2ZWFB

Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 80 minutes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
71
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHDPVPTPRAAARAAVDELQGAPLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title Crystallographic evidence of drastic movement of a copper ion toward the substrate tyrosine for starting hydroxylation reaction of tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 15
structure length 71
sequence length 83
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zwfB01
1WXCB 1WX4B 3AWYB 3AWSB 2JV8A 1WX2B 3AWWB 2ZWEB 2ZWGB 2ZMYB 1WX5B 2AHKB 2ZWDB 3AWTB 3AWXB 3AX0B 2ZMZB 2ZMXB 2ZWFB 3AWUB 3AWZB 2AHLB 3AWVB
chains in the Genus database with same CATH superfamily
3VMHA 4NBFA 3VMGA 4NB9A 1WXCB 1Z02A 1WX4B 3AWYB 3AWSB 1Z01A 2JV8A 1WX2B 3GKQA 4NBAA 3AWWB 4NBHA 2ZWEB 1Z03A 1WW9A 2DE7A 2ZMYB 2ZWGB 4NB8A 4NBGA 4NBBA 1WX5B 2DE6A 4NBEA 2AHKB 2ZWDB 3AWTB 3VMIA 3AWXB 3AX0B 2ZMZB 2ZMXB 3GCFA 2ZWFB 3AWUB 3AWZB 2DE5A 2AHLB 4NBDA 4NBCA 3AWVB
chains in the Genus database with same CATH topology
1WXCB 1WX4B 3AWYB 3AWSB 2JV8A 1WX2B 3AWWB 2ZWEB 2ZWGB 2ZMYB 1WX5B 2AHKB 2ZWDB 3AWTB 3AWXB 3AX0B 2ZMZB 2ZMXB 2ZWFB 3AWUB 3AWZB 2AHLB 3AWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXC B;  1WX4 B;  3AWY B;  3AWS B;  2JV8 A;  1WX2 B;  3AWW B;  2ZWE B;  2ZWG B;  2ZMY B;  1WX5 B;  2AHK B;  2ZWD B;  3AWT B;  3AWX B;  3AX0 B;  2ZMZ B;  2ZMX B;  2ZWF B;  3AWU B;  3AWZ B;  2AHL B;  3AWV B; 
#chains in the Genus database with same CATH topology
 3VMH A;  4NBF A;  3VMG A;  4NB9 A;  1WXC B;  1Z02 A;  1WX4 B;  3AWY B;  3AWS B;  1Z01 A;  2JV8 A;  1WX2 B;  3GKQ A;  4NBA A;  3AWW B;  4NBH A;  2ZWE B;  1Z03 A;  1WW9 A;  2DE7 A;  2ZMY B;  2ZWG B;  4NB8 A;  4NBG A;  4NBB A;  1WX5 B;  2DE6 A;  4NBE A;  2AHK B;  2ZWD B;  3AWT B;  3VMI A;  3AWX B;  3AX0 B;  2ZMZ B;  2ZMX B;  3GCF A;  2ZWF B;  3AWU B;  3AWZ B;  2DE5 A;  2AHL B;  4NBD A;  4NBC A;  3AWV B; 
#chains in the Genus database with same CATH homology
 1WXC B;  1WX4 B;  3AWY B;  3AWS B;  2JV8 A;  1WX2 B;  3AWW B;  2ZWE B;  2ZWG B;  2ZMY B;  1WX5 B;  2AHK B;  2ZWD B;  3AWT B;  3AWX B;  3AX0 B;  2ZMZ B;  2ZMX B;  2ZWF B;  3AWU B;  3AWZ B;  2AHL B;  3AWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...