2ZWLT

Human factor viia-tissue factor complexed with highly selective peptide inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
191
Chain Sequence
b'TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor VII light chain
publication title Human factor viia-tissue factor complexed with highly selective peptide inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 43
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT02
1LE5A 1NGQH 2VDNL 5CUSL 4XNXL 3ZKND 4ENEC 2NY7H 2L4OA 3TGXA 1MLCA 2HT3C 5I66A 1MUJB 3RVVD 4J3SA 2JLLA 2JELH 2GW5A 2I07A 3MROA 4JO2H 4NRZA 4XB8A 5EDXA 4RFNB 4ZXBB 4PR5A 3L6FB 2V2TA 1YY9C 5CEZD 1MCEA 1ITBB 3RZWA 2HVJB 4N0UB 5F7HA 3RDTC 2OQJB 1E6JH 1RZKC 1SYSA 3BP6A 5GS3A 3SHSA 2BOCB 4KHXH 4L4TD 1C08B 2EDDA 1KTLB 3VI3E 3ARUA 5E99H 5C09D 1P7HL 4OLEA 5DEFA 3SDAA 4YPJA 5IV2A 2NZ9D 1KJ2B 4QRQA 3G6JE 2X89D 3WS3B 3TCXA 32C2A 1WWAX 4B41A 2YS4A 4PG2A 5LGJB 3KYOB 4Y4FA 1CR9L 4G42B 1MJ8L 1CXIA 3C8DA 4FABH 1C5BL 1RZGB 1S7TB 3RWDA 4EKXA 4Z7OF 4L4JA 4P4KB 5KVGL 1PY9A 3SQBA 1KCRL 3TV3L 1LEIA 1Q72L 4XP6H 4EBQL 1P2CB 1LP9F 1R0AH 5E94B 4U6VL 4HKJA 4ONGH 4KVNH 3QDGB 3R0MA 4CKVX 1AE6H 3BZFA 4NKMB 4TSCH 4Q9RL 3P9LB 3DUUA 3B83A 1J7VR 3T0EC 2CK0H 2P7TA 3FFCB 4P4RB 5HHPB 5B3NA 4MNGB 1BJMA 4HCRA 1KPUB 2B5IC 4LHJB 2JB5H 3RWJA 3SY0B 1DQJA 1X9QA 4LCIH 4YDVB 3H0TA 4GMTL 1UZ6F 2E5EA 1MHEA 1PKQB 5D70H 5DD6B 4IDJH 3QIWC 5LBSL 1QHPA 3EYSH 4P3CL 4FFYL 2WBJB 1JPTH 5L0QC 2KL6A 1GRWA 5JHLH 3U0PB 1X4XA 3C2AL 3HZVA 1BFSA 1NCBH 2PW1B 2Q86A 4F9LA 4DCQA 1ZLUK 2YUXA 1B4RA 1ETZA 1NANI 2ZUXA 5DMYA 2ZUVA 4MA7H 1MELA 3BMWA 4QXTA 5IM7A 2WIIA 3IETB 1QNZL 3TESA 2UUDH 3C08L 1B88A 4C56A 4OB5H 4TRPL 2VXQH 4BZ1L 3ZL4H 3HAEG 5GRJL 2X4RA 1NFIB 4CNIA 4X7TB 3HMXH 2ZOKB 4PJEE 5B8CB 4QO1A 4NBZB 2BSSB 2IBBA 3O2DL 2GK0A 2GK2A 2NY4D 2D7OA 1S9YB 3H9ZA 4J1UA 4KXZH 1TZHA 3GFUA 4HW6A 4URTB 2LVCA 4LVEA 1MRCL 3TNMB 1JMXA 1WBYB 3FQUB 3HE7C 5HVWA 1KYOJ 3MUGA 3RY4A 3MJ7A 2R69L 3PG2A 4ZAKC 3MOAH 4S1RH 2NTFA 5GJTL 4PRAB 4PJ9C 3S34L 5IJKA 3ALXA 1U9KA 4IRJD 3KLAB 3U9PH 1TZGH 1OD7A 2R29H 4U1MB 3FQNA 2BX5A 3VXUE 3ROLA 3CFJB 2EO9A 1EPFA 1KXTB 1LO3L 1YEIL 5DRNA 2A74A 3R06B 3SGEH 3DARA 2D7PA 2FIKA 4QGYA 5DUMH 1MFDH 2ESVD 2JCCE 2GSGA 2DTML 3ARQA 1OGAB 4YDLC 3G9VA 3QNXB 4N8VB 5LQBL 1W8NA 1DVFA 1U95A 5I8EB 1RSFA 1X6NA 1J8HD 1EZVX 3P30H 3QFJB 2D03L 4ONHA 1WGOA 2IH1A 3FOMA 3DX9A 2QEJA 3INUL 1N5AA 4B0MM 4MS8C 1CE6A 2FSEA 4EIZC 5ISZD 4GBXD 3BPNC 5DLMH 4HIJA 2PF6A 1T2JA 1V7NL 3P0YL 1S7UB 3SBWC 1T1XB 1D5IH 4MXWH 1I85C 1IAKA 4JFFA 3BQUD 4N0RA 3QEQD 4MXQD 1ZMYA 4YXLL 2BY2A 3IKCA 4KMTH 3GSOA 3UTSD 2VKWA 1TVHB 2CRIA 5ESVA 4LQ1A 3E6FA 2FCBA 4FQXC 3WEXB 3S3SA 1YEJL 4IMLA 1T0MB 2EYRB 5D71L 3VFOB 4KROC 5AYUH 2X4UB 5FO8B 4PLOB 1Z0NA 4HMCA 1MQKL 1DE4B 5EWIH 4L8CA 3DRTA 1HILA 2W65B 2VDRH 3OXSB 4N1EA 4FZEH 3W0WB 1ND0B 4JE4B 1M71B 1K2DA 3LKSA 1NGYB 2B4CC 2QQQA 5BZDB 5JXED 3RX7A 1QVOA 1FL3B 2H1PL 1MQ8A 2Q20A 3O3AB 2YPVH 4FFZL 4WV1C 1BFVL 3T0XA 5HGBB 3PGDA 3L7EB 3MREB 3TN0D 1I7TB 4YIQA 2EDKA 3X12B 1NGPL 1U3HA 5E6IA 3BIKA 3VXNA 1YEFH 2HTLC 4Y5VC 5F7KC 3TYGL 3OKKA 3QAZC 4P46A 2DQDH 4CVUA 5F7MC 1D9KB 2GJ6B 4KI1A 5GS1A 1UEYA 1MFAH 1MHHA 3MLSL 3VFSA 4YC2B 1EERB 1Q0XL 5ACZB 3TT3L 3T8XA 1T1WB 3EYUH 1NFDA 1T5XB 1J0KA 1RZ7H 3OKDA 4MJ6A 3CXDH 2BVQB 1YNKH 3GHBL 3DO7B 1DBML 1CCZA 2GHWB 1C12A 4YDKH 3VXPA 1K8DA 1N5YH 3TP4A 1UZ8B 2QADD 2AK1L 1QUNA 2AAVA 4PLJD 1IKFH 3EAKA 4L9LA 3WXVH 4WWKC 5I8CA 5J6HB 3V5DA 3S5LA 1B2WH 2H32H 4ODTL 4RA3A 4RIRA 3GGWB 3TM6A 1RZKH 1UFUA 4F9PA 3ULUF 1TQCC 1ZT1B 5A2LH 3B2UC 3FB7B 5CFHA 2WUCH 1J1OL 4ETQB 4LSTL 4JREB 4LVNB 4PJDE 4J4PC 2MQ0A 3I50H 4I0PC 1MFEL 4QRTA 2PR4L 3U0TB 4ZNCD 2A83B 3C6LA 4JKMA 1JGLL 3BT2L 4UDTB 3GIZL 3WN5B 4EVNA 5JMOC 5CJQH 3PWNB 1CF8H 3C6SB 1AD0B 1AGDA 4NQDB 3VRIA 5L8KB 2IANB 1DQDH 5J12B 5AD0A 1AO7A 1N8ZB 1B0GA 1S9WB 1YPZB 4OLXL 3GBNH 5AZ2L 1JFQL 4A6YA 3JZ7A 1KN4H 4B7LA 2HYMA 4HGMA 5IQ7L 3ES6B 4B5EA 3ZDYE 3KPTA 4JB9H 4RFOH 4JFHD 4P57B 2Z91B 1F2QA 3W9DB 2IBGA 2Q76B 5F97E 1CZ8L 5D96B 3HB3D 3P77A 1CGUA 3HMWH 3NBNA 4NKDB 3CFCH 4RISH 1NAKH 2FX8H 3X14A 3TBYA 4LCCA 3WFBH 4LLMB 4LFHG 3CMOH 1GGBL 1GJIA 5JQHC 3LKNA 1AD9B 4XPTH 4ZFZA 4M7ZC 4P4KD 3ARDC 1CL7I 5BS0E 1KIPB 3P9WB 4WGVB 4QTIL 1G7JA 4R0LB 3MRRB 4LSSH 1A7OL 2FLRT 4GFTB 5IR1B 2VDPH 5LWYH 4GLRH 5I73B 4NQSB 3ULVD 3QEHB 3FONA 2YKLL 4JDZA 4XCYA 4DN4L 3HMXA 5C2BH 5KSAA 3L3KB 4KZDL 1OAUH 4Y4HD 3QFDB 5IHZB 1EAPB 1WAAE 4M7KH 3MJ9L 1EXUB 3BESR 3Q3GB 4BSJA 5D7JB 3RI5F 2WBJD 2FGZA 2P5EA 3A6BL 5DMIL 2O5XL 5HYFA 2XZQH 4WY7H 1XGTB 5BJTA 1MSPA 1S7VA 3P4OA 4WCYL 5HY9B 3PQYB 1I3VA 4I5BB 4LAQH 2AEQH 1A6WL 3RIAK 2DLTA 5TFSH 3QXAA 5C6WH 2XFXA 5M7QA 5D7LE 3SEPA 1YDPA 4UILL 4PTTA 5SV3A 4JFDE 5I30H 4OD1H 4OGZA 1CICC 5I1AB 1T04B 4ZMAT 4JO4H 4GRLA 4U1HB 3MLRL 3GMQA 4W6WB 4XTRD 5IEHB 5KAQF 3MYJA 1EZVY 5HGGS 3RVXD 1KELH 1VEPA 2VOTA 3VWJC 4XGZA 4IOSD 3WO4C 2ITCB 3LV3B 3HI5H 5HHOA 2FNBA 3FOLA 5FKPA 3ZKNC 4MNGE 1SHMA 3X11A 1RQ5A 1YECH 1FLRH 3C5JA 2G9HA 1VACA 1FFNA 4HWUA 1KN2H 4J3UA 3QP3A 4KQ4H 1PKQE 1QSEB 1MHPH 1YQVH 3F58L 5IWLC 4BQCA 1A1NB 