2ZWLT

Human factor viia-tissue factor complexed with highly selective peptide inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human factor viia-tissue factor complexed with highly selective peptide inhibitor
rcsb
molecule keywords Factor VII light chain
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 43
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zwlT02
3NIDF 3D87B 3QXAB 3VXSE 5D93B 1RUPL 2GAZB 1YYLL 1T0MB 2VNCA 3RWFB 5ALCH 2L4OA 4JDTL 4DAGL 5HDBF 4HV8B 4CRPA 4LARH 5DJZB 4YR6A 3SE3C 5CINH 4N90D 4L29A 1Z0NA 1X5KA 5DO2C 4YEFA 4GSDL 1G1CA 2OZ4A 4W4NA 3F7QA 3RPIB 4X5LA 3WIIL 3N1PC 3GMPB 1QLFB 5GGVH 3E6HA 2IGFH 1ORSB 2IALA 2R8SH 5J12B 2VE6A 1G84A 3P4MB 2DLTA 4FQLH 3SQBA 3IDIA 2YD1A 1HCFX 2JB6B 3KYKH 1ZGLA 1RULL 2DQUL 1YNKL 1TLKA 3QUXB 4HX1A 2PW1B 1UKSA 1QOKA 1U58B 1HHHB 4ZMAT 4KK9C 2QTEA 3QUZB 3QDGA 4XMLL 4D9RD 2OTWA 3DRQB 1NGWA 1RIHL 3TIDA 3C60A 3L1OL 4LSPL 4FFWC 4Y1AE 3RPKA 1NFDB 1D6VL 4MWFA 5B39G 4TUJA 2PW2A 1N0XH 3IXTA 2E9BA 4UNUA 3T4YA 1RPQA 4YHZL 4HXBH 1BGXH 3RVWC 5EC1B 4N8VG 5IG7B 5TDPB 3UTZB 3N0PB 2F54D 5LWYH 4XI5D 1OW0C 2BC4A 5DK2B 4OFVA 1IVLA 1FRGH 1ZLUK 2VL4A 1MSPA 3GHBL 3DI3B 1IQDA 5ALBH 1YNTB 3AM8C 3FRPG 4JFXB 5FYKL 4LSRH 1A9BB 1AC0A 1PZ5B 3D9AL 1LK2B 4PJ9C 3L7FB 4MA8L 4NO5A 2K1MA 3OKEA 3LDBC 5JW5A 3MGOB 3ZDXF 1D6EA 3O2WH 4UDTA 1NGPH 3UO1L 4PRHB 1T83C 4GG8A 2FB4L 3JTTB 1M7XA 4MZ3A 3R8BB 1QEWB 3CVHH 5LAXA 1DQJB 3ULUC 4M4PA 4OBRA 3WHXB 4F58L 4OFYA 2C5DC 5CP3H 1C16B 1AKJB 5FYJE 4LCUB 2A1WL 4OLWL 3HE7B 1LO3H 2P1YA 4Y0GA 4N0FA 1KCSL 3QQ4A 4GW5B 1RJLB 4XAWH 2V5TA 3I02A 4P9HC 3PF2A 5ID1B 4PJXB 4DOHE 1KLUB 4PJEF 5HDOA 1FFOA 4PTUB 4YGAB 3SDDC 1IGML 3OXRB 1A7RL 3RBGA 3QHFH 2Q7YB 1AD9B 2DQTH 3O3UN 3P0YL 3RKDD 3KPNA 1NGXB 4X98B 4RNRB 1RAMA 4NYLB 4H1LA 1UCBL 4ZODA 3AREC 1JGLH 3LN4A 3ARGC 4I13B 2VZOA 3H0TB 5B3JE 1I9IL 4IRSD 1B4JH 3TESA 1F02I 4UILL 2VITA 4OQ1A 2B5IB 4YHPA 3LN9A 4R7NB 4UU9B 4X5XA 2Y4SA 4GRWE 2X4TB 1RD6A 2ATPA 4W68A 3UBXB 5F3HA 1A1NB 3VFOB 1UG9A 2HFEA 5LGHL 5C0GA 5D8JL 1OAYL 1ZANH 4PV9A 1BVKB 3OB8A 4QOKE 1DBBH 4LHJB 2B0SL 4ZFGL 1NDGB 3P40A 3O8XA 3VRLF 1FE8H 4I0PB 3BVNB 3EYQD 4F57L 1YEEL 5HI5D 2W0LA 1NQBA 1UXSB 3D0VB 4DZBA 1XAUA 3SOBL 2I07B 3B2UC 3GHEH 2VLRB 1GPOH 2VXUL 4BKLA 1D9KA 2A6IB 5ACZB 2AS5M 4G42A 1UKQA 1PAMA 4QWWC 3CFDA 5FO9B 5FEBA 3GSUA 1A6VL 4Z7VA 3QDMD 3BN9D 3OAZH 5D5MF 1I4FA 2J5LC 1KN4L 4TUOA 3MOBH 3RVTD 3UMTA 5GISL 1P6FA 3VRJA 1MCOH 3Q6FA 1Q72L 2PCPA 3UROR 5EOQL 5C07E 3P77B 5CSZA 5IR1B 1J0ZA 2IPUK 3PQYB 5D2NE 3RVVC 3I75A 1PYWB 3QEHB 2P5EA 4CMMA 2F8OA 2H1PL 5DK0A 3MBEA 1JZ4A 1DLHA 1IGYB 5AYQA 3VFMB 5C86A 4Y19D 2NXYC 2DWEB 4G43A 1YEJH 