2ZVZA

Structure of the periplasmic domain of motb from salmonella (crystal form iii)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
170
Chain Sequence
b'PNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDAINRRISLLVLNKQAEQAILH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 54
structure length 170
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zvzA00
1R1MA 2ZOVA 3S0WA 3TD5A 4R40B 4G4WA 4PWTA 3TD4A 3S0HA 2KGWA 2AIZP 5EB0A 4G4YA 4ZHWA 3S0YA 4B62A 4G4VA 2ZVYA 3TD3A 2ZF8A 5EAZA 3S06A 3CYQA 2W8BC 2LCAA 3S02A 2N48A 2LBTA 2ZVZA 3OONA 3WPXA 4RHAA 3IMPA 3WPWA 4G4ZA 4G4XA 4ZHYB 4B5CA 2HQSC 2L26A 3LDTA 4G88A 4ERHA 2K1SA 3CYPB 2MQEA 3KHNA 3S03A 4ZHVA 5EB1B 1OAPA
chains in the Genus database with same CATH superfamily
5J2TA 3R0PA 4O4HA 3JALA 4C8GA 3HAXD 2OTJF 1W40A 1NJIH 1JFFA 5EAZA 3S06A 1W2BF 5LOVA 3F6MA 3MCAB 4BT7A 4I4TA 2N48A 2KTVA 4BY9D 2HRYA 3IKEA 3N4ZA 3RE3A 4ZHYB 5JCOA 2HQSC 2BTOA 2YYEA 3WGJA 3JAMM 5HY2A 3JAWB 3LWPC 3PAFA 4X20A 5ITZB 2H8EA 5CA0A 3F0DA 5EIBC 1W57A 5LA6B 3TD4A 3QTYA 3D01A 2QA4F 3HKBA 3BYQA 5JCOC 2Z1UA 5MN6A 2RHOA 2HRUA 3S02A 1NQ3A 2H6LA 4IHJB 3LYBA 2Z1TA 5C8YA 4C81A 4LNUB 3V3TA 1CLIA 2CHTA 3WPWA 4U3JB 3WJRA 4B5CA 3JASB 3LWVC 2H8CA 2CVLA 4X1YB 3L7QA 5EB1B 3RYIB 3M1XA 2RHHA 4FFBA 4R40B 2HS0A 2I6RA 4ZOLB 3JAWA 3GHZA 3RA6A 1VQVA 3ZP7A 1W41A 1Z5WA 5LA6A 3G6EF 2CZWA 2DT4A 4BVQA 1VQ6F 3AGKA 4EI9A 3WPXA 3E20B 3WGLA 1IV4A 5LXTB 5HXUA 1IV3A 1X7PA 1QVGF 1QVFF 4C8EA 2L26A 4IHJA 3N4YA 3VI6A 4LNUA 1X25A 3FD5A 1H47A 4U3JA 5IT9M 4I55B 2VGNA 1U3LA 2IQQA 5CB4A 3RYCB 3LWQC 5FNVB 1PXWA 3JASA 1SA0B 3GYQA 4X1YA 1GO1A 3RYIA 4B62A 2G9IA 2R751 3ZOPA 5EWRA 3TD3A 3CXCF 3PLAC 4ZOLA 5EYPA 4TUYB 3CCLF 3FD6A 1JD1A 3K12A 1TVKA 3C9RA 3CCSF 5EZYB 1SDSA 1W5BA 2OHWA 3LDTA 1KNJA 4F6RA 2K1SA 3G71F 3CCQF 5LXTA 3S0YA 1IPAA 3V4DA 3ESJA 3C9TA 3IEWA 4U39A 1CN7A 2VAMA 1QD9A 2OTMA 2HP3A 4I55A 5IJ0B 3Q8HA 3RYCA 2Z1FA 5FNVA 2Z01A 1VHAA 2W8BC 1SA0A 2LCAA 3O85A 3KJKA 1YJNF 2RB9A 3KE1A 3WXMB 2UYJA 3MBMA 1ZWZA 4TUYA 3VIUA 5BMVB 1JN1A 3KJJA 3GTZA 4I50A 5EZYA 3LFOA 3NK7A 5IJ9B 3CMAF 