3MODH 2GSIB 4N5UA 4JRYE 1G7PA 4OCYL 5FUCC 5GS0C 1OP9A 1NCWL 1MIEH 3FMGL 1EMTH 1OF2B 2CKBB 1RIVH 2EECA 3BH9B 3UBXG 2OL3B 4F7CA 2YMXH 4CMHC 4L3EB 4R4BA 1GAFL 4N9OB 1RIHH 3H3PH 1FAIH 2W9EL 1OGAD 4KAQH 3KPPA 4ZS6D 4KMQA 4N0CD 8FABB 1T66C 2CIKB 3P2TA 5D5ME 2BVTA 3OJDA 1LEGA 4Y1AB 3TLRA 3W11D 2AXGA 2BVYA 4NQCA 4PB9L 4HJJH 3QFJD 1IC4H 1BREA 2XACC 1TQBB 5I8KH 2DQUH 1H15A 3GNMH 3GMMB 2X40A 3FRPA 1HNFA 3DMMD 4F33A 1IGJA 3ARTA 3UPAA 5ABDE 2NXYC 3RUGB 4Q6IC 1LO4H 4L3AA 4XPFH 3ZYOA 2NY6D 3WBDA 3NTCH 3IFLH 4G6AC 4X8JA 1IJ9A 2B4CH 4ODHH 4ZUWB 5HDBE 2ZUQC 5BXFA 4WFEE 1FFQA 3O0RH 1R3KA 4NCC1 4BFBD 3KYMA 4F7MB 1UJ3C 1W0WB 3FO1A 1HINH 4L4VE 1FDLL 1MNUH 1WEJL 3NACH 3CFKA 3NFNA 4N1HB 2VLKE 5INDB 5IF0B 2XY1A 4PGDB 4P2RE 5DEGB 2DQHH 5D1ZB 3HS0B 5ENWA 5JNYA 5F21B 2BRRH 1FIEA 2HWZH 3PWJA 2PO6A 2VTFA 2DWDA 1H8SA 4NZRH 5GRVL 5J4MA 4L8BB 4PJ5E 2ITDA 5J1AA 4HIXL 2IPTL 2IAMD 1TVBB 5TE4L 4KKCD 3KPSB 2P1YA 4FS0A 4ZNEE 1IZKA 2YD2A 1KLFA 5IMMA 1BJ1J 3EYQC 3O3EB 5FB8B 3BAEH 1T0PB 1MJJA 4RMUA 5FGBC 3SE4C 1Z9LA 2ATPB 3KLSA 3WUWA 5JW5B 5FHBL 4OIIL 1I3RA 2H32A 2XN9E 5IG7B 3RDTA 5IP4A 2XTLA 1RZFL 3WFHB 1CGXA 2NX5B 3KYKL 4NYLA 1SEBA 1FAKT 1D9KD 2GJ6D 1ORSA 3AUVA 2VN7A 1CN4A 3UPRA 1N3NB 4XVJH 1KTDB 1FIGL 2C4FT 3CFIC 4C83B 5DJ6B 1UWGH 3B3IA 1LP9B 1T2XA 5CSZB 1YJDC 5E8NA 1CGYA 4HKZB 4AQOA 5EFIB 3MV8B 5J9PA 1DFBH 5DC0A 5EU3A 4M9OA 3JV0A 3BRGC 4GG6A 2R0KL 1OAKL 1XAUA 2DL2A 3CSGA 1KIRA 1JGEB 5E9DD 4R3SB 2MSPA 1F3JA 3P4MB 3V4PH 1J86A 1FRGH 1PSKH 4BUGA 4PRHA 1NGQL 4HMEA 1DZBA 1L6XA 3BP5B 4FNLL 4MMZC 5IQ9A 2W60B 3W0WE 1NAMA 3K74B 1NANH 4AT6A 3UROR 2HT2D 3O6LH 3HRPA 4LIQH 1K4DA 2G5RA 1ZT4A 3MRGA 5IMOA 2BHUA 5HHQB 2OJEB 5FGRA 2YC1B 4JO2L 3IXTB 3T0EA 4FQ1H 1LDSA 3MNWB 2VDQH 1PYWB 1MF2H 5T5FH 1H5BB 2P46B 3PDGA 4PGEB 5C08A 1E6JL 4Q0XH 1SM3L 4WU5A 3MBEC 3QIWA 4KHXL 4RX4A 4KK8D 3WJJC 3TFKC 2IAND 2VL5A 5E99L 4DK6A 3DNKA 2AQ3A 4MJIA 3OTTA 4M4RA 5EO1A 5D8JL 1TZIA 4RGNB 1XGUB 5EIVA 2ICWJ 4G8IB 2HMID 2BVUA 4U4BA 1S7SB 4FP8H 2HTKD 1KEGH 1WWBX 4Y8DC 4AEIL 3MNZB 3S96A 2FWOB 1RV6X 1F8TH 5CKGA 3HG1B 3WFDL 2AVGA 4KDWA 4NQVB 1KXQE 1RK1A 2MWCA 5L88H 2O61B 1CXFA 4JN1H 1RZ8A 2D0GA 4LU5H 2UZXB 4OSUL 3RGVC 3JWNC 2VXUH 4FQHB 3HE6B 3L9RB 3DRQB 3RIAF 4QCIB 1FBIH 2Y23A 3O9WA 4Z7VA 5E7FA 4U31A 4KVNL 1LD9B 4X6BA 5EU5B 3HLAB 5KAQG 2Q7YB 2EYTB 1AE6L 4TSCL 1WCBA 4L8SA 5D93C 1KFAH 3B9KB 1RULH 3LDBC 3V5HB 2E8YA 4GSDH 3HE7A 1CQYA 1KJMB 1U8LA 2Z0BA 1JPFB 3IJSB 3WXWH 4FG6C 4AEFA 3U4BH 4GW4B 3HA0A 4PJ9A 3QWOB 4E42B 4IDJL 4QKXB 1L0QA 5CHNB 4YHPB 3A6CH 1WJ3A 2OXHA 3GSNB 1A1OA 1VDGA 2EH7H 2GTWB 4WTZG 2BSRB 1EUUA 5GGRY 43CAA 4D0BB 1NCBL 4KVCH 4QHNB 1NCAL 1YEHH 2X4OA 3V5KA 5D7JD 3JTSA 3BDXA 1SBBA 3EOBB 1C5DB 3DGGA 4RWYL 2JJWA 1A9EB 2ZCLH 4AIZA 5C71A 4HUWA 4KTEL 5DJAB 3OB0H 4G7VL 4OB5L 3QNZA 3ZL4L 2NY1B 4U33A 1G7LA 1ZEAH 1ODAA 4AY0A 1EHXA 2VMFA 5HJ3A 1PEZA 1K8IB 5C0CB 1FJ1A 4X98A 3HMXL 3WL9A 1G9NC 2JIXD 4OZFG 4DGYL 4AK1A 5I18H 3QWRD 1BLNB 4XVSL 5DHVA 2H3NA 5HHXL 3HR5A 4I2XB 1RUAH 3S98A 2FECL 5T1DH 4Z18A 2QADC 1OLLA 3BRFA 3ZTJH 3DSNA 5GS0H 5LKNA 4ODBD 5FA3A 5AG9A 4YXHH 3SBWA 1XF4A 1WISA 3MOAL 2NNAA 5I1DA 4QRUA 1G6RL 1I85A 3D18A 5GGVY 1CFNA 1BIHA 3UC0L 4Z7WA 5DFVD 2BNQE 4D3CL 3U9PL 1U6AL 3T65A 4K3DH 1S7XB 3EDFA 2R29L 4HIHB 1MRFL 2ATKA 4FQXA 4PJGA 1R3IH 1QSED 2ADIB 4XVUC 4DVBA 5KS9B 1K5NB 4LCUB 3DV6B 2B8OT 1CFTB 1MI5D 1YUHB 4XX1G 3BEVB 3GSQA 2YA2A 3O41B 2NPLX 1A6VH 1NH6A 2OCFD 1U8QA 1NDMB 4KKAC 4Z7QF 4NJAH 3PV6B 1URLA 2FX7H 4L3ED 1I1RA 1FNFA 1C16A 1NL0H 4N0YH 4UU9B 1KOAA 5GRUH 5KSBE 1DBKH 3SDXF 4WV1A 1BZ7A 2PYED 1I9RH 4IEFB 2XWJA 3EJYD 5EU4A 2HH0H 3HB3C 5EIIB 1DLFH 4LLDB 1JV5B 5I1CL 1RJZB 4X5WA 4Y5VA 2E7BA 1NFKA 2EO1A 5BV7B 5DJDB 3VFVB 3OKEB 1CGVA 1EV2E 2PW2A 3G5VA 3TEUA 1OT1A 3MV01 4X0KA 4PP2B 5ERWA 3LQAC 1PW3A 5BQ7A 1CLCA 5FOJA 4X9BA 4XMLH 3RNQB 4HGWA 1KLGA 2AK4A 4OCXH 3ALPA 1MFBL 3DOSA 4LCYB 2YBRB 4IS6B 1JGVL 5HDOA 3SE9H 3WE6B 4BKLA 1KENH 4G9FE 1H3PH 3DSFL 4LVHC 5F9JA 1F5WA 1JN6A 4Y4HC 3ORJA 1MFCH 3L5IA 3FB8A 4PJ7B 3MRIB 5D1ZD 1KPVB 4UMGA 3QISA 1T3FB 2DLGA 4NRYA 5DJCB 1CLOH 1OB1B 4J4PA 4I0PA 4X6CE 1H3TA 3G6DL 5SWZE 1YJDH 1BAFL 1FVDA 1PG7X 4ZQKB 5FOBA 3KPSD 4WI8A 1I8KB 4Y1AE 1AY1H 4X6DF 1YEFL 1SVZA 4QHLA 4OM1H 4G7YL 4OM0L 2RCSH 3LCYA 3MRLB 2DQDL 1LK3L 4M03A 4R2GD 2H26B 1MFAL 2OXGA 3OQ3B 3DYPA 4ZUUB 4F57H 5HYJE 1I1YA 1I4FB 4MQSB 3KPRE 1BVLB 3V6OE 5JORA 3QEGH 2JE8A 3EYUL 3R8QA 3X17A 4HBQA 4XTRC 5E8PB 2UUDK 4R90L 3CXDL 1YNKL 4NM8L 1HDMB 1WZLA 2K7PA 4ONFL 2ED9A 2HJFB 5DRWB 3D9AH 2HFGH 3PUCA 2ICEA 2DI8A 4JQIH 2PN5A 3MV8D 5F7UA 1N5YL 4GXUM 4U1SA 3CCHB 4HMDA 2Y7QB 1OAYH 1IKFL 4PRDA 2PTVA 4PJAA 2C4XA 3RTQC 4H20L 4B7IA 2WWMD 4NZTH 1VFOA 3ARDA 3DVIA 2LAGB 3H7BB 3H9SB 1FG9C 2Y6SC 4LLVB 5D6DA 3Q0HA 2G5BB 4O2EA 3I50L 4NNPL 1XF5A 4JJ5A 1UB6A 4JQVC 1AGFB 3F7YA 4Z7UA 4JLRA 4PJBF 4IRSC 1BQHA 5ELIA 2CLRA 1JF5A 2EXYD 3D69B 2XQYK 3HC3L 1U2HA 1F4YH 3T0WA 1G7MB 2KDGA 3MRPB 4ZS6C 4MNQA 5CWSA 3CVHL 4Y89A 2NX5E 1FNSH 4JHWL 7CGTA 4QOKE 3LEVL 3FN3A 1L9MA 4Z7OE 4MLSA 5EH1A 4OD3H 5F3HB 5AWNH 1WFOA 1UH4A 5HI5D 1QYGL 5GGSA 2YXFA 4P2OB 