3AB0C 2DQJH 2XA8L 2DYPB 5JUEH 5JXAH 1QRND 2PUQT 4MJ6A 4WU5B 5ILTH 1EMTH 1ND0B 5KS9A 4LVOC 1RUML 4B5EA 3QZWG 2X89D 4XP5H 2I5YL 1XR8A 1TCRA 3SQOL 1FCGA 2IPKB 3EGSB 3STZB 2J1KA 4FQXD 3EO9H 3K8KA 4FFZL 1OPGL 3BWAB 5JDSB 1BFSA 4E41B 1MFDH 4NO2B 1OCWL 3NZ8A 4HGWA 3C5SA 4MLSA 4K3DL 3MV8D 1KF9B 1UA6L 1R3KA 4ZAKC 4QRSB 1MHCB 1KACB 3AUVA 1TZGL 4PJ9B 3LDBB 1LQSR 1Z2KA 4Z78A 4XT1C 3UYOD 5CZXC 5SX5H 3PG2A 2NY5L 3H9ZA 1WISA 3BHBA 4XNYH 3E1F1 4PJGA 2ICWJ 3BP7A 4GRLC 4D0DA 2FBJH 5H94A 3OXSB 1A1OB 1N6QL 1VFMA 4OI7A 5IF0B 2ZG1A 5TE6L 3W39A 2F53E 2DQEH 5GRUH 5IB2B 4QY8B 4X83A 5F1OB 3VFUA 3SDDB 3BKCL 3TO4D 4M02A 1I3RA 2FH6A 4N8VA 4QHUB 1EJOL 4OGZA 1Y0LB 4MAUL 5E5RB 3N9GL 3OGCA 1V3JA 2GSGA 1LO2H 3MGAA 4J3SA 4XRCA 5CS7A 3F7YA 1I8MA 1FDLL 3BAEH 1P84J 2BVPB 2I9LB 3BUTA 3AREB 3D39A 3ARGB 1RZ7L 3TZVC 1Q0XL 4WCYH 4CBPA 1XF3B 1MRDH 4PLKC 3RDTD 2VWEE 4X7TB 2L0DA 2BSSB 1ZOXA 4XCCL 2FJHA 4JO2L 4GAGL 1JL8A 2ICWI 3IJYA 4X80L 1QFWM 1U3HD 2NY4C 1KOAA 3RX7A 1P7KA 3FQNA 4XMKL 3RX8A 1FO0H 2NXZD 2PTVA 2YPLA 4R4BA 1BZ7A 3K8LA 4NWUH 5CGYC 1LVEA 4XPFL 3NFNA 5GIRB 1LO0H 4OF5A 3TN0B 1AXIB 1SEBB 5HI3C 2NX5B 4K3EH 4XNMB 1UQSA 4PRHE 3D18A 1AXSB 1ODAA 3NPZB 4XHJC 1QFOA 1IEBA 4Q9RH 1YPZA 3FT2B 2Q86A 1QKZH 3FFCA 4DVBA 5HYIA 4KK6D 3KJ6H 3FQXA 3MLRL 3BQUD 3LSOA 1JHLH 1JJUA 2QHRH 1CFSA 4HJ0D 4CKVX 5DD6A 3N1MC 3FQWA 1K4DB 3EYVA 3TVMC 1HH6A 4HUUB 2R0LH 4EDWH 1MI5B 1WWBX 4O4YH 3MRGA 4TQEL 5D6DC 5IQ9A 4JKPL 1UZ8B 2NTFB 4RISL 3WBDA 5DHVH 4TNVK 2R4RH 2HRPH 5C2BH 5GGTA 3WD5H 2B39A 4Y4FD 4JY4A 1T4KB 2E6QA 3NCEB 5B22A 5KOVC 5FB8B 4NUGH 2IAMD 3HR6A 3VJ6A 1U8KA 2NXYB 3NCBB 3F5WB 4DN4L 1A9EA 3AB0B 2ZUYA 4PJHB 1XF4A 3QA3B 2VABA 5MEPA 1S9YA 4JJ5B 4LSVH 1G6RB 3O3BA 4LVOB 4PLOB 3KS0J 2FYYA 3BW9A 4P2RE 5EULV 3WFDH 3ZTJG 3ZYIA 5CEXB 1F3DJ 4Q6IA 5GJTL 4ELMF 1Q0YH 1YZZA 3MNWA 3MUY1 4BJLA 5CHNB 3SY0B 4WNQB 2D7PA 3WFBL 5D7JC 3RTQD 4ODUA 5ERWB 3WJLC 4ZAKB 4Y2DC 1EO8H 2EC9U 4HCRL 4O51A 3SGKA 3BYTA 1D5XA 4QNPF 3QUML 4FFYH 1IGFH 4DKFH 4FS0A 1FN4B 1JPTL 1PBYA 5EOTA 3GMOB 1TZIB 2IWGA 1J12A 1HE7A 4RQQA 3W0WE 4CL7A 1PLGH 2BOBB 2BSTB 4KUZL 1M71A 1MRCL 2Y06H 1UWGL 2YA2A 4HK0A 5CEZH 2A83B 3QEQB 4M61A 2SEBB 3P4OA 3ULSA 4GRLB 4K9EC 2VXSL 4ZPVA 4ODHL 4OZIA 1KV3A 2GK0B 3O3EA 4L3CB 43CAB 4YBHA 3GO1H 3MPCA 5D72L 3VI3E 4OBSA 5E99L 3VG0H 3V6OE 4ZUVB 5C08E 1NBYB 1FBIL 4MHHI 1Z5LB 1T03L 3PNWB 5DD3H 3KLHD 1JK8B 1CG9B 2JCCA 2BVTA 3A67H 1XGYL 1JPGB 2BRRH 2W9EH 4PTTA 3VWKA 2CRZA 4PRDB 1VESA 2ZCHH 2J6EA 3C09C 1OAUL 4QXWA 1JRHH 2V7HB 4MXWL 4I2XA 1SMAA 3CPLA 3HC0A 2GJ6A 2YK1L 4LPXA 3RGVD 2W92A 3W9EA 3FFDA 1MCNA 4M9PA 4ZDHB 1ERNA 4RGOH 1UB6B 1PVHA 5IBTL 1IAKB 3QHTC 1K8DB 5E08H 