2ZWEB

Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 40 minutes
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
77
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHDPVPTPRAAARAAVDELQGAPLLPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title Crystallographic evidence of drastic movement of a copper ion toward the substrate tyrosine for starting hydroxylation reaction of tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 77
sequence length 84
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zweB01
2ZMXB 2ZWFB 3AWWB 3AWYB 2ZMZB 2ZWEB 2ZWGB 3AWZB 2AHLB 3AWVB 1WX5B 2ZWDB 3AX0B 3AWTB 1WX2B 3AWUB 1WXCB 2ZMYB 2AHKB 1WX4B 3AWXB 3AWSB 2JV8A
chains in the Genus database with same CATH superfamily
4NB9A 4NBGA 1Z03A 2ZMXB 1Z02A 2ZWFB 4NBEA 4NBBA 3VMIA 3AWWB 1Z01A 3AWYB 2ZMZB 2ZWEB 2ZWGB 3AWZB 2AHLB 3AWVB 3VMHA 1WX5B 4NB8A 2ZWDB 3AX0B 3AWTB 4NBAA 4NBCA 1WX2B 3GCFA 3AWUB 4NBDA 1WXCB 2ZMYB 1WW9A 2DE7A 3GKQA 3VMGA 2DE5A 2AHKB 4NBHA 1WX4B 2DE6A 3AWXB 4NBFA 3AWSB 2JV8A
chains in the Genus database with same CATH topology
2ZMXB 2ZWFB 3AWWB 3AWYB 2ZMZB 2ZWEB 2ZWGB 3AWZB 2AHLB 3AWVB 1WX5B 2ZWDB 3AX0B 3AWTB 1WX2B 3AWUB 1WXCB 2ZMYB 2AHKB 1WX4B 3AWXB 3AWSB 2JV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMX B;  2ZWF B;  3AWW B;  3AWY B;  2ZMZ B;  2ZWE B;  2ZWG B;  3AWZ B;  2AHL B;  3AWV B;  1WX5 B;  2ZWD B;  3AX0 B;  3AWT B;  1WX2 B;  3AWU B;  1WXC B;  2ZMY B;  2AHK B;  1WX4 B;  3AWX B;  3AWS B;  2JV8 A; 
#chains in the Genus database with same CATH topology
 4NB9 A;  4NBG A;  1Z03 A;  2ZMX B;  1Z02 A;  2ZWF B;  4NBE A;  4NBB A;  3VMI A;  3AWW B;  1Z01 A;  3AWY B;  2ZMZ B;  2ZWE B;  2ZWG B;  3AWZ B;  2AHL B;  3AWV B;  3VMH A;  1WX5 B;  4NB8 A;  2ZWD B;  3AX0 B;  3AWT B;  4NBA A;  4NBC A;  1WX2 B;  3GCF A;  3AWU B;  4NBD A;  1WXC B;  2ZMY B;  1WW9 A;  2DE7 A;  3GKQ A;  3VMG A;  2DE5 A;  2AHK B;  4NBH A;  1WX4 B;  2DE6 A;  3AWX B;  4NBF A;  3AWS B;  2JV8 A; 
#chains in the Genus database with same CATH homology
 2ZMX B;  2ZWF B;  3AWW B;  3AWY B;  2ZMZ B;  2ZWE B;  2ZWG B;  3AWZ B;  2AHL B;  3AWV B;  1WX5 B;  2ZWD B;  3AX0 B;  3AWT B;  1WX2 B;  3AWU B;  1WXC B;  2ZMY B;  2AHK B;  1WX4 B;  3AWX B;  3AWS B;  2JV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...