3JARA 3IKFA 2PHNA 2QI2A 2R6R1 2YXZA 3F0FA 3N2GB 1KQSF 3ZO8A 3SIVA 1YHQF 3MCQA 4ZHWA 4TV9B 5C8YB 5DCVA 1XBIA 2JNBA 5HP8A 1VQLF 1U40A 5IJ0A 1IV1A 4G4ZA 1XRGA 1FFXB 4FFBB 3VTIC 3FPIA 4ZI7B 5HY1A 3C9SA 5GAPK 2ZOVA 5BMVA 1W5EA 4DRXB 2HP0B 4X1KB 3K0TA 1XHOA 1W3EX 5IJ9A 2OTLF 3N2GA 1W581 2BO1A 3MDOA 3RYFB 1K9MH 1IV2A 2UYNB 4TV9A 1RA4A 1H7MA 5FJ4C 2CHSA 4WBNB 4ERHA 4X1IB 5CB4B 1E7KA 3B6NA 2RHJA 3F0EA 5GONB 3FBAA 3DC2A 1DBFA 1FFXA 4YJ3B 1YIJF 2P6YA 3S0WA 3ON1A 1RLUA 4O2BB 1VQ5F 4BVTA 3I3FA 2Q1YA 5EYPB 4ZI7A 4C82A 1RQ7A 4B46A 3CG6A 3ZP4A 3OW2F 4DRXA 2HP0A 2ZF8A 1TVKB 1Q7YH 2BTQB 4X1KA 1VQ8F 3HWUA 4NWOB 4O4JB 5JQGA 1VH8A 5HWEA 4EB6B 1YJWF 4F6RB 3DDNA 5GIOC 3V7EA 3WGNA 5GIPC 3RYFA 1X7OA 2UYNA 5AVMA 5KX5A 3S03A 4E6EA 4ZHVA 3HJWC 4WBNA 4G4WA 4EI8A 4X1IA 4KWEA 3VYSC 1T0AA 3M4SA 4X3LA 5GONA 2AIZP 3CC2F 4YJ3A 4YJ2B 2IAFA 2OZBA 3VYTC 3NVKE 1KC8H 2VAPA 4O2BA 1YI2F 3NVIB 3CPWF 5B8FA 2QEXF 1TUBB 2ZVZA 3G4SF 2UYPA 4RQOA 1H48A 4I50B 2PMPA 4O4JA 3HKDB 1W59A 3JCMM 2IG8A 4EB6A 3JARB 3C9UA 4TV8B 3VYUC 1QU9A 1VK3A 2Q1XA 3IEQA 3CPQA 3CCUF 3JATB 2KG4A 3SIUA 3P0ZA 3CC7F 5EO3A 1U3PA 2DYYA 1UFYA 3CYQA 4YJ2A 3MQWA 4M8IA 3T80A 3VOAA 1TUBA 1KD1H 3HKCB 1RLGA 5JH7B 3CD6F 2ZODA 1PF5A 1FNJA 1KNKA 3F0GA 2GZLA 3HKDA 1RQ2A 2KGWA 4IIJB 4TV8A 3RYHB 3OBYA 1Z5VA 2GLZA 3HTNA 2HVYD 3JATA 3CC4F 2UZHA 1YJ9F 5A2QM 3QHDA 1J7HA 4RHAA 2LBWA 5IYZB 2CSLA 2EWCA 4BT2A 3FFMA 3KIZA 1M90H 1K8AH 3RA5A 2BTUA 1SZQA 3HKCA 1COMA 5JH7A 1VQOF 1VQ7F 1Q86H 1CK2A 1GX1A 2HS3A 2V9YA 3OBWA 5EIBD 4ZK7A 2HX0A 3K2XA 5JQGB 5GANK 4IIJA 5JVDB 1QAHA 3JVHA 3RYHA 5KMGB 5KX5B 1Q8RA 4BT3A 5HY0A 3EORA 4G4XA 2VXYA 2RHLA 3M84A 3VOBA 5FLXM 3KHNA 5HP7A 3CCJF 2AMTA 1OAPA 1NMUB 5IYZA 3CB2A 4BVRA 1K73H 3I55F 1W5AA 3S0HA 4NUTA 3CCRF 3E22B 4G4VA 5CA1B 3QUWA 2Z1EA 1XV2A 2KTUA 2FGYA 3U0OA 1DT9A 3J80M 3J7AR 1ODEA 1Q81H 1T0KB 2VGMA 5JVDA 3CYPB 5G4UC 3JAKB 1VQKF 5KMGA 5GINC 1R1MA 1YQNA 3IR9A 3TD5A 4DXDA 4O2AB 4PWTA 5ITZA 4O4IB 2F9ZC 4NQ3A 1OFUA 5EB0A 3LMEA 5HY4A 5LP6B 2ZVYA 2I6DA 4BT5A 1JJ2F 3K14A 1M1KH 3ELCA 4O4LB 2LBTA 1Q82H 3E22A 3NMUC 5CA1A 4ZHQB 1VQMF 3CCMF 