1RIVH 1KIPB 4CW1B 1WTLA 1B6UA 3T0VA 3HA0A 3VH8A 1G9NL 5DA4A 1A7OH 3BIBX 4JFPB 3L3JA 1Q9WB 5E9DD 3MV01 2X4SA 3BXNB 3AMKA 3LS4L 5MERA 4JO4L 4PYHA 4KRPB 2ZOKB 1OTUC 3G5XB 2D9QB 4EZMA 1T5WA 1ZVSB 4P0DA 2JLLA 4XVTL 5KSUA 1KT2A 1BD2D 3MLTA 4OV5A 4KK8C 4GBXC 2EO9A 2IFGA 4LPUA 1V3LA 3B8YA 3KDMA 1OT2A 1AJ7L 1CDCA 3IJSB 3TVMB 5DURD 2AV7B 3ULVH 5IGXL 4LASH 4HIIB 3FJTA 2X4OA 1U8HB 4HF5H 4WUUD 5J06A 4JRWA 1D5ZA 3BPCB 3S96B 1KB9K 4JFED 2DQIH 3QUYB 3ALXA 1H15B 5A2FA 4JO1H 1UACH 1RURH 1UT9A 3G08B 4PG9B 1OGAD 2CK0H 1NMCC 5I9QC 2XN9A 5I8OL 3VFGH 1NUFA 1S9WB 4G5ZH 5K93A 3SO3C 1R3HA 3QWQB 4UMGA 4HKJA 4ONHB 3D0LA 5F7HA 4HQQL 4DGIH 4MJ5B 2VO5A 3WFHA 2G2RB 4ZYKB 4LLQB 2OK0L 4GAYB 4KJYA 2ARJB 1H5BA 2ADJA 3P30L 4FMFA 3QI9C 4MXVF 2Y1VA 4J4PD 1BVLA 5IHLB 5D7JB 4ODXB 1CFNB 3E6FA 4TTDC 3OKKA 3VFVB 2NX5E 4Y2DB 5FUOL 4G7YH 5GGUA 5IVXB 1BAFL 3FB6B 2XTJC 4AIZA 5IROC 5EIQA 1WVZA 1NBZB 3DJ9A 3GSNL 4NRYB 4EBQL 2E27L 1FRGL 3K0WA 4NKMB 5I16A 3VWJA 4MCZB 4EVNA 4LQFH 2GY7B 5D9SB 2HKHH 3HPLA 5FDWA 1QBLH 3P11H 1ZHLB 3MRLA 4P4KA 1ZWIA 4JY6A 3QUXD 4IDJH 2GFBB 4P5MA 3MRDB 1I1YB 1J87A 3GIZH 1A7PH 3K74B 3QUZD 4KDTC 5JMRA 3VGHA 1EFXA 4PUBL 4U1IA 5LBSL 1MI5E 1ACYL 3SO5A 3UXFA 4PS4L 1E6OL 1CK0H 5AAWA 1W0VB 1FFPB 2F74A 2X4RA 4IRSA 4M5YL 1ZLWK 4AM0B 5IB4B 3NFPB 1OQXA 4XGZB 1CLZH 1R6VA 1N7MH 4U05A 3UTQA 1F00I 1I7ZA 4NN6C 5ESVA 3JUYA 3DHMA 4YEEA 2CIIB 2WQRA 5TDOB 3TT1H 3MTRA 1CFBA 3K80A 2YD4A 2NY1C 4PJHE 3VFWB 1LO3L 2YRLA 4LFHG 3QB7C 4PGEA 5DUBA 2HLFC 2VZ3A 3O6FB 4G6FB 4O5LL 3BZEA 1T1ZB 1YJDL 1NANI 3U0PB 2XKNB 5I8KL 5DMIH 1UVQB 4GT7A 1IQWH 2EYRA 4M7LT 3TBSA 3OKLA 3W5MA 1BPVA 5ECJE 4I8DA 3RAJH 3DO7B 5DFWH 2FD6L 4BQCA 3L5JA 4CADA 4PGDB 3G6JA 1U8IA 4XPAH 5BW7C 3OTTA 3L95A 2XZCH 2XWTA 3C2AH 4PRHD 5IESL 1JUFB 2FATL 3OKYA 1TETH 3H9SA 1T1YB 1W72A 3PWNA 5D6CB 3NPSC 1AKJD 2HFGL 3O6LH 5JA8B 1HK6A 3PDDA 3HE7D 2NZIA 1PSKL 1T7VA 2IANA 3MJ6A 4JPIB 3QEQE 1BJMA 2H6PB 4W4OA 1DEEA 4LSDA 5I2IA 4OZHF 1Z3GH 3T0DA 4M1CD 4Z6AT 5GRJL 3ARWA 3HB3C 4YQXH 3DVGA 1J8HB 4NFCA 1S7VB 3BE1L 2UZXB 5FO7A 4Y19A 1AY1L 3TA3C 1AD0A 1F5WA 3WDHA 1QRNA 5MHSE 3D3VA 3MA9H 2AJXL 3QUKA 2DQGL 4GMTH 4HIHA 4KV5F 4N1CA 1GPOL 5F7UA 3QFJE 4UQ2A 2X89A 1DLFH 3V6FA 2FHBA 4GG6F 3VXQB 3MRJB 4ZG1A 4NP4H 2Q6WA 5BO1L 1S5HB 3LV3A 5F7EH 3EOAA 5GSRA 3VGBA 2GUOB 5J13B 4PJ7E 1S78C 2QADC 2GTZB 2R9HC 2G5BB 1DBJH 4YDJA 4MNQA 5I9QB 1UB5A 5BVJA 3B5TA 1S7RA 3SO3B 1ZHNA 1UC6A 5E70A 1KBGH 4PGBA 2LABA 3QXWA 5KSBE 4F9PC 2JJVA 1DE4A 1QSEE 4N1EA 1S7TA 3RFZC 4R26H 4LDLB 4KI5F 4XP4L 3SDXB 1RU9L 4KTEH 3WKMH 3E3QE 5FDYA 3QI9B 3I3BA 4I0PD 4S10A 4E42A 1WEJH 2B2XL 4J7RA 2ZCLH 3U36A 3WE6A 5ILTL 4GAJL 3VXTB 3RNKB 5C0JA 