2ZWLT

Human factor viia-tissue factor complexed with highly selective peptide inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor VII light chain
publication title Human factor viia-tissue factor complexed with highly selective peptide inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 43
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT02
3RGHA 4K9EH 4AT6B 3KPRE 3NIDF 2EE3A 1CDGA 3O41A 3NIDE 3GIVA 1YEEH 4OCSH 5H37G 5E1HB 3U9UB 4FFYL 1SJEA 2EE2A 3QDJD 4NRXB 1ORSB 3SBWC 2GY5A 3MRQB 5DQDL 2F74A 1B90A 4FTVA 4KV5E 1TETH 1UJTA 3STBA 3SE3C 1FJ1A 4NYLA 3ES6B 3TT1H 4U3CA 2QQNH 4PRBA 1L0XA 1JF5A 1XF5A 2WV3A 4DFIA 4LU5L 1EHXA 3ARDD 1T80A 1TJGL 5FEBA 1OAQH 1JTTA 1HZHL 4L4VD 2WZPD 1XGRA 2VQTA 4XWGH 4OLVH 5JNYB 3B3IB 3P9LB 1YNLL 3CPLB 3QUZC 5K9KA 4U1MB 4N9OB 3MV01 1JGVL 1UH2A 4LAQH 2GTWB 3KDMA 1KT2B 3GMNA 3L3HB 5E8OB 1RURL 2DQUH 1MI5A 4P5MA 4JFHE 5FDWB 3KYNB 3QQ4A 4XNYL 3SDAC 3A6BL 4R8WH 1H15B 1DEEB 4X4YB 2Q7NA 1X5AA 1QKZL 1RUPH 4WW2A 5J9PA 1A6UL 4XNXL 3AU1A 4NM4H 4FQ2L 3MLXL 5C09A 4BJLA 1LHZA 5E9DB 3RP1A 2VZVA 2GJZB 3TJEH 1IQWL 4PYGA 2R29L 4XCEA 2VLKB 4X8JA 3EUUA 3VXOB 2NY7L 5DD1L 3GSNA 3MJ8B 5I73C 3IDXH 4Y2DB 4GBXA 4QWWC 2H6PA 4I77L 4PJ5B 3TPKA 1UKQA 2XWTB 5HHME 3NA9L 1D6VL 2R0LL 1AQDB 4IMKA 1I9IH 3IXTA 3ULUD 5HPMA 2X7LA 3VXQB 4OQ1A 2A77L 1KB9K 2B1AH 4EVNB 3HC3L 1SEBB 4Y88A 3ZTNL 4X80L 1ZTXL 3CX5K 4RFNB 3KNBA 2X1XR 2EICA 5DFTA 3EHBC 3GSWB 4NQEB 1U8HA 5EORL 3TIEA 4FFWC 4YBLC 5CEYB 1LEKA 2WUCH 2V17H 4X6FB 1IC7L 2IEPA 4KKBC 5GS1B 1RJYA 1CXIA 2DKMA 2DQJL 3MRMA 1EXUB 1R3KB 4P2RA 4QY8B 4YDIH 2Y6SD 5BZWB 1QVOA 1IJ9A 1G0XA 3BUTA 1IAIM 3PWLB 2HMIC 1IGYA 1JNNL 1MCFA 3ARZA 4BSWB 2R1YB 5JA8B 4X6BA 2YSSB 5T5FH 1G9EA 3VA2C 1IAOA 3FFCB 1LEGB 4BFEA 5L9DL 3F7YB 4QOKA 4AENB 5JW4M 3EOYG 4JHZA 1QBLH 4ALAH 2HJKB 4KQ3H 3JSSA 4KHTL 3N1GC 4RIRB 1BM3L 5D5MB 4U4BA 2CUMA 1I4FA 2YWZA 4AK1A 3T77A 5IB1B 4OF7A 1ZKAA 1FNEA 4X98A 3QO0B 5DK3A 5BV7H 2YZ8A 4QRUA 4B0MM 2BNQA 5I71C 3I75B 2P7TB 1GOFA 4JKMA 4RAUA 2W0LA 2NY1B 1A47A 5FCSH 3FB5A 2AJUL 4AL8L 5J12B 1Z0NA 5H37H 1JYXA 1T0NB 2RCSL 3FKUS 4HPOL 3VI4F 5LGHH 5GGUB 1SQ2N 4J8RA 3VI4E 1A7PH 2LV4A 1OPGH 1NUFA 3FB6A 4XP4L 5CLTA 1B0RB 2GYSA 4BQ9A 1NGQL 1JHTB 1BMGA 1OLLA 4OUUA 3CH1A 5TE7L 1YYLH 5LGKA 3BZ4A 1DUZA 4ZUVB 3MNVB 1BFOB 3DXAB 3MUGB 4PGBB 2J8HA 3C60C 1L6ZA 3KXFB 3MCLL 1XCTB 4G6AD 4M6NL 4UTBH 3IKKA 1RJZA 4NZJA 3BP6B 3GMPB 4WIQA 1NFKA 5J4MA 2EIDA 1A4JB 1G9NC 4L8CB 3Q6FA 1DE4B 3LN4B 3RAJH 1HH9A 3BQUB 3CFEA 3SJVB 3CXHJ 5E8DL 3SGEI 4OLWL 1NGPL 1KV3A 1UG9A 4Z0XB 2YD5A 2ZUYA 5I16B 3HC4L 3DO7A 3NFSL 4DGYH 3ZZ1A 3V4UH 3EJZD 3KJ6H 5ERWB 1A6TB 4D0BA 1A1OB 1OWWA 3CH8A 4G6ML 2R4RL 1DQML 2VISA 3PJSB 1LQSR 3QAZB 3HG1D 5CUSH 3RX7A 1YN7A 3BDBA 3VXUB 3ULSB 3VFOA 3TO4B 1R5VB 3FCTB 1H8SA 4S1RH 1YN6B 3RY6A 3BISA 4FQIL 3V6OC 1BREA 3GIVB 4NO0B 3DX8A 1FNAA 1OAXH 3AAZA 4LLUA 1SJEB 1EVUA 1UCBL 2DQHH 4H8WC 4X4XA 3FT2A 4R7DB 4Y1AE 3O3DA 3STLA 4MA1B 1BEYH 1D9KC 1ZT7B 4WEMB 3LZFL 2NZ9D 5KANI 2W38A 2AJXH 4K94L 4PJ7B 1WWAX 4OI8A 3MA9H 4LSUH 2X1PA 1FJ1B 4WFFE 1DQTA 1UGNA 4S11A 4A6YB 3C6LA 3DMMD 2QHRL 3SKUD 1I3GL 4XC1L 1I7ZA 4NFBA 4MCYB 2X4SA 5K9QI 4RRPA 1N2RB 1C8PA 5HHOE 3MV7E 1CFQA 1FO0L 2BVYA 5B4MC 4YFEA 5D9SA 3WNKA 4Y4KA 3B9KC 5AWNH 5K9KB 3BZEA 3QHZH 4QRPA 3CVHH 1GH7A 2BVPB 3JWDL 2VWEE 3L3JA 4XX1E 3KDMB 4M00A 4DGVL 2VE6A 3GMNB 4X4ZA 1KF9B 4OJFH 3INUH 1J86A 1MI5B 1MRCH 3GRWL 3BEVB 3ARUA 3QQ4B 4IDLA 2C4FT 1BFTA 2X4RA 1LK3H 3P0VL 2NXZC 3WBDA 4E41A 4POZC 2FNBA 3B6SA 1LILA 5DUMH 2EDDA 4NZDA 3AU1B 3TBSA 4DVRH 4N5UA 4Q2ZA 4EN3C 3DYPA 4WWKD 5ITFB 3KPQA 5KOMC 1J5OH 1CI5A 2ZZUT 1BVKA 1CFVH 4GBXB 4LHUD 4NQDD 2H6PB 2ZG1A 2BY2A 1YEJH 1EHLH 3G04A 1QR4A 3P40A 3VXME 3I50L 3QP3A 2PYFA 1PZ5B 2ITCA 3IXTB 4JQIL 2X1WL 1PDKA 2WMPA 4PRHE 1UEYA 5TDNA 1U8PB 3WIIL 1A7OH 4JRXE 4MJIA 3KNBB 2KQMA 5IEKA 2EEAA 5IJVA 4WUUA 3TIEB 1LEKB 3AMLA 4JFOA 1NLBL 1QRNA 2X40A 1ZSDB 2MNUA 4JPWL 1RJYB 1SEQH 1NCCL 3QDMA 2ZJSH 4BK5A 1QVOB 4YR6B 5FYLE 4WNQB 5EOCH 3F5WA 4X6BB 2CMRH 3FT3A 4L4TE 1YECL 3M07A 2RGSA 5DDHA 43C9A 1F8TH 2K7PA 4GXVH 1RUMH 3QXDA 4ELMF 4ELME 4XVUD 4HAFA 3CC5A 3OGOE 5KVFL 3FRUA 5J1AA 3KPNB 3G9AB 2XKSA 4CW1A 4WI8A 4YXHH 2RAMA 5I2IA 5ICXA 5LCVH 5MI0B 1NMBL 1OGAD 2R0WL 3QDJE 2DJUA 3EOTH 4PS4L 4GW4B 2YA2A 3CLEL 4Y4FA 3IDIB 3HTLX 3HN3A 1HIMH 1FNEB 2OTPA 4P2OC 4QRUB 1HHKA 1UVQB 4JFYA 4LCIH 2BNQB 3RUGA 1ORQA 3E2HB 4FQXD 1AFVH 1IILE 2LFGA 3QDGD 1GZPA 1RUKL 1TVBB 5EN2A 3V8OA 3HE6A 2VXVL 3FB5B 1IQDA 4G6JL 4WFED 4JLRA 1WQVT 3SE4A 4KRPC 4J8RB 4GG6B 3RGVC 4RWYH 3B8SA 3QA3A 3RKPA 3OKDB 3OKMA 4JB9L 1UKSA 3DIFA 3SDDB 3FB6B 2HLAB 2WUBH 2G60H 4L4VE 3DUSA 3H7BA 4JKLA 4N68A 2KDGA 5L0QC 1J1OH 1DUZB 2ESVD 4NO5B 4RGNC 4RNRB 1RUQH 4MD4A 1FLRL 4RMVA 4I0PB 1SY6H 1MELA 1UENA 5D1ZA 5CJQL 5J3HC 2B1HH 3TNMA 3FL7A 1WFUA 4M6MH 4HH9A 1I7TA 4L3EB 5JORB 4ZTOH 7CGTA 1LDSA 2FBJL 5SWSA 1WBYA 2XN9D 5CSGA 3BFOA 1MJ8L 2ADIB 4JHAH 3O6ML 4QHKI 3Q6FB 4YE4H 4YHYC 4KJWC 1HH9B 3CFEB 3AS1A 4YHLL 3VDCA 5AAMA 3WJLA 3S34L 3UYPA 3VRJA 3REVA 3UTZB 3MV8B 3VXSA 4AMKH 4MA3A 5DUBB 4D3CL 2Z31D 