4R4ND 2DMBA 3HMWL 3CDCA 4RISL 3PWLA 1NAKL 2FX8L 2G75A 1JYWA 2KUTA 2HLAB 5GS2D 3WFBL 3PWPA 4KTDL 5C3LD 4PGCA 4WHYG 4XPTL 2JJSC 3GIVB 1GHFL 4XP9H 1CICA 4QXGH 4HXAL 4ODWA 5D72H 1K85A 2BOBA 4QT5B 1X5FA 5F88B 3HNVL 3QUMH 4YR6A 5C6TL 2J8HA 4NHCH 4XBPA 1UZ6E 5B39B 2YUVA 1RUQH 2RFXB 2R1YB 3CPLB 2IF7A 2C1PB 4DKEH 1B3JA 1F90H 3FL7A 4JN2B 3P73A 3T4YB 3B9KD 3VWJA 1E28B 3MRKB 2MQ3A 3OSKA 3O6KL 1VPOL 1ZS8A 3EYFB 4OZHA 4QWWC 2RGSA 1LVEA 1YZZA 1IFHH 2IAMC 4M7KL 3S36L 5D6CB 3BVNA 2VDMH 2VLME 5FGCE 1NC2D 2F54B 1GGUA 4Y19E 1G9NH 4I3SH 2IH3A 3T2PA 4NNYA 5FECA 5IWLA 1DBBH 4WUUB 1JBJA 4RGNE 3IGAB 4OQTL 5B38B 3F7RA 1MAJA 4LAQL 3KNBA 1AGBB 2BSED 4UOW0 5IFAL 1KIUA 3BISA 3SQOH 1G9EA 4J6RH 5CGMA 4G8EA 2NY1D 5D2NE 3W39A 4YNYA 3BO8A 4I0CC 4MA8H 1I1FB 3UZVB 5KANG 5C0CD 2X89A 5B22A 4DZ8A 3ESUF 4I3GA 1IAOB 1U8NA 4YXKL 1INDH 1NFDF 3D87B 4JFEB 2F74B 3TVMD 3AREB 4BSWA 3K1KC 1OGTB 3GRWH 2AJZA 4EI6B 5JW4N 5FCUH 3VG0H 1JPGB 3BGFC 5LVEA 1RJYB 2OR9H 1Q9WB 5E8DH 4PYHA 4DGVL 3AU1B 1ZHKA 5IJVB 3AAZB 5KVFH 4M93B 4M5YH 5FYLH 2E9IA 2UYLB 5L9DL 1EEQA 1YECL 2VDLH 5E5MA 4CRPA 3V2AR 1IRAY 3QZWA 2F53D 4YLQT 5F7WC 4KQ4L 4QY8A 3MOBH 3BFOA 1P1ZB 2Q6WA 4PV8A 1HWHB 1YQVL 4JRXD 4F8QA 4HBCL 2DQFA 4Y4KD 1KNOB 4LEOA 2BNRB 3D3VA 5E8EA 2JK5B 1HSAA 5CAYB 3KPMB 4IJ3C 1EMTL 1RIVL 3VXMB 3O4OC 5L2KD 4QNPF 5BOPA 1CBVL 1RIHL 3THMH 4GAFB 4KAQL 4R26H 3U2SB 5IESL 1WC7A 4LMQE 5ADOH 2XNAA 2HMIC 1QOKA 3LQAH 5T1LB 5ETUB 3O3BA 4OTXH 4KK5D 4D0DA 4HJJL 4RRPA 1IC4L 4HPOL 2V5MA 1A7RH 4LGPB 3LHPH 3BXNB 3T3ME 4LHUA 1JGUL 1FGVH 5FGBA 1LO5A 2DTSA 1GGIL 3LEYH 4KI5D 1FZKA 4LSQH 1PZ5B 5IIEA 3VXUD 1AHWB 3NTCL 3LN5B 4PYGA 4ODUB 2ZOLA 2NXZB 5HI4C 1DDHB 1R3HB 2VLJE 1UXWA 3QNYB 4OI9A 4Y5XB 3SO3B 3JV6B 3MUHL 4OCSH 3MRNB 1XGRA 3KHQA 4XBEH 3QJFB 5BVPH 2AJSL 4OI7A 1LK2B 1JZ7A 1MIML 1HINL 4XCNB 3ULUD 1IAIL 3NACL 2X4PA 4YUEL 1EGJH 2IG2L 4HV8A 3Q6FA 2JB6A 3BE1L 4OZIF 3BN9D 4LCWB 2IFFH 1GYAA 3QO0B 4P2YA 1IC5H 1P4IH 4MA1B 5E2VH 3BW9A 3IFOA 2R0ZL 4XNZC 4NZRL 3QWQB 2XZAH 2NY5L 4X6EB 2A6JA 1ZLVH 4MA3A 5ADPL 2L7UA 5GHWH 3UTPD 1ZANH 1GGCL 1J05B 3U36A 2PCPB 4QRRD 1FNHA 2OP4H 2WINA 3S35L 1ACZA 5T33L 2J6EH 3OBAA 2LQRA 1QKZH 4YDJB 4MCZB 4DFIA 5CILL 5E0QA 3QSKB 4IDLA 1MJUL 2V6HA 4I3RL 1QFWI 4FXGB 3WJJA 3SCMD 4XVJL 3LRSB 2V9RA 4HF5L 1UWGL 3FT3B 4ODXB 1AP2B 1SJVA 3OKOB 2NYYC 1DFBL 1AGCA 4HLZG 2UWEB 4QHMA 1KACB 4RDQF 4JFPA 3OJMB 2NZIA 5ICXA 2FJHB 4KJPC 3SPVA 2R4SL 4M5ZH 1ZVYA 1PKOA 1ZWIA 2V9QA 2WLYA 1MCBA 5MERB 1ZE3C 1MCPL 3DX6B 3DURA 3V4PL 1PSKL 3REVB 3P40A 3LMJH 3LN4B 3ARGB 4L3CB 1JUFB 3UJIL 3T0AA 1RURH 2C3GA 2ZUWA 2J88L 3HZMA 4GRWF 3O6LL 4LIQL 1D7FA 2GT9A 5IEKA 3TT1L 4XNMA 2DOCA 3H9SD 1AXTH 3SKUD 5FYJE 3MGOA 4OLVL 1JZ6A 5F3BB 4M6NL 1XGQA 2X4SA 3D0LB 3K8KA 3IU4L 4FQ1L 4ZFOB 1G1CA 1IM9A 1NQBA 2OS7A 3OZ9H 5DS8B 2VDQL 1QLFB 1MF2L 1HIMH 2VC2H 3PL6C 4S1SL 5JXEA 3TBWA 5DMGD 4OF0A 3WV0A 3LEXA 3VFWA 3QUMA 3QO1B 2DQCL 3VFNB 3U9UB 4K94C 4HXBL 1Y18A 1GZQA 3EJYC 5SX5K 4PJFE 3NAAH 5D9SB 2Z8WC 1F4AA 3VRLF 4QHUA 1ADQH 4LSPH 4FP8L 4XAKE 4NKOB 3IDIA 2ZPKH 3QR2A 3VH8G 3H9HA 1F8TL 4JFXA 1UM6L 2C1OA 5L88L 5DJ8A 4JN1L 1Q0YH 2CPCA 3QEUB 5C07D 3BP4B 4LU5L 1A02N 2PYFB 1FYTA 2IEPA 3QDME 1E27A 4ELKB 1L7TH 4NGHH 1JTPA 1EH9A 4LK4A 3NN8B 1WFUA 4NO5B 3TJHC 2VZUA 4FN0A 1QO3A 3NCBB 2A73A 4OD2B 3NCMA 3NVQA 3RVUD 2UZIH 1LE5B 4KJYA 4CGTA 1OWWA 1RULL 2RBLA 4UTBL 4UV7L 2H2SD 1MLCB 4N0FB 5DMJB 5I66B 4EDXA 1AC0A 4XHJD 5A2KH 3JV4A 5IW1A 2I07B 1RZIA 3CFEA 5F44A 3MROB 3KLHD 4NRZB 5IB2A 3A6CL 1QBAA 5T5NF 4BFGA 4PR5B 2V2TB 2EH7L 3IDXH 5IB5A 5DQ9A 4XXCC 1OW0A 1SYSB 3BP6B 4YHKH 1A5FH 3GRWA 1YEHL 2FO1A 4TVSa 4RAVA 5DK0A 3EOTH 3MLWL 3RHWK 4N5ED 4ZSOE 2ZCLL 1G7IA 3KPQA 4ZYKA 3K1DA 5DEFB 1NSNH 5IV2B 2MNUA 1IAMA 1FNLA 4QRQB 4R2GC 5BS0D 32C2B 1CGSL 1ZT7A 3ZDXE 4NC1C 4Y4FB 4XH2A 1T20A 2XRAL 5D2LE 1IZJA 4U6HA 2Q8BL 3HCVA 4LSVH 3CLEH 3JBG7 4UUJA 2HA1A 3RWDB 4R9HA 1ZA6A 4KHTH 1LEIB 1RUAL 3D39E 3FN0H 4FQJL 4PRIE 1RFDH 4HKJB 2DBLH 3V6FA 2I60L 3TIEA 1SQ2N 5I71B 2ARJQ 4GG6F 3BZFB 4H1LG 2IPUK 3K8MA 4YXHL 1N64H 3DUUB 1U8OB 2D0FA 2P7TB 1J87A 4PY8I 1E4WH 4YHLH 3RWJB 5DVMA 3BSZL 1DQJB 1V3KA 3H0TB 4RZCA 1IGCH 1MHEB 3QH3A 1YN6A 5E4IA 5F96L 5JA8B 2F54E 2C7UA 3MZTA 5I75C 4YFLI 1U91B 3TYFA 3HZVB 4EOWH 4WUUE 2Q86B 5TQ0H 5EBGA 4DCQB 2NY0C 1Y0LA 4DOHB 1A3LL 1ETZB 3HI1A 5F93C 3T3PF 2ED7A 3MLXH 4X6DB 4Y4HA 3UTQA 3KPLA 4LKXA 1XIWC 4QXTB 5IM7B 4NJAL 2WIIB 3FB6A 1FGNH 4RGMC 5CJOH 3D85A 4POZC 5BRZA 1A3RL 3STLA 4C56B 5EORL 1PX4A 3GM8A 1DBKL 3B5TA 2J8UE 4CNIB 2HT4D 5MHSD 4WJ5A 4M1CD 2DLFH 5LAXA 4M6OH 5T1LD 1TIUA 3I3EA 1EGJA 2HH0L 1JPSL 4R4NC 1MCHA 1DLFL 3GZKA 2R39A 3PP4L 2GK0B 2Y5TA 4NBYB 1A6TA 4J1UB 1TZHB 1I1AC 4OUUA 4LSDA 4P3WA 3DUHA 2YD9A 1P84J 1EBAA 2E27H 1DEDA 1QFUH 5ESAA 5CZVL 1WVZA 3QIUC 3LKOA 1OCWH 3MUGB 4LSRH 2E6JA 3MJ7B 3CSPA 4XX1E 2NTFB 2YPLA 4X5XA 4OCXL 1ZHNA 4RDQG 2J6EA 2FEDD 5HYQA 2DD8L 4TVPH 1RUPL 2LFGA 4CVWA 2FHBA 3ROLB 1JZ5A 2BNRE 4M43L 1JF1A 3RTQA 4O4YL 5DRNB 3MRQA 3GI9H 2A74B 3AS2A 1PQZA 5C0EA 1CTOA 2HKFH 1FYHB 2I26N 3F7VA 4LCWD 3VXME 3ZT5A 2C4FU 1GPOH 3OPZH 3Q6GL 3VDCA 4ETYA 2FIKB 