1I8LA 5GS0D 3L3HA 2RCSL 2HVJA 4JFHE 5DS8B 2VLRD 1QSFA 3MUGA 2XTJB 4MDIA 2MCG1 2FIKA 4QXTA 3ZTNL 2JKXA 4XBGB 3M1BB 4K7FB 4I77L 3JV6B 1DTUA 3MRNB 5T1MB 3SPVB 5L9DH 4MD5B 4NCC1 3VXOB 1U8NB 5DJAA 2CDFA 4KMTL 1C5BH 1RJYA 1EO5A 1IKFL 2VOTA 1S9VB 3C8KB 3OSKA 4OLXH 3PQYD 3SKJH 4KK9D 1QFUH 1KTLA 5I74C 3RRQA 1LEGB 5HPMA 2F58L 1KJ2B 5F1NA 4FFWD 5EZJB 3RI5F 2DYPD 3HLAB 1YC7A 1W8NA 1S9XB 5ACMA 2VDMH 4NN6B 5L2KB 3VXSA 1NSNH 3P2TA 1U3HA 3OPZL 1YN6B 3HAEG 2NY1B 3RVWD 1PKOA 4QRRE 2VQ1A 4NC1E 2MWCA 4MMXC 4KVNL 3J7HA 4WHCA 3RI5K 3Q0HA 1INQB 4DTGL 2VLLB 5T1DL 2OTPA 3QQ9C 3SGJC 4E41D 1K2DA 2DTMH 5JDJA 4F7TA 1IEHA 1P4IL 5IP4A 2Z92A 5F7WC 2AQ3A 4O58H 2DQFB 4Y5VB 3B5GA 3ARPA 3R4DA 5GGRB 2AVGA 1NAKH 4PJ9D 3MMEB 1G7MA 1N5YH 8CGTA 5EBMB 1IMHC 5E00B 3IDMA 1DP0A 4GMSH 3L6FB 4GQ9L 1X9QA 3WS6A 5E8PA 1FAIH 5KVEL 2DDQH 1ADQL 4XP1L 4LBEA 3U6RA 3ULUD 3EFFB 1GJIA 3PDGA 3QXDA 3H6JA 1VENA 4UB0L 4DCQB 2ZSWB 5FUZL 3KJ4C 5D7LE 4Q0XH 4EN3A 4KXZI 1TVDA 4WTWA 5LGKA 3P9WB 4X9FA 4Y1AA 5DVMA 3MLXL 5DJXA 4Y4FA 4HUWA 1D5BB 1VEPA 3W2DH 5DI8B 4WFEE 5C9JB 2IAMA 4K3EL 1QQDB 5DJ6A 4I3RH 5DRWB 5DVOA 3RNQB 3FN0H 4O02H 3TA3B 4ODWA 3T2NH 3P9MA 5FO8A 5FKAB 5JORB 3HCVB 4BFIB 2EC8A 4CVZA 4F7MA 3DIFB 1I8KB 1TJHH 4Y5XA 3ARED 2X4NB 3ARGD 4DKEL 5B21A 1E4XI 2VLME 1BEYL 4EUPA 4KHTH 2Y5TA 3KPOB 1I7TA 4FQQB 2OYPA 3UAJD 3MYJB 2ESVE 2PYFB 4KGJA 3M17B 1I9EA 2QADB 4NNYA 3IDJA 2B4CH 2BXZA 2CJUH 3FQTB 3LB6D 4LDOB 1HWHB 3WHE0 4F2MB 3RTQA 3LQMA 5AG9A 1WIUA 3ARFB 4R96A 1U42A 5D1ZC 3DGCR 5D7IE 4OIIL 1HINL 1KTDA 3QCUL 2R4RL 3U4EA 3Q2CA 1NFKA 1G9MC 1SY6L 4M7JL 1J0KA 4WI8A 5TQ2L 5AWNH 3ZSTA 4NUGL 4YHIA 5IW3A 3M8OL 5HHXL 3TN0D 4AT6A 2B7DT 2NX5D 3N85H 1OAKH 4L4VB 1ONQB 4MQXC 4PRBB 2FEEI 4PJAB 3U0TA 4DUXA 4X6FB 1WT5A 4QEGA 2DM7A 4X6DB 4K23L 5DD0H 2R0WH 1XGUA 3B2UD 4XVUC 3GMRB 3SKOB 4JN1H 1VCAA 3GJFA 2PF6A 1CDIA 5IFHH 4QWWD 2X1XR 1CD0A 1XF5B 2JJUA 2DMCA 1JYXA 3PV7A 4GRMB 3LKRA 5C0DB 1MHPL 5TE4H 5BZWA 2ZSVA 2YC1A 2LU7A 2O5YH 5ELIA 1T3FB 1PW3A 1RJZB 3FMGH 1MI5D 2IJ0C 4K55A 2E6PA 1LDPH 4M3JA 1GL4B 5DQJB 1QSZA 3PWLA 5I74B 3VD5A 2OZ4H 9CGTA 4ODVL 1MEXH 1KPUB 2JELL 3LHPL 4WI5A 5DRNA 2NXYD 3RGVA 2CXKA 1T7ZA 3BGMA 2X9YA 5HYJB 5CEZL 4JO3L 3GSVA 3H8NA 5TF0A 1MIMH 4M1GL 3PP3K 1F4HA 4NHUB 4QOKA 5DUMH 2Y7QA 3BP5B 2ZUSA 3DMMA 4RGNE 1CT8A 3D2UA 1RHFA 4FQIL 1J1PH 4JZNB 4LKCB 2W07A 2RGSA 3UBXG 4K3GA 5ITBH 4M43H 3I84A 1RVFL 4JFQA 3UC0H 3SDXE 4ZAKD 4WV1C 2KQNA 3VXMB 2NY0B 2J4WH 5ANME 1BOGA 4IHOB 3K4DA 3LEYL 4YZFE 1RZKL 2HJLB 5CGMA 6FABL 4JFYA 5F7KC 3BEVA 3G5YB 2E7MA 2HTKC 2R69H 3P0GB 4M6OH 5BRZB 1CFVH 1BD2A 3GM8A 5CZXD 2DLGA 4N9GB 4OCWH 1DN0B 2FCBA 5C07A 4JRXB 4MDJB 1AFVH 4ZUSA 