5C86A 2EH8H 4UT6H 1PG7X 2UWEF 4LPVA 2FX8L 2UWEE 1MLBA 4PJ8D 2ZKHL 4D0BB 3ULUF 3AS2A 1WZ1L 3ULUE 2VISB 4NN5C 1YN7B 4R4NC 1I1AD 3PWPB 2VDNL 5MENA 4LIQE 3O11A 1FBIL 1LO0H 3O9WC 4JREB 4WO4D 1W72B 4XXCC 4P5TD 3L95B 5DJ8B 3DX8B 4V2CB 4KDVA 4LLUB 5EUOB 2X4PA 1N26A 4X4XB 3FT2B 1NBVH 2HJFB 3S36L 2ORBL 5HVFB 3O3DB 2QQLL 5C0FA 3STLB 4QXGL 3CDGB 1IT9H 1NCNA 5ISZB 2IFFH 4OGAD 2NXYD 1IGIL 5DK2B 3R06A 4QF1A 2BY1A 3OBAA 4ZFGH 3NIFF 4ZPTA 1N64L 1T2XA 5EIVA 3W2DH 4PBVC 3BH8B 1I7ZB 3GSVA 4N8CL 1N6QL 2X4SB 4LLDA 1A1MB 5L8JB 5DD5L 3V7MA 3PQYB 2A0LD 1CFQB 3FRPG 3UP1A 4HT1L 5D9SB 1I3UA 4Y4KB 4NKOA 1CDIA 3BZEB 2XKNB 1QSEB 3NPSB 3PABB 2ZSVA 3ZDXF 1DEDA 2JJSA 3ZDXE 4NC1E 3MLWH 4PFEA 4HBQA 4QYOA 3LS5H 3P4OA 3E3QC 3F7VB 1NMCC 4YBLB 3PV6B 1E6OL 4W6WB 2DBLL 1S7TB 3BD4A 5J6GA 3PXHA 2YD3A 2X4RB 3O6FA 2EE6A 3RKDC 3IYLW 4E41B 3FQNA 4O00A 3B6SB 3EKCA 4V2BA 1H3UA 3SGJC 1E4XH 3K8MA 3PGFH 2FB4H 5GXBB 3SEPA 1BVKB 4WGWB 4ZTPL 1AGEA 1HHGA 4P48A 3EFDH 4DOHE 2XQYK 4JFFD 2VL5A 3KS0H 4O51A 4C54A 2A9ML 2EIBA 2VQUA 4HCRL 5EOTA 1CYGA 3FQWB 1C16A 4IRJA 4NQVB 5JXEA 4FOMA 4LSVL 5E1AA 2I9TA 3U6RB 3RU8H 4MJIB 3VH8A 1R3JA 5IKCA 4PJEF 4R2GD 4PJHB 5I71B 3WNNA 1QBMH 1ND0A 4JFOB 4A2LA 4M8QA 4PRNA 1AO7A 1D5MA 3T3MF 3VMPA 4F7CA 5MEPA 3QCVH 4YQXL 3T3ME 1MJUH 3KWWA 4HQQH 3DUUB 1IRAY 3QDMB 4JQVA 4GFTB 3E6FA 4ZQKA 5SX4I 2AERT 4O58L 4LVOC 3HLAA 4HULB 5DTFB 2AXJA 1KBGH 1JRHL 5DLMH 3FOLA 3HG1E 1BLNA 5I1IH 3RVXD 3HB3D 5DDHB 2ADJB 1A6PA 3QXDB 4RX4A 2V2TA 1OQXA 4W70A 3Q5OA 5T1LD 3OKEB 1KXQE 3CC5B 5KS9F 3FJTA 1LP9F 4U1SA 3FRUB 4R7NA 5KS9E 1LP9E 1AD0B 5I2IB 1MFCH 4LDEB 4IOIB 3UTTA 5ICXB 2PO6A 3KR3L 4AQ1B 2J6EH 3K3QA 5ESVA 3TM6A 1XGUA 2W0PA 3C60B 1MQKH 3LIZH 4WGVB 4OLYH 2EECA 3VWKC 1YUHB 4Y4FB 4Z8FL 4EBQH 1DJSA 4JY5H 4PJBF 3S4SB 2MHAB 1HHKB 1TIUA 4PJBE 2X70B 4JFYB 1QFHA 1TJIL 4CADB 1T2JA 4BUHA 4GQ9H 5CBEB 1OARL 5H35A 2ZNWA 5CP7A 3HE6B 4FA8A 2CLVA 3MJ9A 4HV8A 1OWRM 4OLEA 3KJ4C 3RVVD 1DSFH 1LMKA 1PFCA 5GJSH 3QA3B 2EXYD 3QWOA 4XP6L 5H2BA 3OKMB 1WWWX 4Q6IA 5DI8A 4EQ2A 1RZ8A 3RL2A 4L8SA 2BJML 3DUSB 3H7BB 3MODH 1Q1JH 3H9YA 3O2DL 4WCYL 1FIEA 3L1OL 1T7YA 3IS1X 1XMWA 5L88H 1LEIA 1UWGH 4K2UL 3WKNA 4NO3B 2EXWC 5TE4L 3TNMB 1AR2A 4MCZA 3NCJL 5JPMA 3MRDA 4HIEA 4CU6A 1IM3B 1YEFL 4PPTA 4FQJH 4PUBL 4HWBH 5SWSB 1WBYB 1A14H 4K9EL 4GRWE 3P2TA 3HZVA 1J1PH 1CICA 3TF7C 1HYSD 2Q76B 1IVLA 5BS0B 3ARFD 4QKXB 1X6NA 1D9KB 3GKZA 1ADQH 4PRAB 1R24B 3IF1B 4K7PY 3VRJB 4HG4K 2EYSB 1KLUA 4NQDE 5KVMC 4MA3B 1TETL 3GSQB 3GI8H 2PNDA 3QJHB 3G6JA 4K94C 4WEUD 3UJJL 5FUZL 2QQNL 3E1F1 4LOUC 5ETUA 1XF4A 5AZ2H 4E9LA 3T0ED 4WHTA 4LNVA 5EU3A 5I1EL 5MENB 3KPSE 1OAQL 3UBXB 3O11B 5D7KD 1ITCA 1CGYA 4XWGL 4NJ9L 4OLVL 5E2UH 5EC2A 3FOMA 4WY7H 2IBBA 1TCRA 2X4PB 3FFDA 3FO2A 1FV1B 2FEDD 1HHJB 4LAQL 3L5XL 5JTWA 5EBWB 4OI9A 4RFOH 3JWDC 3NMEA 1CD1B 3NCBB 2NXZB 4R8WL 4PJCA 2IG2H 1XFPA 4QXTA 4GJTB 5EU6A 4R4FL 3R06B 2CK0H 1WFTA 4R4BA 4ZPTB 1NQBA 5DJZA 3W39A 4EN3B 2E3VA 4LQFH 4NM4L 4U1HA 4AIOA 5LG1A 3MRPB 2GHWB 3GSVB 3EGSB 1U3HC 2FX7H 1OGAE 2VDKL 5E6IC 1X6LA 3G5VB 4I13B 3IDXL 4LLDB 5HHNA 1HKLH 4X4ME 2B5IB 4H20H 2W9EH 4K7PH 1VADA 3I6GA 4XB8A 1KCUH 3TJHD 1I85A 4P9HH 4Y19A 2BNRD 3MUZ1 1I9IL 3QDGE 1V8HA 1S9WA 3GMMA 1I9EA 2B1AL 5EU7C 5INDB 1XIWC 4QYOB 4WFEE 2VYRE 2XRAH 3P4OB 1YZZA 5DQ9B 1INQB 2VZTA 1VESA 1CBVH 3OR6A 2D31B 1H5BC 3FTGA 5D2NE 4ZODA 4KK9D 4EIZC 3K4DA 2WUCL 4M6AA 2F5BH 3O6FB 5D7IF 4QNPF 3L3IB 5D7IE 4QNPE 3PP3H 1QO3A 4YDIL 1K5NA 1WK0A 4RMTA 4C57C 5HGDA 1KJMA 5JXED 5DD0H 2ESVE 1IFHL 4F8QA 1A02N 5KAQF 5T5FL 5CEZD 4PJGA 2OXGA 1AGEB 43CAA 3KHOA 1HHGB 1JNHA 4YFLF 4HKXA 2DJ4A 1QBLL 3FO9A 2R0ZH 4ALAL 2MCPL 4OM0L 4KQ3L 9CGTA 5JMRA 4ODUA 2G5BA 1RFDL 4OAWB 1B88A 3D85A 2XN9E 5H94B 5J11C 4TQEL 5MERA 3L3OA 1FRGL 4QEGA 3T8XA 4Y7MA 4ZO9A 5FO7A 3WFHA 2I9TB 2NY5H 1IAIL 2ZCHH 3Q5YA 5DEGA 4P2OB 3CSBA 1NGYA 5BV7L 5TQ0H 4M61B 1ND0B 4PRNB 5MEPB 1D5MB 5A16B 1N7MH 4F7CB 2EEDA 3KWWB 4B5EA 1QFUH 4JGJA 2M2DA 4ZQKB 1JJUA 3MUY1 2CKBL 5K93A 2P49B 1H8NA 3HLAB 2BHYA 4HUUA 3HUJF 2KUTA 5F1SA 5LGHL 1ZGLB 3HUJE 1BLNB 1QNZH 3HFMH 1OPGL 5HXMA 4MD5B 2V2TB 3X11A 4MVBD 2HFEA 5CZXD 5L0QB 4RGNB 2R0KH 3RZCA 4CAGA 4PGDB 5ADPH 3PE9A 5ESVB 1XGUB 1BQHG 1T1YB 5DRZB 5HI3C 1N6UA 4NDMA 2AKRA 4UTBL 3VGDA 1ZE3C 4ZUWA 5LAXA 1ZAGA 4S2SA 3RIFK 1F58H 1NDMA 3DJ9A 5EO1A 2Z93B 1FCCA 2QADB 4KQ4H 1T0PB 4OFIA 4NNYB 5C0BD 4JY4B 5KVGH 4WUKL 4PBWD 3DURA 1TENA 2RFXA 1OAUL 3OKLA 4HV8B 1DQQB 4I3SH 4OCXH 1MCPH 3AMKA 4TTDC 5E8PB 5GGRA 5A1AA 1QYGH 3PIQA 2B0SH 3WDIA 3TBWA 3K4AA 3NACL 3PP3K 2HT4C 3WNOA 4ZS7L 4DGYL 5KZCB 3TZVA 1IAII 3KPOA 3BIAX 3V4UL 3KJ6L 2EKSA 4MLIA 1ZT1B 4Q0XH 1LEIB 1JMXA 5I0ZA 5JZ7D 1MCSA 5JPMB 4X99A 3MRDB 3O9WB 1J12A 1I7UB 2OJEB 3JTSA 4JGMA 4S1RL 3UROR 2HFGL 4RGOH 4OF8A 5BVJA 4HJGA 4JKPL 1CICB 2X09A 5IJKA 4LLYB 4NRYB 1M05B 1KNOB 2A9NH 2IFGA 1FHGA 2DQHL 1T21A 3VJ6B 4C55A 4XPBH 3A6CH 4RAHA 5EG6C 1Q38A 4I8DA 1HXYA 1V3LA 1BEYL 4J3OC 1KLUB 4Y5VC 3B5HA 3LCYA 2UY7A 2QKIB 4HXAL 4LMQE 1EEYA 2OR9H 1T2QH 3UAJD 3T0WA 1K2DA 4JFFE 3MA9L 4LSUL 1YEIL 5DVLA 3BN9D 2OP4L 3DYOA 5IB2A 1AHWC 3R0NA 5ETUB 