2YWYA 2O5YL 5I1HH 4PJXA 4M62L 2GSGB 5KZCB 1WV7T 2QQKH 1TLKA 3I6KA 1CLOL 1CVRA 1PG7H 1DVFB 1YJDL 2VAJA 1NMCC 4JQVA 1U95B 5HGDA 4IRSA 4AG4H 4TSAL 4GKNA 4ONHB 3FFDA 4HEME 4NN7B 3QDJA 5BZWA 2DJUA 4GRMA 3DBXA 2IH1B 3FOMB 3DX9B 12E8L 1D5MA 5D1XC 3IDYC 4YX2H 1N5AB 4HQQH 1CE6B 2FSEB 3FO2A 4ALAH 1MRDL 3RPIA 4L4VD 5DDHA 2NR6D 1PFCA 2VLKD 4HIJB 1A6ZA 5IFJA 4XPBL 3TVMC 3QQ3A 1IAKB 2A77H 4JFFB 1BZQK 2YXMA 4X9HA 4YZFF 3DMMA 3IKCB 5JIPA 3GSOB 4JQIL 5EC2A 43C9A 4LARH 4NQEE 3FRPG 5ESVB 1HKLH 3E6FB 4WEBH 3DX8A 3BKCH 1OAYL 4LNRA 4AEHH 3WIHA 1ZHLA 1C7TA 3OXRB 1UM5L 3V4UL 4QEGA 4OGAD 4TNVK 2EH8H 3NFPA 4NWUH 4NZTL 5DZLA 5EOTA 4L8CB 3DRTB 2IC2A 1A6PA 2WP3O 2PXYC 1HILB 4Z7WF 1AQKL 3ARGD 5C0BA 3EO1A 1ADQA 1K2DB 4K94H 3LKSB 4Y4KC 1QVOB 1PY4A 3LB6D 3HFMH 1R24A 2F8VA 1DANU 5D1QC 1QACA 1L9NA 5B4MC 2F58H 1T0NA 3PGDB 2VDKL 1JI1A 4GUPA 1UYWH 1I8MA 4YIQB 4WU7A 1U3HB 5E6IB 2X7LA 3BIKB 5K59E 3VXNB 2J2ZA 4H8WC 2IAMA 4JCLA 5JW4R 3OKKB 1VADA 2I5YL 4P46B 3RRQA 5J13C 1BECA 1ZAGA 1FNSL 5GS1B 4KRPC 4R97C 1MHHB 2QJDA 1SJEA 3VFSB 5F1NA 1U8JA 2FX9L 4AM0A 4Y5YC 3T8XB 3OKDB 1NFDB 3MPCA 4MJ6B 3EO0A 2VXTH 1C12B 4GS7C 3VXPB 1JCKA 1K8DB 1XR8A 4PRPA 1PX3A 3RHWF 3V4VL 4WI7A 4AJ0A 2K9UA 1P6FA 4L9LB 3WKML 5CGYC 1XF1A 2YA0A 3S8WA 3QCVL 5I8CB 3QUML 3GSXA 4CN4A 3V5DB 3S5LB 1IGFL 4RIRB 2LU3A 3BGAA 1EVTC 1NCNA 4WI6A 2NW2A 1PAMA 5E9DA 1XR9A 4JO3H 1A2YA 1OAZH 1DEEA 2ICWI 4UI2A 1UC6A 2AJYH 5J57B 2E7MA 5DGQA 4ZUSA 3C6LB 3UJTH 3MRBA 4DEPB 4D9QE 2DQTH 1IFHL 4JKPL 3V9FA 2MJWA 4EVNB 5C0AE 3ZE2F 3K81A 5DVNA 3MRMA 4PD4J 4I18C 3RVWC 4OGYL 4UV4L 5KN5A 1AGDB 3VRIB 3UYRL 3VJ6A 1RVFH 3KLDA 5AD0B 4BH7A 1AO7B 3A67L 1FPTH 1WIUA 1OSZA 1B0GB 1YC8A 1KJVA 4G5ZH 4XRCA 4A6YB 1U42A 5JHDD 5FUOL 3E2HB 3SDAD 1FZMA 2X4TA 3SQOL 4X8XA 5HHNA 3SCMC 4WFFE 3OAYH 3P77B 4MA8L 1P7QD 4V1DE 1YYML 4Y4FD 3TBYB 3X14B 3U82B 4UAOC 4LCCB 3N50A 1UCBH 1CGWA 5ID1A 1GOGA 4CDHA 4PY7A 3LKNB 4ZFZB 1INDL 2VXSH 1P5VA 2X9YA 4ZS7L 5A16A 3C60C 5I0ZA 2OR9L 2F15A 4N8CH 4YHYC 4JFQA 4W6YB 1G7JB 3BH8A 5FHAH 3T0DA 1M7XA 5SX4I 4EUPH 2VE6B 2W0PA 4O2FA 2IMMA 4KC3B 1J5OH 3KHOA 4FMFA 3FONB 4XCYB 1MEXL 4DFHA 5JW3L 3AB0B 1R5IA 3MOBL 2P8PA 5FYKL 3KYNA 3C2SA 5FK9A 5KSAB 4FZ8H 4CMMA 4U3XA 4RFEA 3TPUA 5LXGH 5F71A 1J1XH 1OARH 1BM3H 2ERJC 1KULA 2OI9B 2CUIA 2P5EB 4MHHI 4Z7UF 3SDXE 4NKIL 5GS2H 1NGZA 1QFWH 3LVEA 3IU3B 1XFPA 5HVFB 5IBUB 5BJTB 1S7VB 3P4OB 3THML 2JJVA 3BZEA 5F1IA 3T04D 1G0DA 4R26L 4JY4A 2IFGA 4LPTA 2CIIA 3P11H 4YDIL 1Q94A 3QXAB 4LLQA 2XFXB 4HDIA 1FORH 3RGHA 4H25A 4OTXL 2MCPH 1H8NA 3NCJH 1YDPB 2VQ1A 4PTTB 4B53A 4BK4A 2AJVH 2ICCA 4KKLD 5GGVL 3MXWL 4J7RA 1L0YA 1ROWA 4LQFH 4JZJA 5DK3A 1DTUA 3FAWA 1FGVL 4PLKD 4GRLB 2E7CA 3B43A 2VWEE 3PABA 3GMQB 2FZ3A 4JM4L 3IDNA 4K71B 3MYJB 3T1WA 2JIXA 1TCMA 1B9ZA 4XGZB 5D7SL 2UY6A 4JZOA 4U3HA 5HHOB 2LVEA 3FOLB 3VGAC 1A0QL 5FKPB 1U93A 4JPWH 5SWSE 3RIFK 3UXFA 4OCSL 1CLYH 3X11B 3C5JB 2NY3D 2G9HB 4XBEL 3T08A 1VACB 1FFNB 2H2SC 3VW3L 4IOIA 3VI4F 5EUOA 4XHJC 4S1QH 1SY6L 1KIQA 3KDMA 1IC5L 1P4IL 1G7PB 5HHMB 1ZLWH 4DOHE 3BMVA 3DV4A 1J0YA 4XMPL 4X6DE 4OZHF 4KWUA 5MP6H 3OG6B 4F7CB 2EDJA 3N85H 2R2HA 3WNOA 5I9QB 2YN3A 4R4BB 4C56E 4XAWL 1A47A 3CH1A 3UAJD 5KZCD 1G9MC 1MI5A 3DX7A 2IPKA 3KPPB 1OTUC 1A9BA 2J6EL 3HNTL 3OJDB 1LEGB 2AXGB 1ZXQA 4NQCB 3GO1L 4DZBA 1QKZL 4DUXA 4HS6A 4YHOH 1H15B 2D4DA 5CD5C 35C8H 2V7HA 2VSDA 5J1TC 4F33B 1IGJB 2PYEA 3DVGA 2QSTA 2W38A 4LRIC 4G9FD 1FL5A 3MFGB 3PNWA 5B3JE 4X8JB 3BHBA 3M1BA 3VRJA 2YD4A 1NCDH 5BXFB 1EIBA 4PREA 1CFVL 1YMMA 3H42H 5JDSA 1C5CL 3KAAA 4JVPA 1R3KB 2ORBL 4M5ZL 3KYMB 3WD5H 1FO0A 3FO1B 1MWAA 2LTQC 3G08A 3CFKB 3NFNB 1EBPA 2AABL 4PJBE 1FP5A 2OK0H 2NLJA 4H8WH 1I9IL 1RURL 4TNWK 3C09B 1OSPH 5JNYB 5F7EH 1AXTL 3PWJB 2PO6B 2DWDB 3HZKA 4Z0BH 5T3ZD 1FNGA 5DD1H 1A7QH 5I1GL 1A8JH 2ITDB 5J1AB 2XA8L 3S4SA 2DM7A 4LDEB 3KPRD 3TIDA 3QPQC 4EN3D 3WLBA 3LD8C 2AJXL 5IMMB 4O9HH 1Y6NR 1OTSD 1UA6L 4F7EA 1MJJB 3IS1X 2IPUG 3TWCH 3O2WL 1U3HD 2Q3ZA 5E6ID 3WUWB 5DD3H 1I3RB 2H32B 4Z5RA 3RDTB 1ZLSH 4XXCA 5DJYA 1QQDA 4P46D 4NYLB 2ID5A 4P99A 1SEBB 4O58H 1ORSB 3UPRB 4IOFD 5EZJB 3ZT7A 2H9GA 3SOBH 5E8NB 4WO4D 1IARB 5J9PB 2QBWA 4RGOH 1I75A 5EU3B 5H37H 1Q0YL 1BHGA 1OY3B 4GG6B 4Q97A 1KIRB 4ZUVA 1L7TL 4NGHL 2XWBA 3B9EA 2VIRA 1QRNE 1F3JB 3WNNA 3PXHA 1QBLL 5FKAA 3U7AA 2FEDC 4JY5L 4FQIL 2WWKO 1PG7W 4PRHB 3V52H 2WQ8A 2E9JA 4X6FA 5IQ9B 4NKQB 1NAMB 4AT6B 1K4DB 4B50A 1S7WA 4M7JL 1ZT4B 3MRGB 5IMOB 4QOKD 3WLWC 5B8CC 4P5MA 1JIBA 3PP3H 3T0EB 4XPGH 1KV3A 1YMHB 2B5IB 3WSQH 1JP5A 3C6LD 3PV7A 5C08B 5F89A 3OG4B 4WU5B 3EZJB 4YHKL 3QIWB 5CZXD 4Z7NF 5TJWK 1S78D 1Z9SA 5L0QB 2VL5B 3EOTL 1AO7D 1BIIB 1L6ZA 4MJIB 4ODVH 3VXSA 1FNEA 1TZIB 4I77H 2GJZA 2XYCA 1SMAA 2FIRT 1XIWA 1MY7A 1IC1A 3V6ZA 3S96B 4J3WA 3MLYH 2FGWH 3CLEL 5A1AA 3MBXH 4ZD3L 2IADA 1RK1B 1RZ8B 4JHAH 2X70A 4V2BA 2P8MA 5E2WL 4U6TA 1RUML 1ZGLP 2DKMA 4WTXA 2O93L 4JFYA 4XP5H 2F8XC 3FN0L 2EEBA 3RFZC 1U41A 2ENSA 2FR4A 3O9WB 2DBLL 2XA3A 4Z7VB 4X6BB 1D5XA 1I1AA 4OGAC 4TUJA 4DKFL 1ZGLA 1EEUA 4NZDA 1WCBB 4L8SB 1N64L 3MCG1 1VCAA 2IGFL 1KTKE 3QXUA 2W92A 4MAUH 3QIUA 3HE7B 1U8LB 1UADC 1E4WL 3CSYA 