2ZAUA 3D00A 5J2UB 4BW0B 2HS4A 3VO8A 3D54A 1ONIA 4BT4A 3HKEB 3E1YA 1VQPF 3WJPA 3ERNA 4XCQA 3JAKA 3LWOC 3LWRC 1VQNF 4HNAB 1UI9A 1GO0A 1FSZA 2ALEA 3N2KB 3V7QA 5LYJB 2NMUA 3P10A 1U43A 4O2AA 3CCEF 4O4IA 1FNKA 3UT5B 5MN5A 3WJQA 3I56F 5MN4A 5LP6A 3I7TA 3VCZA 3CMEF 4TZZA 5J2TB 4LCKA 4O4LA 4G88A 1VQ4F 2CWJA 3JALB 4O4HB 2MQEA 2GVIA 3VMFB 4BT6A 3J81M 2UYKA 3CCVF 4ZHQA 3NK6A 1JFFB 4B45A 5J2UA 2WALA 5HXZA 5LOVB 4X3MA 5LP6C 4I4TB 3WGMA 4G4YA 1W55A 3HKEA 4C4WC 3C8LA 1W42A 1GZ0A 4EI7A 2AIFA 1W5FA 4HNAA 1JY8A 3OONA 1N8RH 1VQ9F 2CW4A 3N2KA 2FC3A 5LYJA 3IMPA 4X20B 4BVSA 3WGKA 1X52A 2QTPA 5CA0B 2LBXA 3UT5A 4C8IA 1S72F 1YITF 2VAWA 1YGYA 5G4VC 3P4EA 2B33A 3HKBB
chains in the Genus database with same CATH topology
1R1MA 2ZOVA 3S0WA 3TD5A 4R40B 4G4WA 4PWTA 3TD4A 3S0HA 2KGWA 2AIZP 5EB0A 4G4YA 4ZHWA 3S0YA 4B62A 4G4VA 2ZVYA 3TD3A 2ZF8A 5EAZA 3S06A 3CYQA 2W8BC 2LCAA 3S02A 2N48A 2LBTA 2ZVZA 3OONA 3WPXA 4RHAA 3IMPA 3WPWA 4G4ZA 4G4XA 4ZHYB 4B5CA 2HQSC 2L26A 3LDTA 4G88A 4ERHA 2K1SA 3CYPB 2MQEA 3KHNA 3S03A 4ZHVA 5EB1B 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1M A;  2ZOV A;  3S0W A;  3TD5 A;  4R40 B;  4G4W A;  4PWT A;  3TD4 A;  3S0H A;  2KGW A;  2AIZ P;  5EB0 A;  4G4Y A;  4ZHW A;  3S0Y A;  4B62 A;  4G4V A;  2ZVY A;  3TD3 A;  2ZF8 A;  5EAZ A;  3S06 A;  3CYQ A;  2W8B C;  2LCA A;  3S02 A;  2N48 A;  2LBT A;  2ZVZ A;  3OON A;  3WPX A;  4RHA A;  3IMP A;  3WPW A;  4G4Z A;  4G4X A;  4ZHY B;  4B5C A;  2HQS C;  2L26 A;  3LDT A;  4G88 A;  4ERH A;  2K1S A;  3CYP B;  2MQE A;  3KHN A;  3S03 A;  4ZHV A;  5EB1 B;  1OAP A; 
#chains in the Genus database with same CATH topology
 5J2T A;  3R0P A;  4O4H A;  3JAL A;  4C8G A;  3HAX D;  2OTJ F;  1W40 A;  1NJI H;  1JFF A;  5EAZ A;  3S06 A;  1W2B F;  5LOV A;  3F6M A;  3MCA B;  4BT7 A;  4I4T A;  2N48 A;  2KTV A;  4BY9 D;  2HRY A;  3IKE A;  3N4Z A;  3RE3 A;  4ZHY B;  5JCO A;  2HQS C;  2BTO A;  2YYE A;  3WGJ A;  3JAM M;  5HY2 A;  3JAW B;  3LWP C;  3PAF A;  4X20 A;  5ITZ B;  2H8E A;  5CA0 A;  3F0D A;  5EIB C;  1W57 A;  5LA6 B;  3TD4 A;  3QTY A;  3D01 A;  2QA4 