3IJSB 5CSZB 4XCFH 3ARWA 1EMTH 1S8DB 3VXRA 2FWOA 4WI7A 5EU3B 3QI9C 5FA4A 4C56D 4KKCC 1AXSB 5IIEA 3QISA 4K23H 3MLVL 4Y5XA 3FOMB 4OCYH 2W0FB 2EC9T 4JN2A 1NGWB 5F7WC 3VFTB 1TCRB 1XIWA 1V7MH 3FO2B 1I8MA 5AYUH 3WJJA 1NMCB 3JTTB 4BUGA 1AKJA 1M7IA 1QA9B 4OJFL 3INUL 5J1TC 1FE8H 1R3IH 1FORL 1RZGB 3CIQA 3QIWD 4FFVD 3RA7L 1IEAA 2GTZA 5C0EA 5FUOL 5D8JH 1NCUA 4ZD3H 4LDOB 4LFHD 4OGXH 4P2CG 4QHMA 3QPQC 3TA3C 3S96A 1F3DH 5C6PB 2ZUSA 4PJIF 2CXGA 4JPKH 1IAKB 3IDGB 4PJIE 2EC8A 4PJ9D 2IADB 3FQUB 3BRFA 1NUDA 3QFDA 4LKXA 5HI5D 3QG6A 1HKFA 1YEJL 4PLOB 4PB9H 4ZAKA 3I6GB 1U3ZA 4FQ1H 4DW2H 2D0FA 4BA8A 4F7TB 4E0RA 5LBSH 1LE5B 3EO9H 2G9HB 4MAUL 3OR6B 2W60A 1A9BA 1U8OB 3RVTD 2VJXA 1JP5A 3LRGA 3RZWA 4XH2A 2FIKA 4OF6A 1MFAH 5I1JH 4JHWH 1UCTA 4LPYA 1NL0H 2BXZA 4DUVA 1K5NB 4LVOB 2HRLA 1EJOL 4N9GA 1KJMB 4TSCH 4XGZA 3VDBA 3MBED 3BH9B 5EOCL 1GVIA 1A7NH 1MAMH 4WFGD 4F3FA 5T3XD 4PJGB 2VLKD 1IEHA 4UOJA 1JNHB 4XAKD 1F8TL 4Y2DD 4GXVL 1RUML 3FO9B 4IHOA 4XVJH 1MSPA 1BJ1H 5TGBB 4GAJH 2E5EA 4YXHL 3MRRB 4ZS6D 2PYEA 3L3OB 4PD4J 2V5RA 1R5WA 5FXCH 1U8LA 2VDPH 5FO7B 3VWKB 1FPTL 3O4LA 3V52L 2IBZX 5DEGB 3P9WB 2VDRH 1AH1A 1CXLA 5GGSY 2BVQB 3CUPA 3EOTL 1NGYB 4WEBH 1HIML 3OKKA 3HS0A 4LRIA 1T66C 4LCIL 4NQED 1RJLA 1QTYT 1AFVL 4FQCL 4PRDA 4APQC 4KDTA 1KB5L 3GK8L 4GMTH 3ESVF 1QSVA 4OCLC 3OWEA 4K07A 4EI5A 3QEQD 1PX3A 4QCIA 4I5BA 1L6XA 4RWYL 1PLGH 3T0EE 2CIKA 1KC5H 3P0GB 3U83A 3CCHB 2G60L 1NCWH 2QSQA 5D7KE 4ZXBA 5C70A 5ID1A 3RZCB 3SDXF 1OM3H 3SDXE 4ENED 1J1OL 4U2YA 1INEH 1RUQL 4NUGH 5EBLA 4L8BA 4JFXA 3I3DA 2CDGA 2X05A 1SY6L 4UQ3A 1KJVA 3QUYD 2VN4A 2Y5TA 4PRPD 3MRLA 2AKRB 4NDMB 4ZUWB 2QJDA 4RGMB 2Q1EA 1D5IH 3T08A 4YIQA 1CN4A 4D0DA 5JHDA 1T4KA 1JBJA 2Y06H 4X6EB 5F3BA 4GS7B 3HMWH 2NY1D 2ZP0T 4R3SA 5GGRB 1FGVH 4WTZG 3PIQB 4CMHB 2V7HB 4IJ3B 4LHUG 3TH4T 4AMKL 4Y4HC 2BMKB 4Y8AA 3VGEA 2EH8L 1RZ7L 4UT6L 4P23A 4L5FH 3KPOB 3S5LB 2BNRE 2AV7A 3ARBC 2M1KA 1I8LC 4YHIA 3BPCA 5DGRA 3MXWH 3L5WB 2FBOJ 4X99B 3C8KA 2AXHA 3O8XC 4P0DA 3JTSB 4R9HA 3SKOB 1LO0L 4U1IA 1FO0B 5BVJB 1QFOA 4HJGB 2A2QT 1EO8H 5D6CA 5BRZA 4N0RA 2CR3A 4P4KC 4YDVB 4Z77A 3GFUA 3UPRA 35C8L 4M5ZH 1NBVL 1DBJH 2XFXA 1HXYB 2DM4A 3GBNH 4G6FB 3BQUD 4KZEL 2ZSWA 1GGBH 5CEZE 1U8KA 4O5LL 1IT9L 3LRSB 2DQDL 2HRPH 2IFFL 4YGVA 5DJXA 3HZYA 3I2CH 3STZB 4YH6A 3BKYH 3E8UH 2IPUG 4AEHL 4YK4C 4ZFGL 1K2DB 4Y89A 2XWJA 3R8QA 1E4KC 3VFWA 3W2DL 3RX5A 3V4VH 1MJJA 4PY8I 5J89A 1KEGH 1CQKA 1XGTB 3VXRB 3LKOB 1S9VA 3TO4D 5FA4B 5C0CA 4DGIH 2H8PA 5DMKB 2GY7B 1IEBA 1G6RH 3NABH 4JN2B 4NO0D 1XIWB 4LPTA 3KYAA 3MLWL 3M45A 1I3RB 3C5ZC 1AKJB 1LE9B 1T5WB 4QHKJ 1M7IB 3QCTL 2QHLA 1H5BB 5HHVH 3P0YL 1H3VA 3RQ3A 2A6KA 3CSYA 2VXSH 4CU8A 1LO4H 1AQKH 3G6AB 2E7CA 2GTZB 3GHBH 5HYJB 2P8PA 4K3DH 4AYFA 1G7IA 3P77B 4P3CL 3S97C 3V9FA 4JY6A 5F1NA 2V5YA 4QHMB 4O02H 4OD1L 4HJ0C 1HHHB 2AK4A 1YJDH 3ZT7A 5JR1H 2FSEB 4JE4B 4OZGA 4MA8H 3C6SA 5CGYD 4YHMH 3D25B 1FVEB 5E94B 4UUJA 5D1XC 3PGFL 2FB4L 5A2FA 3QFDB 2JIXA 5EO9A 1XGQA 3QCUH 1FG9C 1ES0A 2DJSA 4QRRB 4ZAKB 3EFDL 4OIBA 5J11B 3U46A 1JHLL 4Z7VB 2GKIA 1IGCL 2FR4A 4GKSA 1CGTA 4PV9A 5D72H 3U7YH 4KH2A 4E0RB 4MNQA 1ZA6B 5C0BE 1MFDH 5JA9A 2I9LA 4KFZC 3RU8L 4JM4H 2DLIA 1HCFX 2W60B 3Q1SH 1AGFA 1A9BB 1SVZA 1AC6A 1F00I 2EDQA 5IBTH 2NPLX 2XTJE 2IGFL 1QBML 1TQBC 4R96A 5EU5A 5GZND 3L7EB 2G75A 4HKBB 4XH2B 3GSNH 5E8NB 1CFSA 3QCVL 3CZJA 3UMTA 4PGJA 4ZG1A 5BV7C 1MJUL 1GGCH 4HQQL 4ODHH 4GRWH 3CFCH 5I0DA 3LY6A 4N9GB 4XGZB 5HD8C 4M48H 1GJIA 3BI9X 3SKNB 4F3FB 4YXKH 4JM2A 4KGLA 3WLBB 3QIUA 3WE6A 5I1IL 2Q6WA 2L4OA 4NKIH 4IHOB 2NYYD 1HQ4A 3P9MB 5DJ6A 4NQXA 3UDWC 1EIBA 4WDIA 3O45B 1MFCL 2D9QB 2PYEB 2VR4A 4Z0BH 3WIHA 2PW1A 3CDCA 3OQ3B 1FNSH 3BGAA 1MQKL 3LIZL 4OTXH 4OLYL 1AJ7H 3CUPB 5FOJA 2DL9A 4EBQL 3BWAA 4JY5L 4MZ3A 3HS0B 5GGTA 2FLBT 2W9DL 4AEIL 4GG8A 2OJZH 3VCLA 4PRDB 1TVHA 3OKYA 1HK6A 3GMOA 4U6HB 5I17A 4PG2C 2BDNH 4WTWA 3DV6B 1HDMA 4X9IA 1WEJH 4JRYB 4EI5B 1CE6A 2AJYL 4MAYD 4I5BB 3ZT5A 3PWUA 3PDOB 1HWGB 3VD9A 3NAAH 1QLRA 3EDDA 2DYPB 3QQ3A 3SO3C 4ZXBB 4C56E 3MFFB 5K9OA 4XWOD 3MODL 1Q1JL 5ID1B 4ODVH 3LEXA 1QSFB 1T83C 4BQ6A 1HSBB 5CP3H 2CLZA 4CMMA 5L88L 5EBLB 3PWJA 4NWTH 3NOIA 3QZWA 4JFXB 4L8BB 1JWSA 2CDGB 4P3DB 1JVKA 1HNFA 2HVKA 4KVCH 1KJVB 4Z18A 2Y5TB 3MRLB 2OR8A 2O61B 2F8OA 1PY9A 2CRMA 5DHVB 3UTSD 5JHDB 2R1WA 4UDUA 1P6AB 4X6DE 1YDPA 3D39A 3V6FA 4MS8C 2EYTA 3RWHB 4QXUH 2J12B 4R3SB 3MGTA 4JJ5A 4MWFA 3VGBA 5BZDB 3VFUA 1ADQL 1P5UA 5IB3B 2XY1A 2EDKA 5FA3A 3I84A 1ROWA 3WUWA 1NCAL 4LCWD 4WU7A 3OZ9L 3N85H 3I85A 3SDDD 4F9LA 2VKWA 2AEQL 3VFVA 2WIIA 5F9WC 2X5PA 1AHWB 5HYFA 3PL6A 2AV7B 1A3RH 5IROC 4YX2L 5IW6A 4NJAH 3PG2A 5AZ2L 25C8H 3TFKD 4UT9H 5B39G 4I0PD 3QI9B 3HE7A 1OAKH 4UINH 3C8KB 1NUNB 4XNZB 1F6AB 1QG3A 2WWKT 1ZHNB 4EI6B 4L3ED 4H0IA 4XPAH 1ZHKB 4U1IB 3AFLA 5E2UL 4O4YH 5D6CB 4XP5H 5D7LB 5HGBA 2HLFC 4P2QD 3U36B 2XT1B 3MSPA 1MHEA 5CKGA 1YMHA 3UPRB 3VWJA 4X9BA 4OF0A 4YLQT 2XFXB 3DOSA 4BH7A 1ZVHA 4S10A 1A6WL 4N0UB 1BFVL 3WXVH 5T3XE 2E6JA 2VLKE 1CR9H 5DJXB 2P24A 3HZYB 1LGVA 3ARGA 3DETD 2RBLA 4HUWA 3MV8D 4XAKE 2HTKC 2IG2L 1OP3H 1FAIH 2QQQA 4PJ5E 1BAFH 1HEZA 3ARQA 3ZKXC 