1Q9KA 4YHLL 5KG9A 5FYKE 4LPUA 4JFZH 4QNPE 3L1OL 3JTTA 4PJ9B 3GUTA 1MCSA 2EE9A 3RP1A 5CUSH 5F72S 1A1OB 3DECA 3W81A 43CAB 4I8DA 1EO5A 4Z76A 3RIFF 3V5KB 3JTSB 3MLXL 2DQIL 3DGGB 2P5ED 3P9MA 4U7SA 3L3DA 4CJ1A 3PGFL 5CJOL 4AIZB 2A0LC 4HUWB 1NC2A 4J12A 3CK0L 1HI6A 4X80H 4YDLB 5C0JA 1G7LB 5E2TH 4X7CC 2APVA 5HJ3B 2A9MH 4XP4H 1IMHC 2DLFL 1Z3GL 1FJ1B 4HJ0C 4M6OL 3B6SA 2YOCA 4X98B 4OKVA 3WL9B 3WS6C 3GKWH 3T4AA 2F5BL 3WO3B 3H9YA 2CLVA 2EDQA 1J88A 3R1GL 1EO8H 5DHVB 1NUNB 2H3NB 3TH2T 1BJ1H 3HR5B 3WIIL 5D1XA 4ZOBA 1ONQA 1GOHA 3ARSA 5EIQA 4GRLD 3UTOA 5EBMA 2DYPD 1QSZA 4Y16C 1OCWL 1Z2KA 3BPNB 1MJ8H 4I9WE 2RAMA 5FA3B 1MJ7H 1C5BH 4LLUA 5KVGH 1XF4B 4OZIE 2A6IA 2NNAB 3TVMA 5I1DB 4QRUB 1TETH 4ZUTA 3D18B 1CFNB 1Q72H 5GSVA 3AMKA 5HHOD 4Z7WB 3C5ZD 4PB0L 3ZKMD 1G9MH 3T65B 3WIFA 3IDGA 4OFVA 3NA9H 3PDOA 1JL8A 1BWMA 4TVPL 1WBZA 3CU7A 2ATKB 4FQXB 4PJGB 2DQGL 2FBJH 3VXOA 4DVBB 4Q9RH 4KROB 1A21A 3GI9L 2VISA 2F53A 5I1KL 5JR1H 2Z93A 1S9KC 3GSQB 3J8F7 1GPOL 3OPZL 5HHMD 2DMKA 2D3VA 4YJZL 2F5AH 1QFWM 2PXYA 7FABL 3O45A 5IVZA 2QQKL 1U8QB 3R0NA 4GMTH 2Y72A 4JRXA 2BXZA 1PG7L 4Y4KA 4KK9D 2AGJL 4GMSH 4XCEA 1C16B 1ORQA 2ZUSA 4PJEA 4TNWF 5L2KA 5D1QA 4AG4L 3FRUA 3C2AH 4WV1B 1BZ7B 5FEBA 5MEND 1CTNA 2XWJB 3KGRA 5EU4B 1NCUA 2DM4A 3DI2B 3ALWA 2HVKA 4ALAL 4X5WB 4Y5VB 1YY8A 4HKBA 4PJ8D 4TRPH 3WJLC 5F7NC 1QP1A 2PW2B 5GRJH 4HPYL 3MJ8A 3G5VB 4M3JA 1CFQA 4X0KB 3WN5C 1EEZA 2VZOA 2ZSVB 5ERWB 3PJSA 5ESQA 2VLRE 5E5RB 4Y5YA 4WW2A 3O2DH 5BQ7B 4LARL 5FM4A 4EIGB 4ESKA 4RMWA 1HKLL 1S5HA 2N7AA 4GRWE 3BKCL 1KLGB 4HGWB 2AK4B 4WEBL 4NBXB 4P9ML 3VXUA 4DVRL 1MRCH 1IEBA 4NWUL 4D8PA 3CDFA 5K93A 1MCRA 2P48B 1DQLL 4BKLB 1V3LA 2JCCA 1KLUA 3CZFA 2R69H 5F9JB 1JN6B 1HN1A 3FB8B 4K94L 3FQWA 3S34H 3MACL 1TQCB 4HC1H 1HQRA 4KJQD 3ARRA 3M45A 3LS5L 3EIFA 4MQTB 4NRYB 4JRWA 4PPTA 5GPRA 3RJQB 4I0PB 4XP1H 2F58L 4RAHA 2Z8VC 2ZKHH 1FVDB 5FOBB 1UYWL 1LO3H 1YEIH 1IGIH 2MCG1 1H8OA 3JUYA 1U0QA 4QHLB 2C9AA 1AH1A 4QRPE 2DLEA 2RHEA 1MCIA 3HNSH 5FDWA 1J11A 1B0RA 4BFEA 4QRRA 5I73C 5J11C 1I7UA 4W68A 3RDTD 5LQBH 1I1YB 4H5SA 3EJZC 2AERT 3T2NH 5EU6E 5JORB 5IB1A 3FHQA 5CBEA 5I1LA 2D03H 2BP3A 3BUYA 3S88L 1HZHL 4NNXA 1KJ3L 1ITCA 2ICEB 3I85A 3SCMA 4K55A 4HZAA 4U1SB 4X9IA 5ALBH 4PRDB 3VGHA 4ELME 2NY3C 1V7NH 3P0YH 4PJAB 4FA8A 4KUZL 4CJ0A 3S7GA 4M7ZB 3ARDB 4E9LA 5HBBA 1BFOA 3BDYH 3PIQA 4JR9L 3K2UL 4PRHD 3KPNA 4O2EB 1XF5B 2AJYL 3W2DH 4JJ5B 1YEJH 1UB6B 3VD4A 2F8OA 3F7YB 4Z7UB 4JLRB 3O2VL 1BQHB 2FECI 1CI5A 2CLRB 3O6FD 3T0ED 4WI9A 4M02A 1QBMH 1RVFL 2VSCA 5DURD 5C08D 2NY2C 2OTPA 4MNQB 1JYVA 2MPAL 2H1PH 5CWSB 3QIWD 3K2MC 1J10A 4RX4D 1J1PL 4G5ZL 4FFZH 3TC9A 1BFVH 2P5WE 4MJID 3T2QA 2YSSA 1RHHA 2F19L 2YRZA 4LSUL 2OTWA 2VUYA 1AQDA 5GGSB 1WTLA 5DJ2A 1NGPH 3L3HA 4C58B 4PP1C 1EFXB 4E41D 3TYGH 4MVBC 3PWLB 2G75B 4HKXA 2GI7A 3PWPB 1UCBL 4PGCB 1T83C 2AJ3A 1G0XA 1CICB 1FHGA 1I3UA 1Q0XH 4ODWB 3QXVA 2BOBB 2CDEA 1G7QA 4YR6B 4F37K 1HCFX 3RJDA 4PJDA 1U58A 3GB7A 4N8CL 4XBPB 3MR9A 5C07A 1GGYA 3VXRE 2QTEA 4TPRL 3VA2C 3TO4C 5E4EC 3P73B 3WNPA 3VWJB 2UY7A 4FMKA 2AK1H 1TQBC 3WO4B 1DQML 3HE7D 5TDPA 5IT2H 1ZS8B 4BUHA 3T3PE 4MX7A 1QD0A 4XMKL 4OZHB 2SEBA 3O4LE 4ODTH 4YHZH 5C0IA 4ZAKD 4BK5A 5DR5L 4PJ9D 4XI5D 3BVNB 1M1SA 3V6OC 4EN3C 4PUBH 5D7KE 1BM3L 1J1OH 4D9LL 4LSTH 4R6UA 4LP5A 2IH3B 4NNYB 5FECB 2EC8A 1N2RA 1MFEH 4Z78A 2PR4H 1OTSC 5EA0L 4N68A 1W0YT 1JGLH 4XB7A 3UBXI 3GIZH 2YWZA 1OTTD 3KNBB 1X5ZA 1WQVT 1Z9MA 1DN0B 4CMHB 4HH8A 4JO1L 3ZKSD 1FORL 5CSGA 4G8EB 3ZE1F 3W39B 2OX5A 4YNYB 1YEDA 3BO8B 4MQXC 5LCVL 5E00A 4OLXH 2AQ2A 3ESVF 4O51A 5IMKA 5BS0A 5AZ2H 4DZ8B 1JFQH 2QHLA 1X7QA 1U8NB 5DXWA 5IQ7H 4BSWB 3U7YL 2AJZB 5J06A 3VE0A 1CZ8H 3AY4C 4U6XA 4MS8D 4YHMH 5HDLA 1FQ9C 2NXYB 1ZHKB 1CD1A 3U48A 4FOMA 3BGMA 2EIDA 4LRIA 5DFTA 5E5MB 1WAAA 1CYGA 2ZUQB 3QZWB 1JRHL 1VFBA 4QY8B 3VXQB 5DGRA 2FJFA 2V9TA 1I7ZA 2Q6WB 4PV8B 2YUWA 2M8XA 2DQFB 4MXVF 3CH8A 3PGCA 4LEOB 5D7IA 3D3VB 5E8EB 1HSAB 1S8DA 3NIDE 1YQ2A 5CSBA 2YKLH 4DQOL 4DN4H 3HUJA 5C0GA 4GW1A 5D7LA 1YEEH 3UTTE 1OAXL 2Y9RT 2ICWA 4KZDH 5CEZL 1ZTXL 4JFDA 4UB0H 2J12B 3TNNA 3O2DA 4JDVA 1KYOK 3RA7L 3MJ9H 1WC7B 2XNAB 4TSBL 5CP7A 1S5IL 2YUZA 3CDGA 4N9GA 3O3BB 1V5JA 3A6BH 4D0DB 2AV1A 2CD0A 5DMIH 3O3DA 2CJUL 4QTHA 2MKWA 1FVCA 1WK0A 3GMLA 5TDNA 35C8L 3RVTC 3B9VA 1ED3A 4LHUB 4A2LA 1F42A 1P69B 5T3XE 1LO5B 1Q9LA 4JM2C 5JW4M 4LPVA 2HTLD 1LHZA 4NJ9L 2D7TH 2XXCB 1FZKB 5IIEB 1HHHA 3NH7L 4LGSB 3ZHDA 4M1DL 2LU4A 2ZOLB 3MOQA 5DA4A 5CMAA 2NY4B 1NCDL 3VXTA 1UXWB 1GZPA 2ZWLT 2R15A 3OAYK 4Z7WE 4YBQD 3NPSB 4QYOA 1XGRB 3DUSA 4AL8L 3MLRH 1GGTA 3TH4T 1NKRA 4JRYA 4KKNA 2AK4D 2X4PB 4RGNC 1JWSA 4PRNA 2ZCHH 4HV8B 1SJHA 1IM3A 3Q6FB 3VFUA 3UZQA 2X9XA 1OSPL 1XF3A 5F7EL 3BW9B 3IFOB 4MZ3A 5D2NC 4WWKD 1A7QL 4HS8L 5D5MA 4BM7A 2A6JB 4M48L 4MA3B 1C7SA 1VENA 4NHUA 5IGXH 4TYUA 3H6JA 5B8CA 1M05A 3U36B 2WINB 4PFEA 4RMQA 3HAEH 4O9HL 4OCYH 2CH8A 4CU6A 1KC5H 3FMGH 5ALCL 4CBPA 5DD3L 4MJ5A 4NQED 1ZLSL 4GKSA 1GAFH 6FABL 1QTYT 2K3TA 2W9EH 4O58L 5IB4A 1FFRA 1UGNA 3QIBC 4O2CA 4GAJL 3K46A 1SEQL 3SOBL 1IEAA 4PB9H 1AGCB 5HXMA 2XTJE 3CX2A 4L4VA 1S3KH 4JGJA 4HS3A 2L7JA 4QHMB 1E4JA 