1AGDB 3QEQD 1F3JA 1TXKA 3PDOA 5D2NA 4Z7NE 3PP4H 4GRLD 3QIUB 3V0WH 1A3LH 4G9DA 1FNEA 3KJ4B 4PP1C 3TBVB 2O5ZL 3LKNA 4R7DB 4G6JL 4YDVB 2V5RA 1FV1B 3OB0K 2E7CA 1MJJA 4URTB 3JWDL 4WUUA 5MENB 4K3JH 1ZXQA 2Q3ZA 2X7LA 2YEZA 1CR9L 2YKLH 1P53A 3MLZH 4I18A 1X5JA 4KRLB 4ZXBA 1LEIB 4ZD3H 2H3NB 2C3XA 3G5ZB 4G6KL 4KKAC 1D3CA 4G9FB 4GUPB 4UIMB 3BPOC 2VQUA 4ALAH 4L8BB 1OAQH 3CC5A 1U95B 3MLWH 1JNJA 4YX2L 3SE9H 2W0FB 1OP9A 1IAIL 2IH1B 1AP2A 2WANA 3MLUL 5KN5B 1OP5K 1OSPH 2GAZA 2YS4A 3MRCB 2WP3T 4JGMA 4Z95H 5F93C 3HFMH 3ZSSA 4HIEB 1TQCB 2EDKA 3CSYB 3MLYH 2FDBP 3SGEH 4XWOC 4J4PA 5DJZA 1L7IL 1RQ5A 4OI9A 5GGSA 5D1ZB 4LASL 2UWEE 4HDIB 2P4AB 4U1SA 4MB4A 2AJSL 2EDNA 2V9QA 3P4LA 5CCKL 3RPIA 4HPYH 3I50L 4QRTA 4IOSD 4BQBA 5DR5H 3WL9A 2AABH 3UTPE 1GOFA 4H1LH 5SV4A 3OJDB 5IHZA 5HI3D 4GQPH 2XIDA 43C9B 1MY5A 2VXVL 4ZSOE 3STLA 1II4E 2WAHA 4OGXH 3KVQA 5CJXC 3T65B 3I2CH 4F37K 3GMLB 1F6AA 4KRPD 3QUXA 4V1DB 1V7NL 2DQHL 3SKNB 1U58A 4O9HL 1B0WA 1PEWA 2OBGA 1HHHA 2FSEB 1S9KC 3QUZA 1OAXH 1D5IL 1FH5H 3QDHA 1DBML 4XH2B 4P3CL 5EUOE 4OCRH 4NQVB 5E6IA 4UQ3A 4JVPA 4IRJC 2EIEA 3Q5OA 1CXKA 5TDNB 4YUEL 1HSBB 5EU4B 5DT1L 1MF2L 3U30C 2WLYA 4YHLH 3RWEB 4AENB 3TVMD 3QSKB 2CDEB 2D0GA 4FNLH 4G7YL 3MJGX 2AI0L 1A7BA 5GHWH 1CFTA 2EDJA 2YBRA 3HI1B 3MFGB 1WIPA 3ILPA 5E2UH 3U83A 3UTZA 4LP4A 5GZOC 3MODL 3V4PH 4ZTOL 4MHHG 4MQTB 3FONB 3VMNA 1A21A 3ZKNC 3QUYD 5IV2A 2PXYC 1IGCH 2P8MA 2HKHL 3VA2C 3C08H 1YNTA 4JFOA 3MO1B 4IDJL 3PWUB 2O93L 4JFXA 2X05A 1A9BA 3HPJB 1LK2A 2YD2A 5C09E 4ZTPH 5KVGH 3MGOA 1I85A 4PRHA 1CICA 1CK0L 1JZ8A 3JTTA 3VD4A 1RK1B 2WWMD 35C8H 4JQVC 3WJJC 1WBXA 3BEWB 3LRGA 5D7JD 5IJKC 1FLRL 3DX7B 4BZ1L 2EKSB 4WV1B 4OLVH 4Y8AA 4Y2DD 3GSQB 1FZOB 3HG1B 1AKJA 2OR8A 5KOMC 1FZJB 3HE7A 1UH4A 2AERT 5EN2A 4KKLC 4PJDF 4X6DE 1T21B 4GW5A 4NSKB 4ZS6C 4ELKB 1RJLA 4YHML 3EJYC 2R2EA 1KLUA 4XVSH 4WU7B 1IAOB 1SYSB 4S1RH 1VKXB 4D9LH 1KLGA 5DC0A 5DMIL 4RMUA 2R15A 1F45A 2W9LA 5CZKA 3DROB 3MACL 1P4BH 3GBNL 3RAJL 3ARRA 3KGRA 1JVKA 4S1QL 1MAML 1TFHA 1NGXA 4WFED 4JM2C 4QXUL 2E7LA 4OLUH 4H25A 4ERSH 5IWLC 1HDMB 5HVWA 7CGTA 4TSCL 2Q87A 3H0TA 1KELL 4M7LH 1KG0B 1LHZA 1P1ZA 4OJFL 3BGFC 4OCYL 4YIQA 4U1NB 2FZ3B 4G7VH 3MJ7B 3VDBA 5FCUH 4R7NA 5H37G 4E9LA 5EZIL 1X44A 4P9MH 1DQML 3K81A 1A1NA 1J0YA 5JTWA 4KTDH 2CLRA 5JXEC 1JPFA 3B3IA 3BKYL 1XCTB 3O6FD 2ICWA 4G6FD 4RMVA 1BBDH 2K3TA 1CF8L 3V5KB 3QPXL 4G6AC 1NDGA 1CDUA 4KROC 4I0PA 3B9VA 3S36L 4NQCB 2FL5B 1GIGH 1YNLL 5DUPH 4QRUB 4E0RB 2D7TH 4WJ5B 4RA3A 5DJYB 1HEZB 1IC7H 4KK5C 4ZFFA 1C1EH 3HNVL 3W0WA 1KNOB 4HXAL 5ACZA 4XTRC 3BUYA 3LD8C 5MP6L 3LKSA 4PREA 4UOW1 2WBJA 3BESR 3X11B 3SJVB 1FZMB 1EAPB 3MUZ1 3IDYC 4G8GB 2WNGA 4APQC 