5T1MB 3QSKB 4MB3A 4NT6A 4YFDB 1U58A 1XF1A 1MJJB 4LBEA 4G7YH 2Y9RT 3MRHA 3P4NA 4AJ0A 3S35H 1Y18A 3EO1A 4CKVX 3PWPD 5C0CB 1RQ5A 3TV3H 2FJHA 1PJ9A 3GSXA 1KCUL 3QUZD 4NQEE 4PJFA 3RWJA 4P9HL 2WLZA 1NEZA 1KELH 2IPUK 5IVXA 4UAOC 1F4XH 2VXQL 2G5RA 5C2BH 3BPOC 1K6QH 3GKWH 3SKMA 2HWZH 1F4HA 2XRAL 3QEQE 2A6KB 1VFOA 1CBVL 5ACLA 3QWRD 3MLZL 1DL7H 3SDAD 1J0KA 2GSIB 4DZBA 4XPFH 5ISZD 4BM7A 2E7MA 1DUYA 2F5BL 2F54B 5F1NB 3OR7A 4JFQB 2Z91B 3A6OA 5C08B 4KUCD 1B0WA 2AK4B 1RZFL 5CWSA 2ZUUA 1FZMB 5D5MF 1X5JA 2C1PA 2YR3A 5JIPA 3A67H 5D5ME 3KGRA 1XGQB 1ES0B 1YMMB 3IDYB 4G43A 3T2QA 4PJXA 3ZYOA 4PRPE 3N1PC 3IFLH 2R0ZL 2R69H 2VSDA 3PQYD 2LTQB 3AXLA 5C7XH 2ADGA 3D69B 4GKSB 1VERA 5ACMA 4PV9B 4OZFG 2MMXA 1QSED 4MNQB 3MNZB 1EJ6A 2GI7A 1ZHBA 2W0KA 3WXWH 1NAMH 2XICA 1A2YB 3VU2A 4LKCA 4UIKH 1DVFC 3EHBD 1FP5A 3F58H 4MQ7B 1AGFB 2IAND 2V2WA 5GJTL 4FFWD 2WLYA 3U79A 2GJJA 5F3HA 5EU5B 1FG2A 4KKBD 3SOBH 2KPNA 1ACYH 1GRWA 5E5MA 1QFUL 5ALBH 2C4XA 4J4PA 2HMID 2NR6C 1KB9J 3TN0C 1UH3A 4KDWA 4OKVA 4PREB 4QXWA 5CJBA 3QIUB 3HFML 2Q6WB 1ETZA 3DXAE 5DMIH 1U41A 2I25N 1OP3K 3OXSA 2VOTA 3KXFE 3M17A 4NQXB 4XI5C 2AXGA 2R0KL 5ENWA 3ZO0A 3ILQD 1RHHA 1CGWA 3D0VB 5ADPL 5IMLA 2PW1B 4EOWH 3QNYB 1VCAA 1RULH 4OIIL 2NLJB 1IGTA 3BWAB 5C71A 3QEHA 1DBKH 1KXTB 4GG8B 1PZUB 1KUMA 4JGUA 1L0QA 1F58L 1J0YA 3KYOA 1HOCA 5SWZD 3GMOB 5I17B 4KQ4L 3V5KA 1NANH 1AGCA 5FKPB 5CJ5A 2DLEA 5F89A 4OCXL 5EIIA 1CE6B 3PGCB 2LABA 3V4PH 3PDDA 1VENA 4GKOA 1JHKL 2B0SL 1QLRB 3ILPA 4OZHB 4M3JA 4I18A 3QQ3B 1I7RB 4WW1B 3HI6H 4U3XA 1YQVH 1H3TA 3LDBB 4F7MB 3LEXB 3W9DA 2P5EB 4CMMB 4JO4H 4HEPG 4ZSOA 3PWJB 4Z95L 4OCMC 3IDJB 5ANME 1RMFH 3C60D 1Q72L 2HVKB 3F12A 1G9MH 3O8XB 4OFYA 1U8QB 1T03H 1VFAA 1CDBA 3QQNA 1E4JA 3BJLA 2VB5A 5L2KD 2PTUA 2ITDA 3DHMA 4PJ7F 3P73B 4PJ7E 1WAAF 2UY6A 4HZLB 2A9NL 3CVHA 1WAAE 3MGTB 4M1CC 3UEZA 1JTOA 4XPBL 1I9RH 3A6CL 4MWFB 1XZ0A 2N7AA 5DD6A 1S7WB 2I5YH 5C9KA 2BNUA 4RBPK 5FA3B 2ATKA 2DM3A 4RQQB 2NY2C 4WU7B 5DJCB 3FMGH 3B43A 3P4MA 3PHOA 2OR9L 1JNJA 1KYOK 3VFVB 2WIIB 2WWKO 4H88H 4ZOCA 3U30C 1MCRA 4MLSA 2Z8RA 1UQSB 2APVA 5LQBH 1CG9A 3IJYA 3OGCA 2VC2H 4XCFL 4AIZB 5JOFA 5EA0H 1EMTL 5CSBA 2DOCA 3TBTA 3MOAH 1HH6A 1N59A 4K23L 2R9HC 3T3PF 1NGZA 4HUVA 3B5TA 4OCYL 1J8HB 3C5ZB 4JQXA 1QFWM 1V7ML 1YMHB 5AYUL 5BS0D 1GIGH 4BH7B 2E7HA 4OZFH 1D9KD 5HYIA 3SDCA 2P24B 4X6CB 4LAJH 3LKQA 2ZWLT 3HZMB 1IL1A 5D8JL 5A43C 4G42A 4ZD3L 1PKQE 4WTXA 3OB0H 4NT6B 5FYKL 5DRXB 3K1DA 1QFWH 3O3AB 5D1XB 3W0WB 2OTWA 4UNUA 2WAHA 4QHUA 3P4NB 2X2YA 2P5WD 1WZMA 1S7UA 4JFZH 3SGKC 2GUOA 3SCMA 2FJHB 5B4MD 1S7RB 4HIIB 5C0RH 4FQ1L 4DW2L 3B9KD 3U1SH 4M7JL 2XXMB 2XZAH 1NEZB 3GJFA 5IVXB 4TRPH 5FECA 2YD4A 4MJ4A 4LASH 5L6YH 3EO9L 2YEZA 2OI9B 3VG9C 2EIZB 2XPGB 2UZIH 4DZBB 3QEUA 5BV7B 5D93B 1GC1H 3LD8B 5T1KB 2NXZD 4U1JB 4POZD 1HINL 1MFAL 5I1JL 4JHWL 5J6HB 2HT2C 1NL0L 4MXVF 4MXVE 2F53B 5J57B 4FRWA 4LLVA 4KVNH 4GRLA 2C1PB 1BVZA 1EFXA 4Z7WA 4D9LH 5TE6H 1MAML 5AD0A 3WYRA 3WEXA 2VAAA 5C0GA 2H26A 3P3YA 3F62A 1OP9A 1VFBA 4QRTA 1GZQA 3UTSE 3HNTH 4MXQC 3AREC 3B9AA 2VDPL 2ZOLA 3QYCA 3ZE2F 2NZIA 2XV6B 3ZE2E 4KJQC 3T4AB 3HMXH 4J23A 2I07A 1RIVL 1SY6A 2YHGA 4G9FA 4GG6F 4GG6E 1CFBA 3V0WH 4LCWE 1FG2B 4NZUH 1NBQA 3KPMA 4PTTA 1F2XK 5I18L 5IFJB 3RTQA 4U7MA 1JWMA 3G5ZB 5DT1H 5BQ7A 5C07D 1RPQA 1JNLL 5JIKA 1KPVA 5F44A 1PLGL 3OHXB 3UJIL 1KC5L 5CEXA 3SO3B 3JVGA 4JPVH 2VLRA 3QUXA 1ZGLM 3OAYK 5CEZH 5F7EL 1KJ2A 2YPVL 1BZ7B 1NCWL 4L3EE 5CAYB 2NTFA 1F90H 4PTUA 4YHOL 5ENWB 1MRDH 2VLJB 5GISL 1OM3L 4P2QE 5ICYA 2EYRB 1INEL 3ZKND 1RUAH 4NUGL 1JWUA 5DQJB 4U6YB 4XCNB 4WVRA 1IGTB 5DEFB 2YPLA 4P2OD 3QEHB 4ZYKA 3WMSA 4XMKH 2ICEA 4MA7H 1NCDL 5DUPL 5E2VH 1D5IL 3MV8E 1DTUA 3AB0C 3OMZA 4ZUTA 4UB0L 3V5KB 4D0CA 1AGCB 4JPIB 1A5FH 2X89D 1G7JA 4KRPD 4UV4H 4YXLL 5I6XB 3RGVD 2JJTC 4Z7OF 4JFDA 4Z7OE 2VIRA 5HHQA 3ILPB 2HN7A 3C09B 5F9WB 1Z3GH 4I18B 5IOPA 3PWPE 4UQ2B 1NDGA 5IF0B 1PYWA 4N8VA 3GGWB 3W9DB 5GS0H 1UM6L 1CFNB 4ZSOB 3IETB 1LK2A 3QJFA 5EUOF 2Y1VA 5EUOE 2X4QA 5J3HD 3MXWL 1P4BH 4Y16A 3MJ9H 5E03A 4JDZB 3DX9A 5ISZE 3OJDB 1S5HB 1IC5H 2I60L 4BZ2L 1TTUA 4KUCF 1H3GA 3CVHB 4KJWD 2A1WH 3OSKA 4M5ZL 3BZDA 4XVTH 1DBJL 5DD6B 3CFDA 2BNUB 3FHAA 3GBNL 4LCYA 1T5XB 4K55A 1GGBL 4JFPA 4S1SL 4W4OA 1OTSC 2EDHA 2HRPL 2EO1A 2D7TL 3P4MB 3BKYL 3E8UL 3PQYE 3FO0H 3D3VB 1KTDA 1SM3H 2FATH 2JB5H 3N0PB 3X14B 1PG7L 4PRIB 1INDH 3BPNC 4WI6A 4PJDB 3IFNH 1QSEE 3V4VL 4DZ8B 1CG9B 2C26A 2X41A 5F7UA 3IJYB 1MIEH 1NBYB 4R4ND 3OGCB 4PY7B 4YBHA 2DIAA 3T0VA 1YNKH 2JCCA 2ZOKA 3TBTB 1HH6B 4DGIL 2ICWA 4JRWA 1FSKC 1NGZB 3DX6A 4UAOB 4HUVB 3CX2A 3PF2A 3RPIA 5E24E 3WD5H 2HKFL 1U95B 4JZJA 3BPOB 4LLMA 1CT8B 3MZTA 3NABL 3TWCL 1RK0A 2C3XA 4P9HC 5EOCJ 3D48R 4U6XB 3RNQB 3WHXA 2NY0D 4RZCA 3SDYL 2VXSL 1DFBL 3D0LA 4FZ8H 4LL9A 1KSRA 3HRZA 4JFEA 4Z7QE 5IMMA 1HE7A 1LO4L 1AQKL 1P9MC 2OCFD 3OF6A 5F97E 3GHBL 4HHAA 5J13B 1UB5B 5IV2A 4J3UA 5D7JC 3DSNA 2NY6C 4DN3L 3TYFA 2VAJA 1XCQA 4W68A 5HI4C 4MA8L 1FZKA 3LKNA 4G8EA 3BW9A 4QHUB 1TPXB 1R6VA 4ZUUA 3WCYA 4NNXA 3QCUL 4MJIE 3SCMB 4PJHF 3H3PH 4PJHE 3P30H 1VKXA 1BJ8A 1ZLVH 1MCJA 3WFCH 4NCC2 2EE9A 2IAMA 