2HG5A 1T7XA 3I84A 3NCFB 2VLKA 4WENB 4JFPB 5ICXB 4N8VG 1UH2A 4R7DA 5C1MB 1OOAA 3SPVB 1FZOA 4M1GH 5LGHL 4P2RA 4PIRF 1ZWIB 3CFDA 3BUTA 3L5XH 3GJFA 2WSKA 3DURB 1DL7L 4PJ5A 3SDYL 5EC1A 5FAAA 1D5ZA 3HZMB 3ARDD 3ZE2E 2GT9B 5IEKB 3UO1H 4XNMB 3OAUH 4ZNEA 4RMTA 2WQRA 3MGOB 1XGQB 2X4SB 4KUCD 1RMFL 1NGWA 1IM9B 2W91A 3B2VH 4F37F 2DIJA 2KZWA 2V2WA 3MV7E 2XN9A 3DYMA 3TBWB 1DLHA 5FO7A 2ZNWA 3LEXB 1CD8A 1QBBA 3VFWB 3QUMB 3GHEH 4HIXH 2IPTH 1UWEH 4MNQD 5TE4H 5FV2A 1ZLWK 1Y18B 1GZQB 3DXAE 3UMTA 1KCUL 4OIBA 2APWA 2HKHL 3MV9E 4QHUB 3IDIB 3SKNA 4LOUC 4PJ8C 4BQ6A 5JLZA 3H9HB 3MLYL 1T80A 2FGWL 1Q1JL 4JFXB 2C1OB 3MBXL 4OIIH 1N59A 5DJ8B 4KGLA 4JHAL 1RZFH 1JE6A 2DDQH 3KYKH 1FYTB 1E27B 4XP5L 1T22A 3WS6A 5CEYA 4KPHL 3W9EA 5C0AD 3NZ8A 1QO3B 4YPGA 1CICD 2A73B 5CJBA 5HI3D 4KJYB 1F6LL 2ED8A 1S7QA 2QADB 1CLZL 3RUGF 4MAUL 4Y16A 2R0KH 1TJGL 2DIBA 4EDXB 3OR6A 4MAYC 3JV4B 5IW1B 1RZIB 3CFEB 3O8XC 4JFZL 1R5WA 1JVKA 3SE3C 4LPYA 3E6HA 5IB2B 4FNLH 3SGDI 4WFHE 4RQQA 5A3IC 5TQ2H 2WK2A 5IB5B 5DQ9B 4FFVC 5DYOA 5GRYA 5I8OH 4PBVC 5MEQA 4OF6A 2X1WL 5DK0B 4RAVB 1NUGA 1IGML 1G7IB 3KPQB 4ZYKB 2ZUUA 4UBDD 4DGIL 5GS0D 1IAII 3EUUA 2VYRE 2QLVB 3QHFH 4X80L 3SJVE 3I02A 5E2TL 4PJHA 2DQEL 1ZT7B 1SM3H 2A9ML 4XP4L 1FE8L 4XH2B 1T20B 4C54A 3JSSA 4U6HB 5IROC 3HCVB 4UUJB 2HRLA 3GKWL 4MQ7A 5JHDA 2CRZA 3S6CA 3GGWA 5D8JH 1T66D 1EO8L 1ZA6B 1XF2A 3ROOA 4OZGE 1P7QA 3VWKD 2XOTA 3SGKC 4AEIH 3VI4E 3ZKXC 3V6FB 3LQZA 3TIEB 5F6HJ 1INQA 2EDOA 3U0TA 3WFDH 1MJ7L 1B0WA 4EQ3A 4HWBL 2AS5M 1TETL 1NGXA 2ARWA 2NXYD 3Q2CA 3MJ9A 4BYHA 3BPLC 4OSUH 1MCQA 1KB5H 5KOMC 1INEH 3NGBC 4G6AD 1G9ML 1TPXC 1BX2A 3IAQA 4RZCB 4F7TA 3NA9L 5EB9A 3UTZA 5FYKU 3QH3B 4S0TD 1JGDA 3TBTA 1YN6B 2FBJL 3NA4A 3VGBA 2BHZA 1QA9B 4YGVA 2C7UB 4UZGA 2CSPA 3O6FC 4HIEA 2O5ZH 4M7LH 5JR1L 3TYFB 3I6LD 2QQLL 2OSLB 3GM0A 1Y0LB 2Y36H 3D3VD 1BOGA 3HI1B 4AEEA 2F5AL 4ZOAA 1NBZA 3PHOA 4IIQC 4Y4HB 4CADA 3OJVC 4M3KB 4OCMC 3UTQB 5CEZE 3KPLB 4LKXB 3FB6B 1MCWW 3Q5OA 3D85B 5BRZB 3STLB 4GMSL 5I19H 3FZUC 4L4TE 4X4MA 4XBGA 3PP3K 5C09E 1E6OH 2NCMA 1HHKA 4WJ5B 1NCAH 4WGWB 5LAXB 1KUMA 2Z92A 4RWYH 5E8OA 3CJJA 1JHLH 4NP4H 2A9NL 2Y5TB 4KTEH 1V3MA 5ECJE 1KJ2L 3JXAA 3EYQD 3CU1A 1A6TB 4G7VH 4OUUB 4LHUD 1JNJA 5CCKL 1KBGH 5I15H 5J0BA 4RA0C 5ESAB 3LKOB 3TA3C 2BNQA 2FLBT 4DGYH 4QRSA 4X7SL 2YPLB 4XVSH 5HHXH 4UOW1 4X5XB 3HAEA 1LILA 1ZHNB 1AXSA 1JI2A 1LGVA 5HYQB 4MNHA 1VFMA 2YK1L 1JF1B 3ULVL 2HP4A 3RTQB 1G6RH 3MRQB 5JIHA 1PQZB 4XI5C 3BOVA 5C0EB 3F7VB 3UC0H 4C57C 3MCKA 4D3CH 2ZUYA 4HC1L 1U6AH 4L9DA 4PJXB 5CJXC 5KSBA 2CDFA 4M6AA 5GGTH 3VI3F 4FTVE 3I6KB 1N0XL 4XP1L 4G3YL 1MRFH 2ZKHL 1WFTA 3OF6A 4J8RA 1T04A 5HGDB 4D0CA 3BKJL 3TF7C 4IRSB 1IGIL 1OTTC 5L8LB 4U0RC 4GKNB 2MOVA 3FFDB 3QDJB 5BZWB 4GRMB 3DBXB 1D5MB 5TE7L 3HNSL 1OT2A 1MCJA 4G8GE 4NO3A 3FO2B 2X1OA 3RPIB 5DDHB 5I1EH 3T2NL 2EDYA 3MBED 5IFJB 3TFKD 1TNNA 1X4YA 4Z9KB 1JYXA 3QQ3B 2YA1A 3S3JA 4AMKH 4K3JL 3NZHH 3DMMB 4ZODA 5EC2B 43C9B 1BF8A 5I1CH 5DJXA 5ALBL 4G9FA 2NY6B 3QCUH 2UVFA 4LNRB 1ZHLB 4U3CA 3RKDC 3CNKA 3NCYP 3C8KA 1T83A 2YPKA 3AM8A 3NFPB 2AXHA 4DK3A 5F1OB 5EOTB 3RGVD 3BDYL 5GZNC 3I2CL 5C0BB 2X1PA 2EKJA 3EO1B 4X6CA 1HXYA 5SWZA 2E6QA 4XC3H 2XV6B 5E5UB 3W2DL 2JJUA 1MFBH 1R24B 3IRPX 3TO4A 1JGVH 1TITA 5FA4A 3AREC 3U46A 1T0NB 2Y25A 5FM5M 2YZ8A 4LPXA 4WI3A 1RHFA 1IM9D 3DSFH 2ESVE 4GUPB 1I8MB 2ZZUT 4WU7B 1QBML 4FG6D 2X7LB 4XCCL 5HYJA 2IAMB 4HFUH 4C59B 1B4JH 3KPRA 3V6OA 1VADB 4EN3A 1H3WM 3LQMA 3VCLA 3VMNA 5EOCL 1P6AB 5KS9F 4J3TA 5GZOD 4UIMA 1NCTA 5E2JA 1J8HE 3G6DH 5JOPE 1BAFH 4XPHL 5F1NB 1U8JB 1J0HA 4AM0B 5EBLA 5KJRH 3PDDA 5DD5L 1W0WA 2J8OA 4U05A 4G7YH 5ISZE 4OM0H 1OVZA 3EO0B 3DTXA 1RY7B 4IHOA 3MA9H 1LK3H 4PRPB 1XR8B 3IAGC 3BP7A 2NY5C 3V0AC 5DEGA 3L5HA 3P0VH 1AC6A 1WZ1L 1S7RA 2ZG2A 1FYTD 4WO4A 4YBQC 2YHGA 3QEQE 1BVKA 4DN3H 3GSXB 3SE8H 4D2NA 4R90H 3UTSE 4WW2F 2VB5A 1MHCA 4F58H 4NM8H 2EZ0C 4ONFH 2DLIA 4KI5F 4YFEA 2NW2B 3BGFB 5EBWA 5E9DB 1XR9B 1A2YB 3AY4A 1DEEB 1RZJL 1OP3H 3MYZA 4FQCL 1DQQA 4G6JH 5IT2L 1A4KA 4LEXL 4ZUSB 3FTGA 3TJEH 4H20H 1EDQA 3MRBB 4YHZL 2EDWA 3E1F1 3P3YA 2OM5A 3TZVC 1WBXA 4JANA 2XICA 3MRMB 4PUBL 4W4OC 3QUZC 3KXFD 4QOKA 5TF1L 5GRWA 3ZDZE 2LV4A 3VJ6B 3VA6A 4P2QE 5CJ8A 4GQ9L 4NNPH 4BH7B 3LZFH 1FSKC 2H2PC 1OSZB 3KS0H 3UYPA 4ZTOL 1KJVB 3EDJA 4Y5XC 3SO3C 4XVUD 1N6UA 3OX8A 5FYJH 4XRCB 4WHDA 3UEZA 4PJIE 4MSWA 2HJKA 3O4OB 2H8PB 4PJ7F 3HC3H 3GMOA 4UINH 1FZMB 4ORGA 2X4TB 1HSBA 4Z77A 4QGTA 1KB5A 5HHNB 5FYLD 4AYFA 5JZ7D 1J0IA 1FL6A 4KKAD 9CGTA 2OYPA 4YFLF 2XG4A 1D6VL 3CVHH 4NDMB 4JHWH 5ID1B 3LEVH 4JG0H 4KRNA 2JKXA 5FYKD 4PY7B 3NCYS 5TE6H 1HHGA 1QYGH 5A16B 1MPAL 1SMOA 4PGZA 2OJEA 4JM2A 4YHML 3BZDA 4JFQB 4UT9H 3BH8B 5EO9A 4G6ML 4KTDH 4O2FB 2IQ9L 5JMRA 2I27N 5DVOA 1GHFH 4HXAH 4Y19A 5DD0L 3HNVH 4OCRL 1R5IB 5C6TH 2P8PB 3KYNB 3D6GA 5FK9B 4CMMB 4YO0A 4RFEB 3TPUB 4PS4H 4LVOC 3U7WL 3ILQC 3VD9A 3HKFA 2CK2A 4HHAB 1BBJA 1KB9J 2ZCKH 1FZJA 2FEEL 3GI8L 3O6KH 1NGZB 1VPOH 1VB9A 2M26A 3VD5A 4X5LA 1YEEL 5D2NA 2I25N 4XNZB 1F97A 4NQTA 3EJJX 3BZEB 4UB0L 2BNUA 5F1IB 4N0UE 4JY4B 3S36H 2CIIB 3D85D 1Q94B 5BRZD 4LLQB 4HDIB 1CDUA 2QHRL 4H25B 3OKLA 