2ZWGB

Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 12 hours
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
71
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title Crystallographic evidence of drastic movement of a copper ion toward the substrate tyrosine for starting hydroxylation reaction of tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 71
sequence length 83
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zwgB01
2JV8A 2ZWGB 3AWWB 3AWYB 2ZMZB 2ZMYB 3AWVB 3AWZB 1WX5B 2AHLB 2ZMXB 2ZWFB 2ZWDB 2AHKB 1WX4B 2ZWEB 3AWXB 3AWUB 3AWTB 1WXCB 1WX2B 3AWSB 3AX0B
chains in the Genus database with same CATH superfamily
4NB8A 2DE6A 2JV8A 2ZWGB 4NBFA 4NBBA 3VMGA 4NBAA 3AWWB 3VMIA 3AWYB 2ZMZB 2ZMYB 1WW9A 3AWVB 3AWZB 1Z03A 1WX5B 2DE7A 2AHLB 3GCFA 4NBHA 2ZMXB 4NBGA 2ZWFB 2ZWDB 3VMHA 2DE5A 4NBDA 1WX4B 2AHKB 2ZWEB 3AWXB 3AWUB 3AWTB 4NBCA 1WXCB 4NB9A 1Z01A 3GKQA 1WX2B 1Z02A 3AWSB 4NBEA 3AX0B
chains in the Genus database with same CATH topology
2JV8A 2ZWGB 3AWWB 3AWYB 2ZMZB 2ZMYB 3AWVB 3AWZB 1WX5B 2AHLB 2ZMXB 2ZWFB 2ZWDB 2AHKB 1WX4B 2ZWEB 3AWXB 3AWUB 3AWTB 1WXCB 1WX2B 3AWSB 3AX0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV8 A;  2ZWG B;  3AWW B;  3AWY B;  2ZMZ B;  2ZMY B;  3AWV B;  3AWZ B;  1WX5 B;  2AHL B;  2ZMX B;  2ZWF B;  2ZWD B;  2AHK B;  1WX4 B;  2ZWE B;  3AWX B;  3AWU B;  3AWT B;  1WXC B;  1WX2 B;  3AWS B;  3AX0 B; 
#chains in the Genus database with same CATH topology
 4NB8 A;  2DE6 A;  2JV8 A;  2ZWG B;  4NBF A;  4NBB A;  3VMG A;  4NBA A;  3AWW B;  3VMI A;  3AWY B;  2ZMZ B;  2ZMY B;  1WW9 A;  3AWV B;  3AWZ B;  1Z03 A;  1WX5 B;  2DE7 A;  2AHL B;  3GCF A;  4NBH A;  2ZMX B;  4NBG A;  2ZWF B;  2ZWD B;  3VMH A;  2DE5 A;  4NBD A;  1WX4 B;  2AHK B;  2ZWE B;  3AWX B;  3AWU B;  3AWT B;  4NBC A;  1WXC B;  4NB9 A;  1Z01 A;  3GKQ A;  1WX2 B;  1Z02 A;  3AWS B;  4NBE A;  3AX0 B; 
#chains in the Genus database with same CATH homology
 2JV8 A;  2ZWG B;  3AWW B;  3AWY B;  2ZMZ B;  2ZMY B;  3AWV B;  3AWZ B;  1WX5 B;  2AHL B;  2ZMX B;  2ZWF B;  2ZWD B;  2AHK B;  1WX4 B;  2ZWE B;  3AWX B;  3AWU B;  3AWT B;  1WXC B;  1WX2 B;  3AWS B;  3AX0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...