3AREA 4KMLB 5TFSH 4WENB 3WL9A 5IBUG 5FECB 5SWZE 5D72L 1MCQA 4LK4A 4M7ZB 1PAMA 1DVFB 1MFDL 2XZQH 5GGVL 1IM9A 2J6EA 3ISWA 3DSFH 3RDTC 3Q1SL 3H8NA 1LO2L 2MKWA 4L9DA 3RVUC 3QEUB 3UZVB 3RKDD 5T3ZH 2B2XL 3GSNL 4X7FC 1N6VA 3IFPA 5E8EA 3CFJB 5HBBA 2OL3A 1B0GB 4X7DC 4CN6A 3O6KH 3CFKB 3LS4H 4ZOEA 4PIRF 3AC0A 4G9FD 4PY8J 1W0WA 4PGCB 5C0GB 5D1QA 1G1CA 1MLCB 3BUYA 4DVBB 4HWZA 3I6KB 5L2KE 4L9LC 2C5DC 2WBJA 2PXYC 3WNPA 2ZOLB 2KH2B 4OTXL 1BVLB 1AJ7L 3D18B 2I07B 2VLLB 5DC9B 2NY3C 2VXTL 2FZ3B 3FZUC 1T7WA 2YMXH 2HG5A 1CIUA 2OJZL 4PTTB 3WFEH 5IHUH 2YBRA 4K7FA 4HWBA 4ZO6A 1Y6MR 2IBGA 4JO2H 1JWMB 4Z5RA 3EYUH 1WEJL 3BPLC 5DA4A 3ROLA 3ULVH 2UYLA 2XXCB 1A4KB 2VLRB 3GMRA 3NAAL 4FABL 1ZWIA 5T3XH 3V6OE 1U8IA 3S88H 4ODVL 1NLDH 4GXUN 5EOQL 5TF0A 3MA7A 5ICYB 3HI5H 4NWTL 3VWKD 5BS0E 3LPGA 4OBRA 3BKCH 2P8LA 3PDGA 3IVKB 1D5XA 5E70A 3RWDA 2EZ0C 3VD3A 5C8JA 5AUMA 3QHFL 2CKNA 1ZLVK 5HHPA 5I19L 3ZT6A 4U1NA 1UH4A 5J0BA 4D0CB 1TITA 4MMXC 4QXUL 5IEHA 3QIBA 1G7JB 1F4YL 3B83A 3LKRB 5KSBE 1U92B 4LRNH 2NY2B 1NCBH 1P4IL 3DNKA 1Q9KB 1KIPA 4JFDB 3UTOA 2X4NA 2P5WE 2VIRB 2A73B 4HMCA 5B8CC 2VRAA 1BQLH 4I1NB 1KEMH 1ZHLA 5TDOB 3U30B 4M8VA 1CLOH 1NDGB 3MROA 5FHBL 1Z9SA 2LVCA 1FVDA 1PYWB 3MOBH 2F8XC 4Y5YA 3HI1A 1A3RL 1OVZA 1S9YA 3U7WH 4NO2A 2MQ0A 4L1HA 2ZPKL 1CLYH 1LK2B 3QJFB 1GPOH 4NJAL 25C8L 5DC4B 1A9EA 2P4AB 2X4QB 4XMLH 1KLGB 1Q94A 2DQFB 4MB5A 5ILTL 4N0FA 5L7XH 1TTFA 4R26H 5EZIH 4O4YL 3ORJA 4XP5L 4E5XA 1EO5A 1P7KA 3SKJH 3WSQH 2E8ZA 4RA0C 1CWVA 1AXIB 1JF6A 4Q9CA 4HAGA 5GIRA 2BRRH 3BEWB 2V5TA 4JFPB 4ELKA 4ONGH 3WXVL 4P46C 1CR9L 1K8DB 5DK0B 3UZQA 5IM7A 2JB6B 1PEZA 1BAFL 1S5IH 1FFOA 2ADFH 5DR5H 1IZKA 5FYJD 1P2CA 2ENYA 3MZGB 2XI9A 4WV1A 4RWHA 2R56H 1SMAA 2AEIT 4CU7A 1S7SA 1CFTB 5DZLA 5TQ2L 3CFBA 5F9JA 1H0DA 3MBXH 2MPAL 2COQA 5A2LH 2JTDA 1JGUH 5JOEA 1Q0YL 2J8UB 1WTGT 3RPIB 5JMOC 2BOBA 2E9JA 1UZ8A 1RK0B 1ZXQA 1YEKH 1ZVSB 3KPRD 2GK0A 1K6QL 3GNMH 1Q9LA 3GKWL 4RMRA 3MRJB 5C07E 3K81A 4Y8DC 3DRTA 5DJ0A 4ZOBA 3ECBB 1I8KB 1OB1A 2CDFA 2J4WH 2EDFA 5IV2B 2WWMC 4R90H 4JAMA 2BERA 3TYFB 5B3NA 1RZIA 1XCQB 1U3HD 2UUDH 6FABH 1HQRA 5E6ID 3LKNB 4G8EB 1JF1A 3IGAB 3A67L 2ATPB 1G7PB 1U93A 2NW2A 2YPKB 5BXFB 3NCFB 3IFLL 2R69L 3T4YA 4ZFOA 5KSAA 5C7XL 3ARYA 4NKMA 1VGEL 3AREB 3WL9B 3MYJA 4YO0A 3IJHA 4M7LT 1I9JH 5EPMA 3TLRA 3WXWL 4NQCD 1XGPA 1L7IH 2XIDA 4UIKL 3U0PA 1NC2A 1ZLUH 4NM8L 4FXLA 5GS1C 2KZWA 2AXFA 2ARJA 2Q86B 2ERJC 2F58H 3LKPA 5DZNA 1HILA 5HYJD 4H1LA 1Z0MA 3IFPB 1ACYL 4F7EA 5HHOA 3MCKA 4JDTH 3MV7A 5ALBL 4FXGB 1JL8A 2HT3C 1MCEA 2JLLA 4RGNE 2FCBA 3R1GL 2SEBB 5E6YA 3WDHA 4CBPA 3ZKQD 4LHJB 1NSNH 4WJ5A 4HFUL 5DMIL 4ZFFA 2V9TA 3ESUF 3GMQA 3IRZA 5D1QB 1QD0A 4KWUA 5DS8B 3VXTB 4HWZB 4QRRD 4HZAA 2ZG2A 4KJYA 3PNWA 1OP5H 3D87B 5C0AD 2WBJB 2XA8H 4CNIA 3D9AH 4IRSA 4U7KA 1RULL 5CCKH 3LAFA 5D6DA 2BSTA 12E8H 4Z6AT 2D0HA 1NBZA 1DBKL 1TZIA 1ZS8A 1QHPA 2HG5B 3LH2L 3AB0B 1Z2KA 1N0XL 4I3GA 3F65A 4K7FB 4Z7UB 5AZEH 5BJTA 3WUZA 3MRFB 3VXMA 2YN3A 2FECL 3WHE1 2GK2A 3V4PL 3BJ91 3TVMA 4PRHA 3ROLB 5EIQA 3GMRB 3QXAA 1KJ3L 1QLFA 3CLFL 5GHWH 4JRXA 4ODWA 5GS2H 1FL3B 2V7NA 1YQVL 1OAYH 1O7SA 4Q97A 3MRBB 3MA7B 2UUDK 4JO4L 4ETQB 3MLTA 2VR5A 1P7HL 3MLUL 4GT7A 5E2JA 5HI3D 1RMFL 2P8LB 1D5XB 3D6GA 5CD3A 5ID0B 1JZ7A 3RWDB 5B38B 4DKFH 1FZJA 2DQEH 3EYFA 2BC4A 1B6DA 4L4TA 5ELIA 3SPVA 1C5DB 3FB8B 4U1NB 3LOWA 5IUSA 3CXHK 2APWA 3AY4A 3ROOB 3V95A 4ELMA 4WFHD 2D4DA 3QIBB 4TTDD 1I9RL 2B39A 2E27L 2FO4A 4URTB 3VFMB 4JRYD 2I5YL 3VDAA 1ZLUK 1KIPB 3VFNA 2X4NB 3HCVA 4RA3A 1JPTH 1B4JH 2XNAA 3QDJA 1SMOA 2CLRA 3FMGL 3C5JA 5DSCA 2HT4D 2DYPD 1SJHA 4HPYH 4H88L 1KCRL 4G8GB 4X5XA 4Y5YB 5CJ8A 1S9YB 1QSFD 1QBAA 1KPUA 4NO2B 5F21B 3U2SA 1DQLH 1E28A 2XQBH 1A9EB 3E3QE 3EJYC 1Q94B 2VC2L 2LU4A 1FFNB 5EA0L 3VXPB 4J3XA 1UACH 3HR6A 1JZ4A 1FSKB 2EDOA 1RIUH 4N0FB 3JUYA 1OP5K 2CIIA 3ZE1E 3ARDA 2D3VA 4X9FA 1T1WB 4H25B 4HFWB 4F33A 2FD6H 3B9DA 3GSRA 4L4VA 4MA1C 4TPRH 1GIGL 3PWVB 4R6UA 5KW9L 5GIRB 1WIUA 3J8F7 4ELKB 4G8IA 4YDKL 3DHJA 4B7IA 1BQHA 3MGOB 5F72S 5KVEH 5ICZA 1N3NA 2DQCL 1JUFB 3MRCA 1P53A 4MX7A 1V3JA 5F7DB 2HJLA 1P2CB 4Q6YA 1QFWL 2YK1H 5C0NC 1AD9A 4JHBA 4OLZL 4I2XB 2HKHH 3DVGB 5HDLA 1J0IA 1MREH 3CFBB 4HIJB 8FABA 3QI9D 5F9JB 5I8EB 4JFZL 4KKCD 5IESH 4CVZB 5HDBE 2GCYA 3U0TB 5C0RL 2VDOH 1JYNA 3U1SL 2XZAL 3IT8D 2BOBB 2C1OA 4ZNEE 5K59F 5D7LD 4TRPL 3HPLB 5K59E 4YZFF 3GIZL 3IXAB 4YZFE 3RDTB 2GK0B 2YC1A 1Q9LB 5I1CL 5L6YL 2UWEA 2EO9A 2ID5A 1MFEH 3K1KC 1P7QB 4AZ8A 4WW2C 3FQXA 4PJGF 1G7MA 2C7UA 2H1PH 4G7VH 4PJGE 4Y1AD 3SY0A 3KYMA 2CDFB 1NJ9A 4K71C 4OB5H 5IFAH 3C9NA 3QPQD 3TA3D 4KHXL 1RZIB 1Y6NR 1YY8B 4GBXC 1HQRB 4NFCA 3AM8A 4F80A 1LWRA 5M7QA 1F2QA 1U93B 5MEOB 1YPZB 5DRNA 2NW2B 2Y07L 2BVOB 3BZFA 2EDRA 4IMKC 4L9LB 3WUWG 2LVEA 3S4SG 5KSAB 1UJ3A 2OM5A 5T33H 4HC1A 2EDBA 3MYJB 4I4WA 3HNTL 1A1NA 1KCVL 1A7BA 1UEMA 4N90D 2R2HA 2ZNXA 5GRYA 4H5SB 5EPMB 2NY3B 5KN5B 1XGPB 4TNWF 2HFFA 3U0PB 4KKLC 3LMJH 3EDEA 5E4EB 1OGTA 2B8OT 3LKPB 1ED3B 1X4YA 4LSQH 4NZUL 1HILB 3BO8B 1QFWI 4KRLB 5HHOB 2F54D 3UZEA 4XNQA 3IDNA 1VHPA 2WQRA 5C08D 2FL5B 3FO1A 5DT1L 5I1HH 2OMBA 4HWNA 1G7QA 4WJ5B 3W11C 