The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
216
|
structure length |
201
|
Chain Sequence |
DWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Cell adhesion
|
molecule keywords |
Gap junction beta-2 protein
|
publication title |
Structure of the connexin 26 gap junction channel at 3.5 A resolution
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
59
|
structure length |
201
|
sequence length |
216
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2008-12-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00029 | Connexin | Connexin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | Gap junction channel protein cysteine-rich domain |
#chains in the Genus database with same CATH superfamily 2ZW3 A; #chains in the Genus database with same CATH topology 3VA9 A; 3DA3 A; 3FNB A; 2A2C A; 4NV5 A; 4G75 A; 2RAD A; 2BL8 A; 4O1O A; 2QGM A; 3I9V 1; 4GXT A; 4PL4 A; 1YO7 A; 2A2D A; 4DWL A; 2V1C C; 1TDP A; 2V6E A; 3P23 A; 2K19 A; 2L1L B; 2JAE A; 2YFA A; 2FEF A; 3UIT A; 4YZD A; 2HGK A; 4YZ9 A; 2JB2 A; 3LJ2 A; 4YZC A; 1SJ8 A; 2XTQ A; 2BL7 A; 4G76 A; 4HEA 1; 3AJF A; 3F4M A; 4PL3 A; 4Z7H A; 3IAS 1; 3LJ0 A; 4PL5 A; 4HFV A; 4I1T A; 3DA4 A; 4Q9V A; 3Q8D A; 2CAZ B; 1JQO A; 4AS2 A; 3LJ1 A; 3B55 A; 4AS3 A; 3KP9 A; 4O1P A; 2KKM A; 4JCV E; 2E8G A; 1U5K A; 4OAU C; 2RLD A; 3FVV A; 3IAM 1; 3L0I A; 2JB1 A; 3FBV A; 4OAV B; 4U6R A; 2FU2 A; 5LNK 1; 2FUG 1; 2F6M B; 2P22 B; 2MJF B; 2RIO A; 5HGI A; 1W3S A; 2ETD A; 2XTR A; 3SDJ A; 2GSC A; 4Z7G A; 2ZRR A; 2IP6 A; 2QSB A; 2F66 B; 2JBW A; 4NV2 A; 2QZG A; 2YFB A; 2JB3 A; 3DO9 A; 3JSB A; 2ZW3 A; 2XMX A; #chains in the Genus database with same CATH homology 2ZW3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...