5KVDL 1JNNL 1EVUA 5JO5A 1W8OA 4WW1A 1ZVHA 4L1DA 1GIGL 1O0VA 3RWEA 4JZJB 4JFHE 1MREH 4OQTH 2KBGA 3GJFK 4NN6C 1MCDA 2Z4QA 1G6RA 2W9DH 3PABB 5IFAH 2D7TL 2FZ3B 2PNDA 3IDNB 2DL9A 3CXHJ 2JIXB 2CR6A 4U1GC 1X4ZA 5GGTA 4JZOB 3N1PC 3QIBA 1HOCA 1I7RA 2J3SA 1ACYL 5HI3C 1U93B 3L3IA 4J3OC 4YXKH 2DYPA 2R1XA 5BMFL 1XMWA 2YPLD 3MRDA 4PJDF 4IOIB 5EUOB 5T1MA 3QDGE 4M8QA 3GJEA 3MXVL 3KJ4C 1RD6A 4N90E 1DSFL 2ZCHL 1KIQB 1TJHH 3EOBA 3KDMB 2BXYA 4DGVH 3ULVE 4D9RD 4YQXH 5C86A 2VJXA 3FFCE 3FHAA 3WUZA 3C5ZA 5L9DH 4U1NA 3MLPA 2MQCA 3DV4B 3RTQD 3WNMA 2AW2A 4JKKA 2R2HB 5DWUH 3BI9X 4K8RC 4Y88A 1OP5H 5EZIL 8CGTA 2Y6SD 3CH1B 5IGXL 2P4AB 1MI5B 4NCC2 3DX7B 2CDGA 2IPKB 4HBCH 4UBDC 4WUKH 3C8HA 1VSCA 1A9BB 3ZDYF 3A0OA 1KC5L 3OR7A 4IRSD 4DZBB 2DRUA 4DW2L 3WFEL 1F4WL 4JDTH 3RWFA 4HS6B 3QDJD 3QQNA 1U8IA 1CBVH 4H88L 4OZFH 4KRMB 4Z6AT 2EIZA 2V7HB 4KV5F 1HH9A 4OCWL 2D7QA 3UCRA 5IESH 1NUFA 4D94A 2PYEB 2VLJA 4CU7A 5MENA 3DVGB 4J2XA 1F6AA 2W9LA 3F12A 1FL5B 3PNWB 1DBAL 3UBXA 4HUMB 3VWKC 3BHBB 3M1BB 4HPOH 4XNQA 5JPMA 4TULH 3VRJB 3HR6A 5JPNA 1S3KL 4GOSA 4PJ8A 1H9VA 1KPRA 4PBXA 4PREB 2EDBA 1JGUH 1FH5L 1YMMB 4NUGL 5JDSB 4M1GL 1FO0B 1GGIH 4FHBD 4LL9A 1YUHA 4OFIA 2G2RA 3QJHA 3SGDH 1MWAB 3L5XL 1BWWA 3G08B 5HD8D 1HHIA 5F9WC 4N8PA 2NLJB 5IVNA 1WAAF 3UO1L 1NEZA 1MCKA 2AJSH 3HZKB 3OAUL 5GJSL 1FNGB 5C0BD 1MIMH 4JY6A 1IAIH 3S4SB 4U7MA 4YUEH 1H3GA 2IG2H 3TIDB 3B2VL 4C4KT 5ACLA 3WLBB 5D7IF 4MAYA 3ECBA 3BE1H 2VWEC 1PLGL 1R5VA 3O8XA 5IFHL 5A40E 3D25A 2YN5A 5GRZA 2PTUA 4WRLA 1I9JL 3SE3A 5DJDA 2R0ZH 4OT1L 4F7EB 3HUJF 5JIIA 4K23L 2CKBL 2NY5H 4QWWD 1OGAE 3GHEL 4ONOA 1HWGB 1UWEL 4IM8A 4P5TC 5AG8A 4Z5RB 4DWHA 2OR8A 5ADPH 5DJYB 1TTUA 1QQDB 1GGCH 4HAGA 3S35H 3QFJE 4BH8A 2WP3T 3O6MH 2H9GB 5T33H 4PV9A 2D9CA 4GXUN 2XT1B 4R2GB 3EFFA 4LCYA 2N56A 5CILH 4IS6A 5E1AA 3A6OA 2VLLA 5HGHA 1MJUH 2DDQL 4I3RH 4PRPD 4ZUVB 5IROA 3EBAA 4LDOB 2XWBB 2R4RL 4U2YA 2VIRB 3C9NA 3FB5A 4HF5H 5FKAB 3GSWA 1U8KA 4X6FB 2Z31C 3SGKA 3CFBA 3VDAA 3PHQA 1UKSA 5DHYA 1S7WB 5INCA 2R4SH 2X4NA 1U8PA 1GSMA 1R3JA 3SKOA 3TCLA 1B90A 2AI0L 1X5LA 4P5MB 1MCPH 5KTEH 3K4AA 3CVHA 4K9EL 1CDIA 3UJIH 4HWEH 5TQ2L 2J88H 3Q1SH 3IFNL 5F89B 4GAGH 5I8OL 4PJFA 3FKUS 3QG7L 1N26A 3TT1H 5D5MF 3ZYZA 1QSVA 2BZDA 1FG2A 3ZE1E 2R2EA 3O6FA 4OLVH 5I75B 4M6NH 3VXSB 4H26A 3QXDA 1T7VA 3MLTA 3IU4H 1FNEB 4QHKI 2NY0B 1U8HA 3MV11 3QPXL 2GJZB 2V5SA 4OAWA 2BC4A 3RWIA 2PTTA 4IIQA 3QHFL 4JPKL 5AZEL 2YD6A 4F15C 1F11A 4S1SH 1XIWB 4RGMB 1KG0A 1CXEA 3V6ZB 1CDYA 3QDMA 3AFLA 1NLDL 2DQCH 4JCMA 1J18A 2IADB 2GJ6E 4HXBH 2FHFA 2X70B 5HDBF 4YE4L 1IT9H 2P8MB 5IOPA 1QSFD 1XGYH 4JFYB 1T6VN 5DQDL 4YBLC 1VGEL 2FR4B 4E41A 3QA3A 1DVFC 1D5XB 1UM6H 1I1AB 4TUJB 1DANT 1ZGLB 4ZO9A 1I8LC 5E9DE 3M07A 4X4YA 4KDTC 2X05A 4GAYA 1BD2D 4MXVE 3QIUB 3ZKQD 4GO6B 4PLNC 3TA3A 1KB5L 4HUKB 1INEL 5GGUA 1YEGH 1Q9KB 5KG9B 5HI4D 3QQ9C 2V5RA 3JTTB 2UWEF 3GUTB 4LLWB 4UNTA 3SKJH 4OQTA 4Y2DD 4ZSOA 3FCTA 4UTBH 2CXKA 2O5ZL 4M7LL 4UV7H 2YD5A 4Z76B 2BRQA 3HC0A 3S3PA 1JNHA 2WV3A 2Y36L 4OLYL 4Q9QH 1AGEA 4JEGB 2Q87A 4ZAKA 3P9MB 3L3DB 2W1NA 1MAKA 5D2LA 5B39G 1NC2B 3QB7C 1Y6MR 1HI6B 2XWTA 5I19L 5GZOC 4NQDE 5CJXA 2BJMH 4XC1H 5H35A 2IANE 4YWGH 3BYYA 5C0JB 1E6OL 4WHCA 3MRJA 3U1SH 1Z6JT 3D39A 1JHKL 1YPZE 1NMCB 2V5YA 3B6SB 4OKVB 4FQQA 4PRIA 1JHLL 3MLWH 3T4AB 4NP4L 5FF6A 1I8IA 2CLVB 5GRVK 1BQSA 4TVPD 5D1XB 4WTZA 2KKQA 4OF7A 3IDYB 1ONQB 1CGSH 1KBGL 5EBMB 5I15L 3GBML 2XRAH 5L6YL 2Q8BH 3ILPA 4NPYA 4LLUB 5EG6C 4S11A 2A6IB 3TVMB 5B38G 1T5WA 4ZUTB 4K8RH 5GSVB 3LKQB 1QLEL 3D0VB 3VFGL 4FQJH 2NYYD 2CRMA 3WIFB 4YK4C 1PDKA 2HRPH 3IDGB 5TH2A 4EDWH 4QXUL 5GQBA 2I60H 4FXLA 5EN2A 2FDBP 3PDOB 1WBZB 1QHOA 4OZFA 2FH8A 3VXOB 3JWOL 4KJPD 1MVUA 4HGKC 2UZYB 5DRZA 2BK8A 2VISB 2F53B 2CR3A 2Z93B 1OAQL 5EO0A 4EXPX 3F7PC 4WEMB 4ZPTA 2PXYB 3BSZH 3O45B 5IVZB 5GGTL 2J8UA 3OV6A 4JRXB 1RJLA 4Y4KB 4X4XA 5HYSA 5F96H 4HULB 1II4E 5EOCJ 3GSNL 4XCEB 4PJEB 2VZ3A 3QCTL 1U3JA 3SO5A 3N1MC 3N1QC 3NPZB 1FNAA 5D1QB 5L2KB 3U30C 3FRUB 1NC4A 1HEZA 3AREA 1NDGA 5DT1L 3U4EA 1A3LH 5JZ7C 4P23C 4K2UH 2HFEA 3PQYE 4U6YA 2HVKB 1X5GA 3AU1A 3IDMA 3PL6D 1A3RH 4PJHF 5I1EL 1YY8B 3GBLA 4HKBB 4HT1L 5EORH 5J13B 2P45B 3MJ8B 4DEPC 2D9QB 4LHQB 4I1NB 4KRPB 1CFQB 4R97B 3MSPA 4AH2A 1EEZB 3MO1A 1VKXA 4AMKL 3PJSB 1XCQA 5ESQB 3VFPA 3NZHL 3NCEB 3F8UB 1JPSH 4Y5YB 3L3JA 4WW2B 5EZOH 2HLFC 5IB3A 2DM3A 3H3KA 2XZCH 3PP4H 5AEAA 3BJLA 1S5HB 1A6UL 3VXUB 3HTLX 3QCUL 1VHPA 1YMMD 1WWWX 3LRHA 1IEBB 5CZVH 4D8PB 3QI9C 2Z8SA 1GCFA 1UKQA 2JCCB 1KLUB 3CZFB 4Z0XA 1AFVL 1UG9A 3TJHD 4W81A 3FQWB 5MI0C 1NBQA 5IW6A 4EI5D 4XC3L 1QSEE 4JPVL 3NCCB 1GH7A 2DD8H 1MI5E 4WI2A 1RUPH 3MX0A 2P8LA 2G60L 2GAZA 2X9WA 4AENA 4M43H 4WWKA 3RWCA 4O4YH 3IXAA 4HFUL 3TZVA 1B4JL 3Q6GH 2DKSA 5HGAA 2O5YH 4L3EE 4MB5A 4W4OA 4M62H 3QUZA 4XNYL 4YGAB 5FDWB 1B0RB 4QRRB 2P49B 1I7UB 1BGXL 2PYEE 4H5SB 5JUEL 4K7FA 3QUXC 1D5BA 2B7DT 2L0DA 3AB0C 2MKLC 3PF2A 5IB1B 5KVEL 5EOQL 1U92A 4TSAH 4NQEA 1UENA 5CBEB 5I1LB 5KJRL 4OZ4A 5FIEA 5IBTL 3BUYB 1HHJA 12E8H 4NNXB 3RNKA 3L3GA 4NZJA 2ADFL 3MA9L 3GDBA 3SCMB 2M1KA 4RBPH 1MRDH 4MHHG 4NO2A 3RUGE 1BMGA 3P0VL 4EJ1C 4UAOB 