4HD9A 2VDMH 4LLWB 1EBAA 4Q9QH 3EFFA 3MMEA 4NN6C 5GGSA 4HX1A 1F4WL 4RAVA 1YMMD 4U1KB 3PNWB 5MI0C 4EKXA 3EJJX 1F90L 2C9AA 3SGDH 2DQGH 3MUHL 4CNIB 3H9SD 1RUAL 4IRSB 4GUPB 2BSTB 1KIUA 3L3GA 4XMKL 1J0JA 1T66D 5IHZA 2N7BA 2FGWH 1TDQA 3DX7A 3KG5A 4I48A 4APQD 5BJTB 2VABA 5I1DA 4XB7A 3VFSB 4OFDA 1MCDA 5F93C 1A5FL 3LRHA 5CILH 2YN5A 1DQJB 3K74B 5HJ3B 2IQ9H 5IMOB 3TVMB 3NN8A 4PRHB 3AGVA 1BZ9B 3TBYA 4GLRI 5FYLD 3U4EA 3QXAB 1SYSA 2R15A 4IEFB 1Z3GL 4JRXB 4ODWB 1MCWW 3UBXG 3MV9D 3FQTA 4D8PB 2W92A 1C08A 5CINH 5GS0L 2DKUA 2CGRH 4LSRH 4ZUSB 3RWIA 2OS7A 1NMAH 1WIPA 3I02A 4JDVA 1X4ZA 1FZJB 3EYFB 4XNMA 3MJ9L 5JO5A 3QDAA 5SX5H 4L4TB 3HG1A 2IH1B 5TDPA 1F3DJ 5IW3A 3U0WH 5F6IC 1QQDA 4ELMB 4L29B 1G6RA 3MRIA 3H42H 2A1WL 3G5XA 4XVTL 2FO4B 5KS9A 1LP9A 2OXHA 3T65B 4DEPB 4P46B 2JJWA 1CU4H 2PCPB 2DB8A 4XCYA 5HGHA 3NGBC 3L6FA 3VFNB 4XBEH 4IMLB 4Y4HD 2XNAB 3QDJB 3BAEL 3C5JB 4KROC 3CZFA 1SJHB 2FATL 1ZVYA 2CXKA 3VMNA 2JB5L 4K7PX 3ARBD 2BHUA 1INDL 2DDQH 1K3ZA 4MNHA 3IFNL 2P5ED 5EU7E 4AG4L 1MIEL 2VITA 5DJ2A 3MLPA 4JREC 5ESQA 3L3DA 4NQCE 3RY6C 3O8XD 3HNVH 3O2WH 4ONOA 4UIMA 1C12A 4KUZH 3DMMA 1P84J 1EK3A 4KXZI 2X9XA 2XYCA 2CIIB 2R2BB 3ARDB 1XR9B 3QQ9C 1OSZB 1VFUA 5FK9A 5ESAA 3RVWC 5HYJE 4OZIF 1EFQA 1C5BH 4P4KD 4EDWH 4OZIE 4ZNCD 4YWGL 1ODAA 1FDLL 3NFPA 3OJ2C 3WV0A 1G9NH 4M7LL 1J7VR 2ZUVA 4G8IB 1Z5LB 3BDYH 2J1KA 4GKNA 1MH5A 1UWXH 4OCWH 4OD3H 3C6LC 3MRCB 4QRRE 4K3GA 2WANA 4Z7VF 2PTTB 4BKLA 5DVMA 2HJLB 1II4E 4Z7VE 4CVWA 1MWAH 1AD9B 1ZMYA 5C0AE 1B2WH 3GO1L 4TNVF 1KCSH 1WFOA 2BK8A 3PHQB 4ODBD 8FABB 4GRMB 3WN5A 3QXTA 4Y4KC 2W91A 3NPSC 3H3PL 3JV0A 4WTZA 4X7SH 4WWKA 1FNHA 3ET9F 1T7VA 5FO9A 4LHUA 4NQDA 1T20A 3S8WA 5CBAA 1J8HD 3C5ZD 4GMSH 3VFRB 3TBVB 2XZQL 1UYWL 2UWEB 5F9DC 2F19H 4KY1H 4H8WH 2QQKH 5IT2H 2ERJB 4YHZL 5IVNA 4FQHB 1X5YA 1G7MB 1AGDA 1DQDH 4L3CA 3SY0B 3BGMA 5T3ZL 4YHPA 1KFAL 3QUKA 4HJ0D 5JDSA 1IGJA 2A6DB 3JV6A 3RI5F 2V9RA 3WS6A 1UXSA 4Y2OA 3BP4B 3LS4L 5IB5A 4HKJB 5D1XD 3W0WD 1JV5A 4X8XA 3TP4A 2GEEA 5FV1L 4HSQA 3RNKB 2YXMA 3BZFB 4J6RH 3L3KA 4CJ0A 1FZOA 1GYAA 5IHLB 3KAAA 1UJ3B 4NBXB 4ONFL 2GAZA 3O3EA 3NZ8A 5JW3H 1JPFB 1F13A 2GQHA 4TUKH 1A1NB 5JXAH 4JZOA 1FLTX 1YQ2A 5JLZA 5JQ6H 5CP3A 4WFHE 1JI2A 1W0VB 2LAAA 4JRYE 1AY1H 1IE5A 1R3HB 5C0IB 4F37K 1FNGA 1UM5H 1OGAA 2PW2B 2YMXL 3V5DB 1I8IA 1GGTA 1TQCB 4HK0A 5T1KD 2QR0A 4X4MA 3BT2H 3GSUA 4XNQB 1E0OB 5GSVA 4CJ1A 4FP8H 1EEZA 4JO2L 5HD8D 2F53D 4FQXA 4KKNA 1QSFE 5IHBA 3ZYZA 4O2CA 3QDGA 1G7QB 5GRVL 1K4CA 3JZ7A 1MCWM 3ULVL 3QFJB 5JW4N 1ZA3B 4HX1B 1FYTD 1UWXK 4RAVB 4A2MA 5AG8A 3N1QC 5D2NA 3BSZH 3S88L 5F1IA 1NLDL 3ARPA 3JXAA 4AH2B 4BYHA 4Y4FC 1EAPB 3IS0X 2OTUB 2QTEA 3LQAH 5D7IA 4JO1L 1XF2A 3MRNB 1KGCD 2IBZY 4NP4H 1A6ZA 5JW5B 4XC3H 2ESVA 2BCKA 1PQZA 5IHZB 1NGXB 4XPHH 3HE6C 2BSSA 4CVXB 5I75C 4M9PA 3S9DB 3SE4C 2BSRA 1HHIB 4DOHB 3FONA 4NQUA 4V1DB 2Y7QA 2XN9A 5IB4B 1C5CH 4LRNL 1NCBL 4MHHG 3NN8B 1UA6L 2AQ3A 1SYSB 2O5ZH 1KEML 1ERNA 2BX5A 3O3BA 4HS3B 4NZRL 4TUJB 1CLOL 2VH5L 1IKNA 4F2MA 3CDFA 3V7AE 3FQTB 4YDJB 2VLJD 3Q6GH 4M4PA 5D1ZC 3RWGA 1CL7L 5D7LE 2EXYC 3U7WL 2Z31A 3L9RA 2CPCA 1CLYL 4OD2A 1GPOL 1P1ZA 3RWIB 4QLRA 3O41B 2DQIL 4PJ8A 3BKML 2F15A 3ZSTA 4N0UE 4QT5A 4ZO7A 2APBA 5TDPB 4H0HB 5EZIL 3BX7C 3RHWF 1I1AA 3MLRH 2F74B 3QO1A 4MS8D 3HC0A 4FTVB 3S7GA 1YEGH 1BFSA 4W6YB 3SKJL 3WSQL 3MRIB 1WC7A 3WJLC 4OV5A 5JPNA 1NC4D 1IBGH 4WO4A 3TPUA 1CK0H 5F7FA 4BFBD 4P5TA 2J8OA 5GSRA 4XCYB 5HGHB 4MJ6A 1X3DA 1AGBA 1Q9OA 4J7RA 5C3TA 4NYLB 5T5NG 1DLHA 1F3RB 1DBBH 3IKCA 1WISA 2AJVL 4GAFB 4MDJA 2M26A 1G0DA 4PRBB 2DI9A 4TOYH 1IC4H 1XF5B 3CZFB 5F9OL 3FAWA 3LHPL 4OGYH 4AM0A 4Y0GA 4KK8C 4MNHB 5LXGH 3QG7H 1XGRB 4HMDA 4Q7DA 2MTPA 2VITB 1TVDA 3KHQA 4N90E 2Y25A 4GH7B 5DJ2B 3L3DB 4GSDH 3MBXL 4R97B 1CGSH 1JGUL 5KTEL 2HLFD 2AK1L 2J7LA 3NCYS 5FK9B 2V6HA 4KI5C 5C0DA 4P5MB 5SWQA 3O0RH 2F54E 1P69B 3PP4H 3BP7A 2Q7YA 3GNML 1BF2A 5DJAA 5C08E 2YD7A 3NFPB 5I1GH 4WW2B 3OXRA 5J9PB 1NAMA 3X3FH 4JVPA 5C09B 4FFYH 4MQXC 4K71B 2HTKD 1WBZA 4N0CC 1MH5B 3NPZB 2J4WL 3QEGL 5DXWA 2V5MA 4XCEB 1CL7I 5GRZA 1YMME 4X8JB 3GSNB 3D3VD 4R90L 4GAGL 2AVGA 4PRID 4GRWB 3MJ7A 4K8RL 2NMSA 5KANG 6FABL 2AJZA 2B5IC 3H9SE 4DFHA 1BBDL 2QEJA 5HPMB 2XTLA 1UC6A 2X7LB 4BELD 2JJSC 4CDGC 5FO9B 4LU5H 1C1EH 1S3KH 4LHUB 4NQDB 3KPSD 1T20B 1U8HB 3I6LD 4N8VG 5CBAB 5K9QG 1TJGH 4TSAH 1G7LA 4TVPL 4JFFA 4DKDC 1VACA 1L7IL 1YNLH 3MRMB 3O6FC 4P2RB 3WKMH 2VQ1A 5EZJA 1AGDB 2JELH 4L3CB 1JGVH 2F58L 3BGMB 1IGYB 5B39A 5I66A 3EYQC 3MXVH 1IAOB 3X17A 2FH6A 1IGJB 5C2UB 1RURH 3QULA 2YRLA 3JV6B 1EDQA 3MV9E 1GGIL 2AQ2A 2NX5D 4QOKB 4BQBA 1UXSB 5BVPL 1A22B 2FX9H 3A6BH 2B20A 3GJFH 4NN6B 4F9PA 1A3QA 3WNLA 4JG0L 2PETA 3OPZH 4FXKA 4FQ2H 3MLXH 1I4FB 3T77B 4IRJC 5JXEC 4MMZC 2GAZB 4BSVA 2NY7H 1KG0A 2NQCA 1XGYH 4X98B 1EA9C 4I77H 5JLZB 2XA8L 5KJRH 2WW8A 1VFMA 2YWYA 5F71A 5T1LA 2VMFA 3NA9H 5CCKL 4OI7A 1DVFD 4RAUB 1D6VH 5IVZA 2XACC 3I3BA 3QH3A 2AI0H 3DGGA 4F57L 4PJIA 1OGAB 2V5SA 1I8IB 4NOFA 5CD5C 4JQVC 5C6TH 4OZHF 2QR0B 4OZHE 4LVEA 1S9KC 3GSUB 3BYYA 2NR6D 5GSVB 1EEZB 3TN0D 4S0SD 4BSJA 5EORH 5J56B 2P5EE 4O2CB 3QDGB 1JIBA 1IC7H 1UM4H 