F;  3HKB A;  3BYQ A;  5JCO C;  2Z1U A;  5MN6 A;  2RHO A;  2HRU A;  3S02 A;  1NQ3 A;  2H6L A;  4IHJ B;  3LYB A;  2Z1T A;  5C8Y A;  4C81 A;  4LNU B;  3V3T A;  1CLI A;  2CHT A;  3WPW A;  4U3J B;  3WJR A;  4B5C A;  3JAS B;  3LWV C;  2H8C A;  2CVL A;  4X1Y B;  3L7Q A;  5EB1 B;  3RYI B;  3M1X A;  2RHH A;  4FFB A;  4R40 B;  2HS0 A;  2I6R A;  4ZOL B;  3JAW A;  3GHZ A;  3RA6 A;  1VQV A;  3ZP7 A;  1W41 A;  1Z5W A;  5LA6 A;  3G6E F;  2CZW A;  2DT4 A;  4BVQ A;  1VQ6 F;  3AGK A;  4EI9 A;  3WPX A;  3E20 B;  3WGL A;  1IV4 A;  5LXT B;  5HXU A;  1IV3 A;  1X7P A;  1QVG F;  1QVF F;  4C8E A;  2L26 A;  4IHJ A;  3N4Y A;  3VI6 A;  4LNU A;  1X25 A;  3FD5 A;  1H47 A;  4U3J A;  5IT9 M;  4I55 B;  2VGN A;  1U3L A;  2IQQ A;  5CB4 A;  3RYC B;  3LWQ C;  5FNV B;  1PXW A;  3JAS A;  1SA0 B;  3GYQ A;  4X1Y A;  1GO1 A;  3RYI A;  4B62 A;  2G9I A;  2R75 1;  3ZOP A;  5EWR A;  3TD3 A;  3CXC F;  3PLA C;  4ZOL A;  5EYP A;  4TUY B;  3CCL F;  3FD6 A;  1JD1 A;  3K12 A;  1TVK A;  3C9R A;  3CCS F;  5EZY B;  1SDS A;  1W5B A;  2OHW A;  3LDT A;  1KNJ A;  4F6R A;  2K1S A;  3G71 F;  3CCQ F;  5LXT A;  3S0Y A;  1IPA A;  3V4D A;  3ESJ A;  3C9T A;  3IEW A;  4U39 A;  1CN7 A;  2VAM A;  1QD9 A;  2OTM A;  2HP3 A;  4I55 A;  5IJ0 B;  3Q8H A;  3RYC A;  2Z1F A;  5FNV A;  2Z01 A;  1VHA A;  2W8B C;  1SA0 A;  2LCA A;  3O85 A;  3KJK A;  1YJN F;  2RB9 A;  3KE1 A;  3WXM B;  2UYJ A;  3MBM A;  1ZWZ A;  4TUY A;  3VIU A;  5BMV B;  1JN1 A;  3KJJ A;  3GTZ A;  4I50 A;  5EZY A;  3LFO A;  3NK7 A;  5IJ9 B;  3CMA F;  3JAR A;  3IKF A;  2PHN A;  2QI2 A;  2R6R 1;  2YXZ A;  3F0F A;  3N2G B;  1KQS F;  3ZO8 A;  3SIV A;  1YHQ F;  3MCQ A;  4ZHW A;  4TV9 B;  5C8Y B;  5DCV A;  1XBI A;  2JNB A;  5HP8 A;  1VQL F;  1U40 A;  5IJ0 A;  1IV1 A;  4G4Z A;  1XRG A;  1FFX B;  4FFB B;  3VTI C;  3FPI A;  4ZI7 B;  5HY1 A;  3C9S A;  5GAP K;  2ZOV A;  5BMV A;  1W5E A;  4DRX B;  2HP0 B;  4X1K B;  3K0T A;  1XHO A;  1W3E X;  5IJ9 A;  2OTL F;  3N2G A;  1W58 1;  2BO1 A;  3MDO A;  3RYF B;  1K9M H;  1IV2 A;  2UYN B;  4TV9 A;  1RA4 A;  1H7M A;  5FJ4 C;  2CHS A;  4WBN B;  4ERH