2ZW3A

Structure of the connexin-26 gap junction channel at 3.5 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
216
structure length
201
Chain Sequence
b'DWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gap junction beta-2 protein
publication title Structure of the connexin 26 gap junction channel at 3.5 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 59
structure length 201
sequence length 216
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00029 Connexin Connexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.80 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Gap junction channel protein cysteine-rich domain 2zw3A00
2ZW3A
chains in the Genus database with same CATH superfamily
3KP9A 3P23A 4OAUC 3B55A 4O1PA 3FBVA 4Q9VA 2FU2A 4YZDA 2F6MB 4Z7GA 3VA9A 2XTRA 4NV2A 2GSCA 4DWLA 2KKMA 1W3SA 3DA4A 2RIOA 1U5KA 4JCVE 4AS3A 2FUG1 4HFVA 2E8GA 2IP6A 2JBWA 2A2DA 2F66B 2JB2A 2HGKA 2K19A 2A2CA 3LJ1A 2YFBA 4G76A 2JB1A 4Z7HA 2YFAA 4GXTA 3UITA 2QGMA 4NV5A 4YZ9A 2ETDA 3JSBA 2ZRRA 2MJFB 2FEFA 3LJ0A 3DA3A 3LJ2A 4PL5A 3AJFA 3I9V1 2V1CC 2ZW3A 2V6EA 4AS2A 3Q8DA 4OAVB 2XTQA 4PL4A 4U6RA 1YO7A 2RADA 2QSBA 2RLDA 3FVVA 5HGIA 4G75A 2BL7A 3SDJA 3FNBA 2L1LB 3IAS1 1TDPA 2JAEA 2BL8A 5LNK1 1JQOA 4PL3A 2QZGA 2P22B 3L0IA 4YZCA 4I1TA 3DO9A 4HEA1 2XMXA 3IAM1 2CAZB 4O1OA 3F4MA 1SJ8A 2JB3A
chains in the Genus database with same CATH topology
2ZW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW3 A; 
#chains in the Genus database with same CATH topology
 3KP9 A;  3P23 A;  4OAU C;  3B55 A;  4O1P A;  3FBV A;  4Q9V A;  2FU2 A;  4YZD A;  2F6M B;  4Z7G A;  3VA9 A;  2XTR A;  4NV2 A;  2GSC A;  4DWL A;  2KKM A;  1W3S A;  3DA4 A;  2RIO A;  1U5K A;  4JCV E;  4AS3 A;  2FUG 1;  4HFV A;  2E8G A;  2IP6 A;  2JBW A;  2A2D A;  2F66 B;  2JB2 A;  2HGK A;  2K19 A;  2A2C A;  3LJ1 A;  2YFB A;  4G76 A;  2JB1 A;  4Z7H A;  2YFA A;  4GXT A;  3UIT A;  2QGM A;  4NV5 A;  4YZ9 A;  2ETD A;  3JSB A;  2ZRR A;  2MJF B;  2FEF A;  3LJ0 A;  3DA3 A;  3LJ2 A;  4PL5 A;  3AJF A;  3I9V 1;  2V1C C;  2ZW3 A;  2V6E A;  4AS2 A;  3Q8D A;  4OAV B;  2XTQ A;  4PL4 A;  4U6R A;  1YO7 A;  2RAD A;  2QSB A;  2RLD A;  3FVV A;  5HGI A;  4G75 A;  2BL7 A;  3SDJ A;  3FNB A;  2L1L B;  3IAS 1;  1TDP A;  2JAE A;  2BL8 A;  5LNK 1;  1JQO A;  4PL3 A;  2QZG A;  2P22 B;  3L0I A;  4YZC A;  4I1T A;  3DO9 A;  4HEA 1;  2XMX A;  3IAM 1;  2CAZ B;  4O1O A;  3F4M A;  1SJ8 A;  2JB3 A; 
#chains in the Genus database with same CATH homology
 2ZW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...