3RWFA 4OUUB 3CH1B 2DLFL 3BZ4B 5D71H 2RHEA 5GHWL 4XI5D 4GAYA 2PO6C 3T1FA 1RV6X 1WCBA 2A74A 4P4RA 1OAYL 1U8MA 4MDIA 1VPOH 4LLAA 2CDEA 3GUTA 1CQYA 5D7IB 1RJZB 1QEWA 1JPSH 3KVQA 3I9GH 2IC2A 3SGEH 5GS0C 1CS6A 2MQCA 1QR1A 1A6ZB 4KHTH 3RIAF 4C83A 5IMKA 2DQEL 4HWUA 2ESVB 4QHLA 1JPGA 4HUNB 1PQZB 2QADC 3UYOD 2BSSB 5F6IB 4MJ5A 5F7MC 3OAZH 5F7NC 3H3BC 2BSRB 4DCQA 5I1KH 5CGMA 1IARB 1KJ2H 1RJCA 3FONB 5JDJA 4JVWA 3QPXH 1FNLA 4Q6IC 3NGBB 1SBSL 4RMUA 3DO7B 3KLDA 5IWLA 3R0MA 2X4TA 4OZFA 2KBGA 4L8SC 3LV3A 4KROB 2R8SH 1B4JL 1MAJA 1Z9OA 3ARFA 4KJPC 3O3BB 4D9QD 1HCVA 3VW3H 5HYSG 4HPOH 3GM0A 4PGZA 3VFOB 3DBXA 3RWGB 2B4CL 2Z31B 3L9RB 1J8HE 1DQLL 3GJFK 1P1ZB 4OD2B 2XQBL 1NGQH 2VTFA 1LO3L 3AAZB 5TE7H 1CICC 5GGRY 4QT5B 1NFDF 1XR8A 3G6DH 1NFDE 2QBWA 4X6CF 4X6CE 3T0EA 4JANA 2AJSL 2EDJA 3BGFC 2FD6L 3QO1B 4NSKA 3BKJL 3QNZA 2C3GA 4M1CD 4OV5B 4M6NH 4QTHA 4TPRL 1RZJH 2XZCH 2Q3AA 4PLJC 2YA0A 3HZKA 1P4LA 3SDXA 3W0WE 4MJ6B 3NIFE 2NY2D 4G80A 4HMEA 1V05A 4MDJB 5EZOH 1A64A 3C6LB 5FUCC 1KCKA 5KVEL 3KPTA 1MUJA 4AM0B 4X7CC 8CGTA 4XPGH 5GRWA 1B9ZA 3MQIA 4OLWH 1NGPH 1GOGA 1EZVX 4P99A 2YK1L 5KSUA 1CGXA 4X5WA 3VRLF 4O9HL 4LGPB 3VRLE 2HKHL 1MREL 4C4KT 2VZ1A 5FGCB 4QRPB 1BOGA 3X12A 1CD0A 1YEDA 3K2MC 5ITBH 3L3JB 5KBNC 2R9HD 1KYOJ 4XMPL 1T1XA 2VE6B 5E7FA 4N1HB 3MLYH 1NAKL 1H8OA 2VDLL 5SWQB 3VG0H 3CMOH 2R23A 4Q9RL 1TZHA 3BP7B 1MVUA 2GITA 5HVHC 2F53E 2BNRA 1JE6A 3OXRB 3DVNA 3HMXA 3QNXA 3TBSB 2HH0H 4HIXH 2IH3A 2H1PL 4G7VL 4Q2ZB 1UCBH 4ZO8A 4DAGH 3OAZK 1FYTE 3H0TA 2D7QA 3KPQB 3T2NL 2H2PC 3SE8H 4EIGB 1WIOA 2IPTL 4IBLT 5I74C 3TCLA 3G04B 2GJ6D 2AJZB 2PYFB 2BY3A 3C2SA 3CXDL 2ITCB 5FYJH 1I85C 1KGCE 1YY9C 2R4SH 2AAVA 5TDNB 2ZG3A 4HJJH 1I3GH 4XC1H 3MRGA 4TN9A 1JGLH 4PJEE 5IEKB 5IJVB 4WUUB 1BHGA 4KTEH 1KIRA 1QRNB 1VACB 5EFIA 3LMJL 3OAUH 2E8YA 2OR7A 3RWCA 4XPTH 3Q2CA 2NTSP 3K80A 2Z92A 2BOCA 2DMKA 5B39B 4KTDH 5DJDA 3F5WB 3CVIH 2HT2D 3FT3B 3O6LL 4DGVH 1BIIA 5IBLC 3MC0A 4U1LA 43C9B 5I15H 4WU5A 5DFVC 2VLJE 2X1OA 5I1HL 3WFBH 1OQOA 3UTQA 5J1AB 5FGRA 3P0VH 4CW1B 2VDML 4K3JH 2RQ8A 4FXKB 4NHUA 5E95B 4PD4K 5EO0A 1S78C 3ULVC 3F7QA 5BW7A 1KG0B 4MXQD 2APFA 5EULV 3PWNA 1JGEA 3LQZA 4OCRH 3C08H 3RUGB 1ORQB 4KJQD 2FYYA 4NIKB 5CMAA 1GZPB 2OL3H 3DROA 3ZL4H 5LGJA 5IVZB 1RZKH 5EN2B 1CGUA 4KAQL 3DGGB 5E2WL 1IQDB 5I75B 4JLRB 2FGWL 2D9CA 1KTRL 1OTTC 4LEXH 1E6JL 3DIFB 2FH8A 4ODTH 3BHBA 4ZSOE 3WIHL 4JPWH 2DD8L 2CQVA 5C0BA 4WWID 2VZ3A 4M5YH 3RZCC 4J12A 4MD4B 2D7MA 1J9CT 4GAYB 3T1FB 4MD0A 1D6EA 1WCBB 2BFVH 3M8OH 1J87A 4N8PA 5D1ZB 5GGTL 1DN0A 3IU4H 4P4RB 5HVWA 1T22A 1CIDA 4P2YA 2A83A 3BRGC 4HH9B 1I7TB 2AGJL 2CDEB 5CINL 2CGRL 3TESA 5EZLA 1NMAL 2R2EA 2YA1A 32C2A 4RGMC 3O4OB 1YEEL 4OCSL 4YJZL 1QR1B 1FC1A 1JRHI 2XG5A 4IIQA 4R0LA 5F1KC 4ENEC 1FFRA 4GS7C 2KL6A 2R0WH 2B7DT 4MJ5B 5EBMA 2BHZA 4NHCH 4NUJA 4PS4H 4DCQB 3REVB 3P11H 4CMHC 3D3VE 3VXSB 3BVNA 4OLUH 4LEOA 3H42L 2BP3A 4GW1A 3QUMH 4PRIE 4IJ3C 4PJDF 2DICA 4PJDE 3V79C 1CU4L 2X4TB 4OZFB 1RUKH 1MLBB 3RRQA 4G6KH 3HRPA 3TT1L 3TZVC 2VXVH 4LCUA 3S35X 3HAEA 1VB9A 2MCG1 1D5ZA 1OF2A 5HDOA 4H1LG 1RU9H 2DDQL 1TNNA 1JPST 4JB9H 1LD9A 3KPLA 3GJEA 2K7QA 3I6LE 4M43H 3VXNA 5AAWA 1UADC 4TSBH 4U0RC 4P3WA 5I30H 3Q3GA 4MGXA 1F3JA 5IJKC 4KUZL 1J88A 4XX1G 3VMOA 3ABZA 4D9RD 3B9VA 1IAMA 4JANB 1C7TA 2OQJA 5C0FB 2DQUL 3TH2T 5CJQH 5FAAA 2DMCA 1C5BL 4EDWL 3MOQA 3ZMRA 4C56A 3D2UD 2NX5E 3DLQR 3FN3A 3MR9A 5D4QA 4QF1B 4UNVA 1RUPL 2PN5A 1OTSD 1MJ8H 3U9UA 1W0YT 1KACB 3O6MH 3TJEL 4C4KO 1OW0A 1L7TH 3AS3A 3ZYIA 5FFLA 3QHTC 4YHLH 2WQ8A 5DGQA 4G8GD 4OQTA 2CUHA 3QIWA 5IW1A 2FLRT 4D3CH 1B2WL 4EEEA 2DN7A 4X6DA 4NKOB 1KCSL 2ZSVB 4K8RC 4Y5XC 3X12B 3F7PC 5E00A 1WZ1H 4KK6C 4PJ9A 4NBYB 1BBJA 2X1QA 3WJJC 2Y36H 2R23B 5J6GB 1G6VK 2GITB 2V17L 5JNYA 1B3JA 3FQNB 3B3IA 4PJAF 4KY1L 3P9LA 1N4XH 3CPLA 4NC2B 4PJAE 5IT2L 4U1MA 1W8OA 3B4NA 5LKNA 2E9IA 1DQDL 4PYHA 5D7JD 2NY6D 5D96C 2IF7A 4ETYA 5FDYA 1KT2A 5GRXG 4QXGH 2N56A 4LSTH 3TCLB 5HI4D 5FDWA 3KYNA 1H15A 1DEEA 2VL5B 4LPCA 4O51B 4X4YA 4ZAKC 4J3TA 3OB8A 5EOTB 3WO4C 3FT4A 1SHMA 4J6RL 1C16B 5FGBA 1G0YR 4IRJB 5E1AB 3MBEA 1WF5A 2GJZA 1AIFA 3VH8B 3LEVH 1NEUA 1R3JB 5IKCB 2VLKA 3VXOA 5JW3L 3MJ8A 5SX4H 1L9MA 5KSVA 2EEBA 4Y2DA 3FB7A 5JXAL 4FZEH 5DD5H 1OSPH 5JQ6L 2XWTA 3W5NA 1PY4A 4M8QB 1KIRB 1AO7B 3RDTD 1FC2D 4HT1H 5DRWA 3IAGC 4PLNC 5TF1H 3RVUD 1AY1L 4O2FA 3E6FB 1P7QD 1BD2D 1UM5L 5KG9A 3VXQA 1S7VA 5DJDB 4EVNA 3GHEH 5FIEA 4D9QE 3FOLB 1BWWA 1SEBA 3BT2L 1A7PL 4U1LB 1OD9A 3NZHH 1E6OH 4FP8L 2DTMH 3GSWA 4NQEA 2Q87A 2ZUQB 3UTQB 4U1SB 4R7NB 4X6FA 2QSVA 3BD3A 1SYVA 2YS4A 1YYLL 4QY8A 3UTTB 1EXUA 1R3KA 3Q5TA 2PO6B 1OL0A 5BZWA 2K1MA 3QEQA 2H45A 3PWLA 5F70A 4BSWA 3UXFA 4KKAC 2PXYD 1LEGA 4ZTPH 4DK6A 2GFBA 2XZZA 1U8NA 3F7YA 3LQZB 4I9WD 3LQAL 1VGKA 4H1LH 5JOPE 4LRIC 1A7QH 5CMAB 2DLGA 1Z6JT 2NY3D 4NP4L 5H35B 3TC9A 4HCRH 4LGSB 5CP7B 1PBYA 3FZUD 4KDTC 4X5LA 4RISH 1GSMA 2CLVB 5D5MA 4XPHL 3RAJL 4LSVH 1X5XA 5IB1A 1AXTH 4EI5C 3VFGH 3QWOB 1F5WA 2XTJD 3QUYA 5H2BB 4PRPA 1CXEA 4Q6IB 5DI8B 5H8DA 5HDQH 3QO0A 2CSPA 1RZ8B 3MREA 3RL2B 2E7LA 5E0QA 4L8SB 3BHBB 2H32H 2WIMA 2P7TA 1C5CL 4ZXBC 5DA0B 5C0BB 