A;  4X1I B;  5CB4 B;  1E7K A;  3B6N A;  2RHJ A;  3F0E A;  5GON B;  3FBA A;  3DC2 A;  1DBF A;  1FFX A;  4YJ3 B;  1YIJ F;  2P6Y A;  3S0W A;  3ON1 A;  1RLU A;  4O2B B;  1VQ5 F;  4BVT A;  3I3F A;  2Q1Y A;  5EYP B;  4ZI7 A;  4C82 A;  1RQ7 A;  4B46 A;  3CG6 A;  3ZP4 A;  3OW2 F;  4DRX A;  2HP0 A;  2ZF8 A;  1TVK B;  1Q7Y H;  2BTQ B;  4X1K A;  1VQ8 F;  3HWU A;  4NWO B;  4O4J B;  5JQG A;  1VH8 A;  5HWE A;  4EB6 B;  1YJW F;  4F6R B;  3DDN A;  5GIO C;  3V7E A;  3WGN A;  5GIP C;  3RYF A;  1X7O A;  2UYN A;  5AVM A;  5KX5 A;  3S03 A;  4E6E A;  4ZHV A;  3HJW C;  4WBN A;  4G4W A;  4EI8 A;  4X1I A;  4KWE A;  3VYS C;  1T0A A;  3M4S A;  4X3L A;  5GON A;  2AIZ P;  3CC2 F;  4YJ3 A;  4YJ2 B;  2IAF A;  2OZB A;  3VYT C;  3NVK E;  1KC8 H;  2VAP A;  4O2B A;  1YI2 F;  3NVI B;  3CPW F;  5B8F A;  2QEX F;  1TUB B;  2ZVZ A;  3G4S F;  2UYP A;  4RQO A;  1H48 A;  4I50 B;  2PMP A;  4O4J A;  3HKD B;  1W59 A;  3JCM M;  2IG8 A;  4EB6 A;  3JAR B;  3C9U A;  4TV8 B;  3VYU C;  1QU9 A;  1VK3 A;  2Q1X A;  3IEQ A;  3CPQ A;  3CCU F;  3JAT B;  2KG4 A;  3SIU A;  3P0Z A;  3CC7 F;  5EO3 A;  1U3P A;  2DYY A;  1UFY A;  3CYQ A;  4YJ2 A;  3MQW A;  4M8I A;  3T80 A;  3VOA A;  1TUB A;  1KD1 H;  3HKC B;  1RLG A;  5JH7 B;  3CD6 F;  2ZOD A;  1PF5 A;  1FNJ A;  1KNK A;  3F0G A;  2GZL A;  3HKD A;  1RQ2 A;  2KGW A;  4IIJ B;  4TV8 A;  3RYH B;  3OBY A;  1Z5V A;  2GLZ A;  3HTN A;  2HVY D;  3JAT A;  3CC4 F;  2UZH A;  1YJ9 F;  5A2Q M;  3QHD A;  1J7H A;  4RHA A;  2LBW A;  5IYZ B;  2CSL A;  2EWC A;  4BT2 A;  3FFM A;  3KIZ A;  1M90 H;  1K8A H;  3RA5 A;  2BTU A;  1SZQ A;  3HKC A;  1COM A;  5JH7 A;  1VQO F;  1VQ7 F;  1Q86 H;  1CK2 A;  1GX1 A;  2HS3 A;  2V9Y A;  3OBW A;  5EIB D;  4ZK7 A;  2HX0 A;  3K2X A;  5JQG B;  5GAN K;  4IIJ A;  5JVD B;  1QAH A;  3JVH A;  3RYH A;  5KMG B;  5KX5 B;  1Q8R A;  4BT3 A;  5HY0 A;  3EOR A;  4G4X A;  2VXY A;  2RHL A;  3M84 A;  3VOB A;  5FLX M;  3KHN A;  5HP7 A;  3CCJ F;  2AMT A;  1OAP A;  1NMU B;  5IYZ A;  3CB2 A;  4BVR A;  1K73 H;  3I55 F;  1W5A A;  3S0H A;  4NUT A;  3CCR F;  3E22 B;  4G4V A;  5CA1 B;  