2ZWEB

Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 40 minutes
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
77
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title Crystallographic evidence of drastic movement of a copper ion toward the substrate tyrosine for starting hydroxylation reaction of tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 77
sequence length 84
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zweB01
1WX2B 3AWVB 3AWXB 2AHKB 2AHLB 3AWYB 3AX0B 3AWWB 2ZMYB 1WX5B 3AWUB 2ZWDB 2ZWGB 3AWSB 1WXCB 3AWTB 2ZMXB 2ZWEB 2ZMZB 2JV8A 2ZWFB 3AWZB 1WX4B
chains in the Genus database with same CATH superfamily
1WX2B 3AWVB 3AWXB 4NB8A 3AWZB 3VMIA 2AHKB 2AHLB 3AWYB 4NBHA 4NBEA 1Z03A 3AX0B 3AWWB 2DE5A 4NB9A 4NBFA 1Z01A 4NBGA 3VMGA 1WW9A 1WX5B 3AWUB 4NBAA 2DE7A 4NBBA 2ZWDB 2ZWGB 3AWSB 1WXCB 3AWTB 4NBDA 4NBCA 2ZMXB 1WX4B 2ZWEB 3GKQA 3GCFA 2ZMZB 2DE6A 3VMHA 2JV8A 2ZWFB 2ZMYB 1Z02A
chains in the Genus database with same CATH topology
1WX2B 3AWVB 3AWXB 2AHKB 2AHLB 3AWYB 3AX0B 3AWWB 2ZMYB 1WX5B 3AWUB 2ZWDB 2ZWGB 3AWSB 1WXCB 3AWTB 2ZMXB 2ZWEB 2ZMZB 2JV8A 2ZWFB 3AWZB 1WX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX2 B;  3AWV B;  3AWX B;  2AHK B;  2AHL B;  3AWY B;  3AX0 B;  3AWW B;  2ZMY B;  1WX5 B;  3AWU B;  2ZWD B;  2ZWG B;  3AWS B;  1WXC B;  3AWT B;  2ZMX B;  2ZWE B;  2ZMZ B;  2JV8 A;  2ZWF B;  3AWZ B;  1WX4 B; 
#chains in the Genus database with same CATH topology
 1WX2 B;  3AWV B;  3AWX B;  4NB8 A;  3AWZ B;  3VMI A;  2AHK B;  2AHL B;  3AWY B;  4NBH A;  4NBE A;  1Z03 A;  3AX0 B;  3AWW B;  2DE5 A;  4NB9 A;  4NBF A;  1Z01 A;  4NBG A;  3VMG A;  1WW9 A;  1WX5 B;  3AWU B;  4NBA A;  2DE7 A;  4NBB A;  2ZWD B;  2ZWG B;  3AWS B;  1WXC B;  3AWT B;  4NBD A;  4NBC A;  2ZMX B;  1WX4 B;  2ZWE B;  3GKQ A;  3GCF A;  2ZMZ B;  2DE6 A;  3VMH A;  2JV8 A;  2ZWF B;  2ZMY B;  1Z02 A; 
#chains in the Genus database with same CATH homology
 1WX2 B;  3AWV B;  3AWX B;  2AHK B;  2AHL B;  3AWY B;  3AX0 B;  3AWW B;  2ZMY B;  1WX5 B;  3AWU B;  2ZWD B;  2ZWG B;  3AWS B;  1WXC B;  3AWT B;  2ZMX B;  2ZWE B;  2ZMZ B;  2JV8 A;  2ZWF B;  3AWZ B;  1WX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...