4M7KH 2O5ZL 4O58H 4RDQF 4POUB 2Y4SA 5CUSL 1DN0B 4MCZB 4NGHH 5GGUA 4HIEB 2KQNA 5IR1A 3REWA 2HVJA 4JR9H 2N1KA 2R2EB 32C2B 1B0RA 3HZVB 3TEUA 2EZ0D 4LARH 2B4CC 2H3NA 4E42A 1JHTA 1OAXL 1WT5A 4POYA 4R0LB 3BGFB 5EBMB 2NW3A 4BH8A 5DZOA 3MLRL 4OUOA 1YEGL 3N50A 1TMCB 3UYRH 1T89A 1XCTA 3BVNB 1IBGL 2AJXL 1X5ZA 1CK0L 5CJXA 3G6JB 2GJ6E 5D7SH 1M1SA 4P23C 3QB7C 1DBBL 3AS0A 1A4JA 1IC4L 3S3PA 3H6JA 1XF4B 4OGYL 1RAMA 3TNNA 3BQUA 4WHTB 3TH3T 5FYLH 2J8UF 4KU1A 2J8UE 2P1YA 3GJEB 3VXNB 4Z0XA 2UV3A 5I16A 4XNZC 4OFPA 5EC2B 2FRGP 15C8H 2BJMH 5AWNL 5A2JH 1A0QH 3QHZL 4GSDL 4EZMA 3CVHL 3O2DH 1F3JB 3HR5A 4M1GH 3FFDB 4WCYH 5ERWA 1A6TA 1CGSL 3L1OH 1PG7W 4KK5C 2OQJB 3V6ZA 5KOVC 1MRCL 5MP6H 5TE4H 1MJ7H 3O0RL 3TO4A 5HVHB 2PTVA 4C56B 4PJCB 3PP4L 4QXTB 1LK3L 4HDIA 2PR4H 5EU6B 1YN6A 4LP4A 2A6IA 5I1GL 3L5JA 4R4BB 5DJZB 3W39B 4P46D 1J8KA 2XWBA 5DUML 4U1HB 3X3FL 4NO0A 4DVRL 4PGEA 5ANMA 5FM5O 4GQPH 3JBG7 2ZUTA 1J5OL 5I74B 4R7DA 2FJFA 1CFVL 5HHNB 4KV5F 1ZT7A 3QIWB 4ACPA 1EHLL 5IW1B 1MEXH 1VADB 3THMH 1GAFH 5FYKD 3DETC 4S1DC 4Y19B 4X6DB 4MB4A 1DBAH 4PJ7A 1ZLWH 3TCXA 1T6VN 2APXA 3W5MA 1S9WB 1WAAA 1EEUA 3GMMB 3VGAB 5L8LB 5E00B 3UJJH 5FUZH 4A6YA 1RK1A 2OYPA 4MZ2A 4PJ9B 1BBJB 1A7OL 2RIKA 5IP4A 1C1EL 1S3KL 4MCYA 4FMKA 2DL2A 1RY7B 3FTGB 1N2RA 4HGMA 5I1EH 4TSAL 1QOKA 4QHNA 4NJ9H 2HP4A 1SEQL 3WKML 3ARSA 1QO3B 4UNTA 1JYVA 2ZJSL 2E7BA 5HGDB 2JELL 2BVPA 1MNUH 5E9DD 2WWMD 3L5XH 2CMRL 3MXVL 1YEHH 43CAB 2D4FA 3BEVA 4HKXB 1MHCA 2FX9L 4PJ5D 5DMJB 3IDYC 3EYOA 4ODUB 2G5BB 4R4FH 3D85B 2LTQC 3ELAT 5MERB 5DFWH 3FT4B 2GT9A 5LCVL 3OPZL 3T8XB 3WFHB 3MBEB 1AIFB 4NCC1 3ULUH 5ITFA 2VDKH 4U1GC 4Z7UF 5KSVB 3GB7A 1XGYL 5EWIH 3FB7B 4Z7UE 5CIPH 5KJRL 1XEDA 2C3VA 1PKQA 5E5RB 4LIQH 5DRWB 2F8VA 1PZ5A 4O2FB 2AI0L 5KG9B 2IALA 1H3XA 4EXKA 1S7VB 4QRSA 5C6TL 1U8PA 4G3YH 4HUUB 2Q20A 4N1EA 2HT3D 3UTPD 3FFCD 1X44A 4JM2C 3QIUC 3X11B 4OSUH 2HFEB 2WUBL 5B21A 4HC1H 2MQ3A 1SYVB 1UM4L 1KN2H 3LB6C 1ZSDA 1WGOA 1OOAA 1V7NH 1HNGA 5D71L 4YR6A 3QEQB 3HPJA 1MQ8A 1IFHH 4MAYA 4WNQA 5DVNA 3S37H 4D9RE 4M6OH 2P8MA 2B1HL 1JN6A 2EDNA 1VPOL 4M6ML 2GFBB 4F7PA 1U8NB 4L8DA 1MIMH 1VGKB 4LCCA 4S2SB 5LAXB 4ZTOL 5J06A 1JPSL 1NDMB 2MCPH 3I9GL 4OM0H 5EO1B 3SQBA 4CUCA 4G8FA 5TH2A 4G5ZH 1ZLWK 1RFDH 1Z9MA 3KPNA 1U6AH 4TQEH 4JHAL 4K9EC 2QLVB 3DURB 5C6WH 1FRGH 2W65A 2RFXB 3ILQC 3OKLB 4YE4L 1IAIH 1DCLA 3QUYB 4GW4A 4IM8A 4PRPB 3IDIA 5I1KL 3TBWB 3CGTA 3MREB 1KJ2L 4G8GE 1UVQA 3QPXL 3UTSA 5IBUB 4MHHI 3TZVB 2R8SL 2OZ4A 1TVBA 2HTLC 2EKSB 4BFGA 3LDBC 3QFJD 1MHHA 4JZNA 3D5OF 3RIAK 1HI6A 2CKBH 3VW3L 5I9QC 4OT1H 3IAQA 3DXAD 1B4RA 5JUEH 4GG6A 4RSVA 3RIFF 4LCWA 3OKDA 3KXFD 4U0RB 5IR1B 3REWB 2HVJB 3SDDA 2HLAA 3DGCR 3N1FC 2H3NB 4E42B 3U82B 1MCBA 1T21B 3G6DL 3H2WA 2Z8SA 3KPPA 4NO5A 4RNRA 2NW3B 4BH8B 4I0PA 3EAKA 4HUKB 3QBTB 3RY5A 3SJVD 3T2PA 3N1MC 1RZJL 2XZCL 4L3EA 1EEYB 3T04D 5JORA 4V1DD 2H41A 3MFGB 2AEPH 4P2QA 4F9LC 1CGVA 4B41A 3JV5A 4I2XE 2ADIA 5EZOL 5IB2B 3SBWA 4WUKH 3PL6C 2E9WA 4AIXA 1LVEA 2FDBP 1OAUH 3TNNB 4XPGL 1DDHA 2FWOB 3VXUD 2VUYA 3HE7C 3UTZA 3MV8A 5IIEB 2UVEA 5DUBA 3SE3A 3EJYD 1X7QA 4Y5XB 3NACH 4HW6A 4ZS7H 3HR5B 1I8MB 5ITBL 5DHXB 4X7TA 1BD2E 3LS5L 5EB9A 3V6ZB 3VWJC 2OLDA 3MLYL 3VG0L 4B50A 3CMOL 3PWPA 3JV4A 4FTVD 5I8CA 1IEAB 1F42A 4HDIB 3QUZA 5C0EB 3MJ6A 1A6VH 2HFGH 3ARGC 2A6IB 3MYZA 1W72A 4JKPH 4NNPH 2XWBB 1A3LH 3S96B 3L95A 4U05A 2HH0L 4HIXL 2CO7B 5DJ8A 1YPZF 4PGEB 5D96B 5EUOA 5ANMB 1YPZE 4DAGL 2YUVA 1E4XL 2HJFA 3SE8L 5KAQG 2FJFB 4LKXB 3QWRA 3QG6B 3SDAA 2IQAA 3CDGA 4J3VA 5C0ND 3UPCA 5ISZA 2DMBA 3WO4B 4HXAH 2DBJA 4I9WE 3R8BB 5DK2A 5FYJL 1SJVA 3IRPX 1YEIH 3UC0H 1ZT4A 2R4SL 2OP4H 2DI8A 1RK1B 5EDXA 4HJJL 3BH8A 2Z8VC 3MRKA 4UBDC 3CU1A 1JGLL 4PG9A 1MI5D 2OI9C 1A1MA 1K9TA 3X13A 4XT1C 1G1YA 3PQYA 4KTEL 4QHNB 2ARWA 2FIKB 3MLVH 3G5YA 3IFOA 5D93C 3LD8C 2XKNA 1QSEA 1KPRA 3OAUL 3PABA 4XPTL 5C09D 4KTDL 4G9DA 1M4KA 1KBGL 3CVIL 5DLML 3FN0H 4IDJH 2IANA 3F7VA 4MNGE 3PV6A 1FORH 4GBXD 1S7TA 4HXBH 5I15L 2XQYG 1FL6A 1MHCB 3JWOH 3EYOB 3RA7H 3WFBL 5FUOH 1ZEAH 2BXYA 2XA3A 2GT9B 4K3JL 1R5WB 1U8LB 5E99H 3UX9B 2W9LA 2J6EL 3O4LB 5F88A 2EDEA 5JW4R 3VFPA 2ARJQ 5DC0A 1PX4A 1S7QA 3OKKB 3GB7B 4TUOA 4M02A 2PKDA 1RJLB 3GBMH 4OCRL 3C08L 2C3VB 1PKQB 2OMNA 1CXKA 4GQ9L 4HK3J 4KKLD 2OL3L 3ZL4L 3SN6N 3LQAC 1RZKL 1E4XI 4P2RD 3FQWA 4NQTA 2IALB 3WHE0 4QRSB 4J4PC 4NQVA 4QCIB 2ICWI 1DSFL 5D2LA 5GJSL 3U6RA 1EGJA 4LEXL 4MAUH 2CIKB 2H2SC 4PJHA 4QOKD 4ODTL 3W11D 5SWZA 3C87A 4KZDH 2R1XA 1ZGLP 3DUUA 4M5YL 2FO1A 4PBXA 1EJOH 3HPJB 1UWGL 4MAYB 4RDQG 2BFVL 1Q0XH 3M8OL 4UQ3B 5DTFA 4M93C 2P8MB 3IU4L 1JN6B 1A6AA 4F7PB 2EH7H 1V3MA 2ADJA 4FQJL 2NY4C 4L8DB 4FQPA 4LCCB 4ZOAA 4HWBL 2BNQD 1A14L 4YIQB 3OKEA 4G8FB 5TH2B 4D0DB 1T4KB 2NCMA 1J1PL 1HSAA 4KPHH 4W81A 5JIIA 1AD0A 5F3BB 2WP3T 2W65B 4IOIA 4JJHA 2QV2A 1FPTH 3V52H 1IGFH 3ZKNC 3C60A 1T3FA 5I6XC 4K3HA 1YUHA 4N5EC 4NHCL 3VD4A 4YUEH 4LNRA 3P11L 3S4SA 4OLUL 2MHAA 7FABH 5L2KA 1MCNA 2JE8A 2X70A 3GI8L 3QUML 5IG7A 4P23B 3UTSB 4CADA 5L2JA 3C09C 4FQCH 4I18C 5FYKE 4JKWA 1WFNA 4MSWA 5HVGB 5CBEA 1M71A 1CXHA 1KB5H 3GK8H 4G6KL 2DKSA 1MHHB 2HYMA 4JZNB</