3QUW A;  2Z1E A;  1XV2 A;  2KTU A;  2FGY A;  3U0O A;  1DT9 A;  3J80 M;  3J7A R;  1ODE A;  1Q81 H;  1T0K B;  2VGM A;  5JVD A;  3CYP B;  5G4U C;  3JAK B;  1VQK F;  5KMG A;  5GIN C;  1R1M A;  1YQN A;  3IR9 A;  3TD5 A;  4DXD A;  4O2A B;  4PWT A;  5ITZ A;  4O4I B;  2F9Z C;  4NQ3 A;  1OFU A;  5EB0 A;  3LME A;  5HY4 A;  5LP6 B;  2ZVY A;  2I6D A;  4BT5 A;  1JJ2 F;  3K14 A;  1M1K H;  3ELC A;  4O4L B;  2LBT A;  1Q82 H;  3E22 A;  3NMU C;  5CA1 A;  4ZHQ B;  1VQM F;  3CCM F;  2ZAU A;  3D00 A;  5J2U B;  4BW0 B;  2HS4 A;  3VO8 A;  3D54 A;  1ONI A;  4BT4 A;  3HKE B;  3E1Y A;  1VQP F;  3WJP A;  3ERN A;  4XCQ A;  3JAK A;  3LWO C;  3LWR C;  1VQN F;  4HNA B;  1UI9 A;  1GO0 A;  1FSZ A;  2ALE A;  3N2K B;  3V7Q A;  5LYJ B;  2NMU A;  3P10 A;  1U43 A;  4O2A A;  3CCE F;  4O4I A;  1FNK A;  3UT5 B;  5MN5 A;  3WJQ A;  3I56 F;  5MN4 A;  5LP6 A;  3I7T A;  3VCZ A;  3CME F;  4TZZ A;  5J2T B;  4LCK A;  4O4L A;  4G88 A;  1VQ4 F;  2CWJ A;  3JAL B;  4O4H B;  2MQE A;  2GVI A;  3VMF B;  4BT6 A;  3J81 M;  2UYK A;  3CCV F;  4ZHQ A;  3NK6 A;  1JFF B;  4B45 A;  5J2U A;  2WAL A;  5HXZ A;  5LOV B;  4X3M A;  5LP6 C;  4I4T B;  3WGM A;  4G4Y A;  1W55 A;  3HKE A;  4C4W C;  3C8L A;  1W42 A;  1GZ0 A;  4EI7 A;  2AIF A;  1W5F A;  4HNA A;  1JY8 A;  3OON A;  1N8R H;  1VQ9 F;  2CW4 A;  3N2K A;  2FC3 A;  5LYJ A;  3IMP A;  4X20 B;  4BVS A;  3WGK A;  1X52 A;  2QTP A;  5CA0 B;  2LBX A;  3UT5 A;  4C8I A;  1S72 F;  1YIT F;  2VAW A;  1YGY A;  5G4V C;  3P4E A;  2B33 A;  3HKB B; 
#chains in the Genus database with same CATH homology
 1R1M A;  2ZOV A;  3S0W A;  3TD5 A;  4R40 B;  4G4W A;  4PWT A;  3TD4 A;  3S0H A;  2KGW A;  2AIZ P;  5EB0 A;  4G4Y A;  4ZHW A;  3S0Y A;  4B62 A;  4G4V A;  2ZVY A;  3TD3 A;  2ZF8 A;  5EAZ A;  3S06 A;  3CYQ A;  2W8B C;  2LCA A;  3S02 A;  2N48 A;  2LBT A;  2ZVZ A;  3OON A;  3WPX A;  4RHA A;  3IMP A;  3WPW A;  4G4Z A;  4G4X A;  4ZHY B;  4B5C A;  2HQS C;  2L26 A;  3LDT A;  4G88 A;  4ERH A;  2K1S A;  3CYP B;  2MQE A;  3KHN A;  3S03 A;  4ZHV A;  5EB1 B;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...