1M6OB 4J3UA 5F96H 5C8JA 4HLZH 3P77A 3V6OA 1OTUD 5C08A 1TJIH 3NIDE 1HHKA 3PQYA 2OL3H 3U0WL 2OP4H 4AG4H 3QEHA 4TTGA 4XP9L 4OT1H 1VACB 1J8HD 2C3VB 3O3DB 3DXAE 1TQBC 5HDBE 2DD8H 1G7LA 4YLQT 3VI4F 3S4SB 1WEJL 3U30B 2GKIA 1SJHB 2NLJB 2NY7H 5DMKB 3F62A 4ZFOL 2J8UF 4WU5A 5KSAC 1GGBH 1U9KA 3WLWC 3C2SA 3WFCH 5IM7B 4M1DH 3WYRA 3A6BL 4H8WH 4G9FE 1UM5H 1UM6L 1KYOK 3VD9A 5C6TH 3O9WA 2GJZB 5E6YA 2XY2A 3AS3A 2PXYB 4R90H 3LN5B 5JDSA 5HGDA 1DUYB 4WY7L 1SJEA 3L5WB 2NR6D 5FHBH 3IRPX 1IRAY 2RIKA 3I9GL 4QRSA 4YDKH 1N6UA 3LIZH 1ZGLP 4PJ9A 1CIDA 4U7KA 1YEGL 4XZUA 1I1AA 5K9OB 3QAZC 1ES0A 1S3KL 4OFKA 4KHXH 5GGTH 1AO7E 3QI9D 3QG7L 2XQBH 3F7VA 5F97E 3TBTB 2R23B 3F7PC 2ID5A 4PJIF 3HZYB 1INDH 1UYWL 2WUCL 1FNLA 2XTJD 4PJCF 4MD0B 4L5FL 5IQ7H 5IF0A 3R06B 3ZDZF 3MCG1 3QPQC 2G9HA 5T3XH 5IB2A 3VFNA 5IB3A 4QY8A 1ORQB 1FL5B 2HJKB 5J57B 2FWOA 3BIKA 4QF1B 3FAWA 3GRWA 4QHUA 1R3JB 1Y0LA 4O58L 1CL7H 3Q1SL 3L3GB 5EO0A 4XXCA 4RWYH 5ENWB 1I7RB 4X0KA 1OM3H 4U49A 3MJ9A 3G6DH 3X3GH 1DBKH 2G60H 5ESAB 5CWSA 5J1TC 5B8CA 3RA7H 2FLRT 3ZDXE 3RUGB 2IPTL 4NQSA 1HOCB 4RGMC 2DDQL 5GS2D 4LPYA 3ES6B 1VGEL 5I1EL 3ZL4H 4KAQH 1CDJA 5L2KD 4JHAH 4NM8H 2H45A 1FG9C 4KY1H 5F9OL 4U6XB 3HNSH 2NY1D 5IVOA 3WDJA 1C8PA 2FHFA 3FHAA 5SX4I 3NN8A 1DFBL 4UBDD 1A7QL 2HLFD 1JNHB 3LEXB 5I71B 4RMSA 4PJEE 3I3EA 2VXTH 1AXTL 4I0KA 1BBJB 4ZO9A 4UT7L 1EPFA 5TGBA 3TN0A 3ARDA 2NX5A 1REIA 1LWRA 4O02L 5FYKE 3V9FA 3BH9A 1IGJB 1WWAX 1AXSA 4KTYA 4X4ME 2QQKH 3UTPD 5JW4Q 4HUVA 3K4AA 2XRAH 4WHYH 3FB7A 4R97C 2E9WA 1BFOB 3HG1E 2J6EH 3BPLC 4LP5A 3LD8B 4WW2C 1UM4H 1HILA 2FJFA 1SVZA 3FQUA 4JG0H 1K4DA 2B4CL 3IDYB 3K2UL 2CJUL 2PO6C 5IVNA 2ED8A 1T1XB 3S3SA 4APQB 4HUUA 1MI5A 2P42B 3C8HA 4ELMB 3K4ZA 4M48H 1QUNA 3L5XH 3V2AR 1UZ8A 1BQLL 5I1CL 3QRGH 3J8F7 1I7UA 2B1HL 1NFIA 1FFRA 3LKQB 4OAWA 1T4KA 2F19H 3MXVH 2DQCL 1TQBB 3C5ZD 5I6XC 4RX4D 3TA3D 3VRLE 1RZIB 4PJHA 1TITA 3NABL 1S7UB 4M6MH 1DQDL 4OCMC 3TP4A 4HULB 3GSXB 2XFXB 5T1LA 5DD0L 5HGBB 1IT9H 1K5NB 3MXWL 5C3TA 1MCWW 4Z0XA 1EGJH 3EJZD 2ICEB 3VE0B 5FXCH 1LO4L 4YBQC 1UH3A 5CMAB 1HCVA 1RUKL 4HUMB 4PRPE 4UTAL 2XPGA 4X7DC 4U7SA 4HGKC 5TE4L 1S78D 5D5ME 2QADD 2R9HD 5CHNA 3SY0A 4A6YL 4JG1H 4WNQA 1H3VA 4RRPG 5AD0B 4OFDA 3IFPA 1SBSL 3ALWA 4JZOA 5IMKB 1VFBB 3ARFD 4F7CA 5E2WH 3CAFA 4P2QB 2YPVL 2VZVA 5DRXB 2QQNH 1FZKA 1CD1B 1INEL 5KSVB 1HI6B 4YFLF 3NMEA 1FN4A 3CNKA 3GMOA 5DHYB 4JM4L 4NKIH 5E6ZA 1I9JH 3MRFB 4CVXB 4EI6A 4L4VD 4XNXH 2BOBA 2BSTA 3QUMB 3QEQA 2SEBA 3H42H 5F7DA 3SKUD 3SJVE 4U1MA 1QO3A 2EICA 4Z7WF 5IK3B 4LHUA 5MEQA 4L3CA 5T33H 3CFKA 2GW5A 3O2DA 1NCWH 4OZ4B 43CAA 1QLRB 4MAYC 4ZUVA 4AIXA 1NBYA 3MREA 1A64A 4UTBH 1Z5LA 4KKBC 5C0BE 4LGPB 1C7SA 1CG9A 