Z F;  2IX2 C;  3F1W A;  2Z0L A;  2HII A;  1SXJ F;  2NTI A;  3GGR C;  3K4X A;  2IZO B;  1AXC A;  3AIZ A;  5IXA A;  2HII C;  1W60 A;  1PLR A;  2IX2 B;  2NTI C;  2ZVK A;  2ZVM A;  5IWD A;  3AIZ C;  4ZTD A;  3FDS C;  3P91 A;  4HK1 A;  2IJX A;  5AUJ A;  1VYM A;  2IZO C;  3TBL A;  1PLQ A;  5JNE D;  1IZ5 A;  3AIX B;  5E0U A;  4CS5 A;  2AVT A;  3V60 B;  3VKX A;  3LX1 A;  3GPM A;  1U7B A;  3FDS D;  3GPN A;  3AIX A;  2HIK A;  3G65 B;  3IFV A;  4L6P A;  2ZVW A;  2HIK C;  3A2F B;  1IZ4 A;  2IO4 B;  1B8H A;  3P87 A;  3G65 A;  1T6L A;  5H0T A;  1VYJ A;  4TR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...