4BSVA 4XPBH 4DN3L 3SE8L 2VRAA 1CD9B 1T7WA 1HE7A 4ERSH 4HD9A 4F58L 1BFOB 3PIQB 1HH6A 3KPNB 3WNKA 2DMCA 1HYRC 3F7QA 4YAQA 4YHYB 3ULUL 4X83A 4G6JL 3DXAD 2R2CA 1IAIM 1UM5H 3V4UH 3MRHA 4LBEA 4RSVA 2DWEA 2FJGA 3TJEL 4KKBD 3RZCC 3EDDA 5BVJA 5ANMB 3MFFA 1AQKH 2J7LA 5IHLB 3MNVB 1LWRA 5KSBF 3VMPA 3LZFL 2B2XH 1M7DA 3CDYA 4ODXA 3MLZL 2EDNA 2ERJB 3DVNB 5FYJL 3KPSE 5I17A 3EHBC 3VXSD 5TDOA 1RU9L 2YSSB 4OCLC 3WFCH 1RHHB 2VDKH 4UINL 2J4WL 2NY0D 2OTWB 4WHTA 1LDPH 1AQDB 5CBAA 1EA9C 1UACL 3L3HB 5DJ2B 2LU7A 3CAFA 1XIWD 2AXJA 4HKXB 4HLZH 2I5YH 4POZD 4JG0L 1OPGL 2AJ3B 4PTUA 5E2UL 2DI7A 5TE6L 3RU8L 2FX9H 5I9QC 1LP9E 4QLRA 1PZUB 2CDEB 1G7QB 4Y2OA 3MV8E 4PJDB 1U58B 3GB7B 3MR9B 4UT9L 5C07B 2QSCL 5HD8C 4ZOEA 1VFAA 3MA7A 4L5FL 1I1AD 3V4VH 3ARFC 1T1ZB 3GMRA 2LAAA 4CVXA 5C0AA 3WKMH 3QIUD 1K6QH 5TDPB 3VGAB 3QCVH 4MX7B 1IGFH 1RI8A 5C0IB 1CT8A 1BZ9A 4PS4L 2E3VA 3LS4L 2VKXA 4X6CF 1DCLA 2NMSA 5I6XC 4L29A 1F00I 1N2RB 2ZCKL 4Z78B 3LN9A 3C5SA 5F6HI 4HFWA 4JKPH 4V1DA 1KEML 5EPMA 1ZV5A 3FO9A 3QULA 1CVSC 3T1FA 4OGYH 4UV4H 5C9JA 2B1HH 3UYRH 3F65A 1YEDB 3A67H 3W5NA 5E00B 4C55A 2V5TA 4OV5A 5IMKB 4O51B 5BS0B 1MREL 2PO6C 5IVXA 2EXWC 1X7QB 2HFTA 5FUOH 3T77A 2W9DL 5HYIA 4N0FA 4TUKH 1S9XA 3KG5A 5C6PB 4F7PA 1HCVA 1IQWH 4R7NA 5D1XD 3VE0B 3HG1E 4LLYA 4U6XB 1WCQA 3HPJA 1YYMH 5DVKA 1CD1B 1KCSH 3BGMB 3RL2A 4U0QB 5I2IA 3FT2A 4NO0D 3VWKA 2AJUH 4UOJA 4ZS7H 1VFBB 2C3HA 2FJFB 4MYWB 1TJHL 1I7ZB 3SDXA 5H94A 4Q6IA 3SDDC 4YQXL 2LTQB 3PGCB 5D7IB 2CO7B 1BF2A 1S8DB 1CK0H 3D2UD 1H3VA 2B1AL 1MEXH 5DWUL 3QHZH 5JW3H 3HUJB 5C0GB 4GW1B 5FYKH 5D7LB 1P84K 1OP3K 2PXYD 2ICWB 3BD3A 4JFDB 1UJ3A 2V7NA 4S1DC 3TNNB 4JDVB 3KWWA 5FM8A 4WUKL 5F6IC 3RWGA 5F9DC 3V8CA 5CP7B 3CDGB 5C7XH 4N9GB 3IF1A 3LD8B 2A38A 5D1QD 4NKIH 4JDTL 2AV1B 2YD7A 5B4MD 4OBRA 1QPXA 1JF6A 3O3DB 1RUKH 3ARBC 4QTHB 1FVCB 3GMLB 5TDNB 1ED3B 2EKSA 5CS7A 3H8NA 1PVHA 4A6YH 1Q9LB 5GISL 3JV5A 2EDXA 4P5TA 4YDIH 1U8OA 1X5HA 3MCLL 1N7ML 3LPFA 5KW9L 1HHHB 5C0CE 5SWSA 4X4ZA 2BVOA 3VFMA 3V0VA 2AV7A 2BSTA 4TULL 4KRPD 5CMAB 5GGVH 3MXWH 2I24N 2ENYA 4H1LH 3VXTB 5ITFA 3BWAA 3QQ4A 1GZPB 4GT7A 4HIIA 4I2XE 3SE4A 4QYOB 3DUSB 4HEPG 4FTVD 4JM2F 4MD0A 1U91A 4JM4H 4JRYB 1JWSB 3H3BC 4PRNB 1HQ4A 3D5OF 2QR0A 1SJHB 1IM3B 4X6DA 3VFUB 5D7SH 4K3HA 2F53E 1XF3B 1A0QH 5CGYD 1IEHA 4Y2DC 1L4IA 1T21A 4G8GD 3V79C 3VW3H 2Z31A 3OHXB 4K3EL 4NQUA 4JRXE 5D5MB 4G8FA 1SY6H 5KS9E 4NHUB 1M05B 5L2KE 3ARZA 3O9WC 4KQ3H 1JYNA 4FQLL 5ID0B 1L7IL 4O02L 1ZKAA 4XMPH 3FJTA 4L8SC 4ZFFA 3HPLA 4M4PA 1RPQA 4MJ5B 2N7BA 4BQBA 4GKSB 3RVWD 4XAWH 3PXJA 5ICYA 5IB4B 3RI5K 3O6ML 3CGTA 3CC5A 4IRZH 3HN3A 4O2CB 3HNTH 5AUMA 3GO1H 4YBHA 1IEAB 1F02I 1DBJL 4XNUL 2VH5L 4L4VB 3L3OA 4P9HL 3I75A 4FFWC 4HS3B 2HG5B 3BKYH 3FQTA 3MBEA 1H0DA 4KI5E 2VLKB 3JVGC 4PJBA 4UDUA 1A7PH 2ZG3A 4R7DB 1XCTA 1FZOB 1IGTB 4P2RB 2H45A 3H7LA 2WNGA 3CFDB 4OKDA 2HN7A 1UH3A 3GJFB 5H8DA 1MOEA 1H3UA 1NEUA 2BFVL 2COQA 4PJ5B 3QUYD 1A6AA 5EC1B 1WZKA 1D5ZB 3ETBF 3ULUE 1CFVH 2R0WL 2I9TA 3HI6H 2FBOJ 3DROA 1C5CH 3C60D 2ORBH 3KR3L 1I8LA 4GRWH 4KDTA 4KH2A 4OV6F 5DF0A 3UJJH 5KTEL 5JOPD 3RGVA 1NGWB 2AABH 4GXVL 2V2WB 4HWEL 1I9IH 4NWTL 2XN9B 3Q1SL 4PJ7E 4GAGL 1VGKA 1DLHB 5FO7B 5IMLA 3UTPE 3QXWA 1V7MH 4P5KA 5I1GH 4QRRE 2XA8H 3EW3B 3OJ2C 4RWHA 4NC2B 1JRHI 4MWFA 3T3MF 4XCFL 5DUPH 2AJXH 1OP5K 3SKNB 5EULV 3TBVA 1MCOL 1UA6H 4OLZL 1HYSC 3BKML 5JLZB 4HZLA 3OXRA 1Z0MA 3O2WH 2VR5A 1JZ8A 1N59B 1QRNA 4HUXA 4U1IA 1IT9L 2EDTA 1T7ZA 1XGYL 4NM4H 5HHVL 1T22B 4CU8A 4Q9BA 5CEYB 4G43A 4OCNC 3VG9C 3W9EB 4PD4K 1JJUA 3NZ8B 4YPGB 1X44A 5CD3A 2F9BT 4NOFA 4P2QD 1S7QB 3KPOA 5GGQL 4Y16B 3EDEA 2AXFA 2PKDA 3CX5J 3F62A 1YEGL 3OR6B 3X3FL 4MD5A 2D31A 2E7LC 3K80A 1E4XH 3VH8A 2GKIA 4PGJA 1R5WB 3WNLA 4EI5C 1LNUA 4OUOA 1QBLH 4X99A 3E6HB 4JY5H 4FQIH 5ANME 1BQLH 3SKJL 3QHTC 3H9SE 2CLZA 3E8UH 4RQQB 4Q2ZA 2ZNXA 2NW3A 5DYOB 1BJ8A 2VDOL 5MEQB 1S9VA 3DETC 4M7JH 4KJWD 5CIPH 4Q9QL 2MMXA 3OGCA 4LNVA 1LEKA 2XTJC 5JIKA 3S5LG 4ZFOL 3ZE0F 3KXFA 5DMKA 1UM4L 2PETA 2BJML 4XC1L 5HTSA 4NQXA 4YWGL 3EGSA 3I02B 3MUJA 2YD1A 4PJHB 4NN5C 5JXAL 2BMKA 4LGRB 3U1SL 1ZA3A 1UVQA 1KT2A 4MQ7B 5JHDB 5I74C 2ZG1A 3T2OA 5GGRA 2VERN 1OTUD 3SDAB 3TBSA 4OIAA 4S2SA 3ROOB 1XF2B 2P24A 4P23A 3CIQA 1P7QB 5ACMA 3LQZB 5C07E 1INQB 2N4IA 5CD5D 1J9CT 3BN3B 1ZHBA 4ZD3H 3N06B 2DKUA 3SKMA 1AKJA 4APQC 2VR9A 5K9OA 1NGXB 4W6XB 5E2WH 1RUMH 4K8RL 3AMLA 4ZXBD 1U36A 1R3LA 3RWHA 4F80A 2HRPL 4HH9A 4EDWL 1BX2B 2KH2B 4F7TB 5TGBA 1KF9B 3UTZB 1CE1L 2DICA 1JGDB 3TBTB 4MB4A 4DKFH 5GGSY 4YGVB 4KKBC 2IGFH 3V7AG 4HIEB 2W0LA 1NAMH 2P47B 3DI3B 3QI9A 3QRGH 1BOGB 1P9MC 5EZLA 4PG9A 1NBZB 3PHOB 4F3FA 5I76A 4CADB 1P7KA 5FDYA 3K0WA 3L1OH 1U3ZA 4UQ3A 1KGCE 4H1LA 3G5ZA 1RIUH 4PJFF 3EYOA 4KV5E 5D7LD 2VNCA 4XBGB 4JFDD 3NFSH 2AEIT 3IDJA 1HHKB 5DSCA 1LO0L 3M17A 4BZ2H 3QPQD 2DQIH 2Z92B 5E8OB 4K2UL 2E7HA 5D6DC 3QUKA 3PGFH 4GG8A 1FN4A 2VZSA 3QDGD 3CK0H 3CUPA 1IQDA 2VE6A 4N90D 4OZIA 2X4RB 5J11B 5DO2C 2FO4A 3OB8A 4Q74A 4ZFGH 1Z3GH 3WFZA 3FFCD 3QUXA 1B6DA 1F4HA 2BNQB 4QRSB 1SY6A 5EZOL 2F5BH 4OGXL 3FN9A 4NFDA 5ITBL 5IBUG 2OMNA 2XZCL 5FFLA 3BEWA 4JFEE 3R1GH 3WIIH 1I9EA 3HAE