2Y23A 4FXGB 4TULH 3QNYB 3UC0L 5EORH 3QFJA 3BKML 2EDOA 2MMXA 4XNUH 1RK0A 4H5SB 4IRZL 2GQHA 4GKSB 3EHBC 4Y16C 5IFJA 12E8H 1IC5L 3GMMA 4PJ7A 1MREL 3KLDA 5I18L 2FEDD 3QO0A 1BM3L 3JV4B 1F2XK 2Y07L 2EDQA 3GSRB 5HYJD 1AFVL 2P8LB 1CN4A 5KSBA 1JGVL 4U1HA 5IEKB 1QSEA 3EZ8A 1VSCA 4HMCA 2FHCA 2E7BA 4OIBA 5TE7H 4CW1A 3VW3H 3EW3B 1F4XH 4K3JL 3JVGA 4HFWB 2HH0L 4KFZC 3MFFB 2GSIA 5E03A 2HJFB 3K7UA 1JGEA 2XACC 2P24A 3UJJH 2VUOA 1H3PH 1CDHA 1Q9WA 2ZOLB 2R4SL 2EDLA 4NZTH 3VXMD 2NY0D 1DL7L 8FABB 2R1WA 4FABH 3CDYA 2W91A 2BFVH 5CBEB 3G5XA 1J0IA 1NLBL 4R97B 1MCEA 1OSPL 4Q2ZA 4Q58C 5BRZD 2VL5B 1KPVA 1PG7L 3BPLB 3BH8A 3EYFA 3CK0L 3RL2B 3RWHA 4IIQC 3BZ4B 2YD7A 2NW3B 4JRXD 1OY3B 1U6AH 4I4WB 2PO6B 1QBMH 1EBAA 3QIUD 3IJSA 2AV7A 4NDMB 2AXGB 4IMKA 5CUSH 5MEND 2H32B 3BSZL 1NFDF 1JV5B 2R2HB 3U9UB 2Q3AA 3VU2A 3S96A 4ZFZB 5I1AA 1U2HA 1EEZB 3BDYL 3QUYA 1H15A 2D03H 5I6XB 2OR7A 2N1KA 5I19H 4G9FD 4QRRA 2ZKHH 2BNRB 2A6KB 3RL1A 4NKQB 3UTTB 5I1HH 3WLBB 4R4FH 5TH2A 2VIRA 4KVCL 2HT4C 4HLJA 4L9LC 4J8RA 2IH3A 1E4JA 2I27N 2GTWB 5FECB 1T5XB 4TSBH 4MJ5A 5HHNA 3HZVB 5JW3H 2YUWA 2G2RA 4ZYKA 4LLQA 1N8ZA 3IT8D 1JTPA 5HD8C 2ARJA 4ONFL 3LKPB 1A8JH 5CJQL 1N2RB 4MNHA 5B38B 4OCSH 3T8XA 2F5BH 5D1ZD 3VFVA 1ZKAA 3B6SB 4W70A 5GHWL 3HMXA 1AO7D 3IKKA 1HKFA 15C8H 1IAIM 3C5JA 3S36X 1RUQL 3V4PL 1U36A 1YYMH 3TPKA 4C4KO 1NBZA 4ODTH 4NRYA 4R2GC 5D1QA 1L4IA 5D7KD 5DEZA 5IMLB 5D7LA 5C6WH 1WZ1H 4MQXD 5D9SA 3PGFL 3TFKD 1N4XL 5J6GB 1HH9B 2GCYA 1IJ9A 1KB9J 3DX8B 1AI1L 1CU4H 5HHOE 3NAAL 3K1DA 4V1DD 1MWAA 2GFBA 2HWZL 4XVUD 1AGCB 3RWGB 4PJXF 2H9GA 3T1FB 3UP1A 4XPBH 4YE4H 3LKOA 4MAYB 2DN7A 4ELME 4NZRH 4LMQI 4HWBL 5ISZE 3FO9A 2FJGB 1WICA 4OM1H 3NFPA 4N0YL 1E6JH 2HTLD 4P3WA 5DMGD 1U8JB 2CIIA 4WVRA 3CVHB 3UYRL 3WUWG 5C0RH 1DVFA 3MROA 4TYUA 1L7TH 3LRHA 3P9LB 4QNPE 1PFCA 4S1SL 5GGRY 3MYZA 3ZYZA 3O6FA 5LXGH 5E94B 1CBVL 4XVSL 2VKWA 1T1ZA 1OHQA 1GXEA 3KPPA 5D7IA 1FG2B 5C7XL 1KEGH 3I85A 2XKNA 4X7SH 1UVQA 4HBQA 2A9ML 3GI8H 1W2KT 1LK3L 2IQAA 3LS5L 1P4BL 3U7YH 3V8CA 2WIIA 5IVZB 3SGDI 2C4FT 4LSSL 2A6JB 1H9VA 4JFFE 1NCBH 4QTIH 4LDEB 3VG9C 1NJ9A 4JFDB 1A6AB 4ODBD 4OQTA 4NM4H 3EUUA 1IZJA 4AQ1B 5FYKD 4P2QE 5T3ZH 3BKJL 2DKUA 4G7VL 5I1GH 1JHKH 1T1YA 4V2BA 2VDLL 2ED7A 1QNZL 1T80A 4NQUA 3CFIC 4POUB 2JTDA 3DV6A 4N0UB 3HG1D 3K1KC 4AYFA 4NT6A 2YZ1A 3NA9H 1F11A 4KTDL 3DV4B 5DFTA 2X1QA 3KPSB 1CFQB 3CLFL 1GOGA 4J3TA 4L3EB 1AR1C 4XMPL 4BK5A 4IIQB 4Z9KB 1X7QB 4EI5B 1S7VA 3UTSE 5GRXG 5IJVA 2IG2L 2MHAB 3L7EA 3MCLH 4LSTL 1Z6JT 5F70A 5DUPL 3DVNB 4X9BA 4XCFH 3U48A 2ADGB 4PP1D 2YPKA 5HHVL 1H0DB 4E5XB 1GGCH 5LVEA 5IW6B 1TZHA 1IC7L 4YK4C 2QL1A 3MRKB 2R29H 1Q9OB 2KBGA 1HXMA 5FA3B 5TPWH 3RY5A 3MRJA 5GXBB 3QWRD 1S5HA 2GUOA 4H20H 3H9HB 3ULUL 1ZHBB 3QXUA 3UPRA 1M05B 2G5BA 3RWCB 3LQAH 1I3GH 1ZA3A 4JRYB 1G7QB 4L9LB 1MVFA 5I8EB 5JZ7C 3SDYL 2OL3L 3IFOA 4LLWB 3UJIH 2W65A 4P9HL 2XG5A 3RJQB 1A1MB 3GBMH 1GGIL 3SDXA 3NA4A 2NZ9C 5ANMA 3QI9A 4D3CH 4UV4H 4NQCD 4XWOD 4OB5L 3TCLB 4KKCD 1ZA6B 5FF6A 1DBAL 1XIWA 3EFDH 1NC2B 3DRTB 1MELA 1AIFB 5J3HC 1A6WL 1X5LA 4HZAA 1JWSA 1G7PB 2JK5B 3AC0A 3CIQA 3ULUF 3FN3A 3I6LE 5I8CB 4R2GB 4R90L 3VFSA 5BV7H 4XBGA 4K7FA 3SJVD 3JV6A 4MA7H 4EUPH 3D85B 4HJJH 1H3XA 3LY6A 4CN4A 4G8GD 3MRNA 5T1MA 1H8NA 3SPVA 4MD5A 3ARUA 4JY5H 2BNQB 2DI8A 4GKNB 5F8QC 4PJ8B 2OLDA 2XICA 2R2BA 1MFAH 5KW9H 2J88H 3ZZ1A 3BFOA 5C0EB 5HHQB 3C8KA 1S9VA 5ICYB 1S5IH 4NKOB 3MRMB 4WI2A 4GW4B 1RUAH 3MJ8A 3JUZA 5J6HA 4DUWA 3MGTA 5C0FA 4WDIB 5EZJA 2VLKB 4FQCH 4MXVE 5E2VH 3UJTL 1EDQA 1S9XA 5EU3B 3OKOB 4LLDB 5FYJH 5SWQA 3U7WH 1OARH 4O2EA 2JB5L 2ITCA 3EYUH 1GC1H 3GI9H 5K33A 2BNRE 3DARA 2B1AL 3G6AB 2R0ZH 3L3OA 4HS6B 5F9WC 2CIKB 3ZKND 5A2LH 3GJFH 2PXYD 2BHYA 3PGDB 2Z35B 2VLLA 1IEAB 5HBBA 2VN4A 1BLNB 1L6XA 4U1KB 2UWEA 5EOCH 4TOYL 1KSRA 3C87A 3RJDA 5CD5C 2OR9H 2AEQH 2AGJL 4KPHH 2DLHA 5DEFA 4Y5VA 5KVFL 1QVOB 3VG9B 3MMEA 2JJSC 2DJ4A 2OQJB 5DFVC 1M7IA 4K8RH 4PJBF 3L6FA 1XGRA 4ZSOA 3VXRE 2PR4H 4TSAH 3DSFH 5CJ8A 4U4BA 1MFEL 2R1XB 4KAQL 2CD0A 4U31A 4GRWH 5F6IC 3MA7A 5SWZB 4NM8L 1JWMA 3V6BR 3F12A 1KJ3H 2M26A 1EEUA 4KY1L 5IHUH 4DCQA 1G6RL 1N59A 3B9KB 2ZSWA 1A2YB 2FGWH 1C7TA 2QLVB 5J89A 1I9RH 3OKDA 3TO2A 4ZS6D 1QD0A 5DGRA 3EJYD 1FO0B 1F8TL 5DQ9B 3HNTL 3SDAC 4KQ4H 5C9JA 5K9JL 3C5ZA 1MUJA 1PX4A 1T2QL 2OI9C 3EO0A 5EB9A 4M8QA 2QQKL 1XGTB 3IVKB 5JORA 1YEHL 3HCVA 3G04B 5EO1B 3DIFA 1I8KA 2UY7A 2X4NA 1G6VK 3VCLB 3KNBB 2XZQL 1EHXA 2Z8SA 1MVUB 3L3DB 3KPOA 4NCDA 4FQQA 4NO3B 4R9HA 3EOTL 1Q1JL 3WIHA 2PYFA 2HN7A 2NMSA 4HIJB 1RZ8A 4DGYL 4UT6L 4X99B 3CVIH 5C09A 1H8OA 3ARFA 3KPTA 3T77A 1MFCH 4NQXB 5JXED 3C9NB 3LQZB 5FGRA 3NH7H 3V4UH 5DJ2A 4OZHE 5EO9B 3ULVC 3S37L 4FQ2H 1ZLVK 4G6AD 4R0LB 1U8QB 5DHVB 3RHWK 1R5IA 1XH3B 2Z91A 1WGOA 3FOMA 1K4CB 1TVBA 1T04B 3QZWB 4X6DA 4OD2B 2BMKB 1IT9L 4P59L 3V5DB 4KK5D 3C6LC 4KV5E 1EGJL 5H8DA 3SKOA 5C1MB 3IDXL 5AAMA 2VSCA 4GG6E 3LOWA 4LNRB 4S1DC 5C0DA 4JG1L 5K9KB 4C55A 1PG7X 1T3FA 4APQD 5E2WL 1A3RL 5SWSB 4Z8FH 2P5WB 4ENEC 4P2CG 3CFEB 1B2WL 1EEQA 3KG5A 5DQJA 3DO3A 1CXIA 2VH5L 1A7NH 1MJ7L 2CLVB 1K8IB 4KI5E 1FGNH 3OJMB 4OD3L 3VGEA 2JIXB 4GAFB 4JZJC 4PIRF 5J11C 4LSUH 5HYJA 1OD7A 3WUZA 4P2OD 2UUDK 4JQXC 2BCKB 4P5TD 3BZFB 5LCVH 1CLYH 1YQVL 4IDLA 3E8UH 3AU1A 4I3SH 1C12B 1HHIB 3QXTA 5F9WB 3T0EC 2DAVA 4JZNA 4LKCA 4LKXB 1NCUA 2AXJA 4FZEL 1E28B 2AV1A 3S8WA 3O0RL 3U1SL 3D25B 5E5MB 2YUVA 2PN5A 3MR9B 4P2QD 1J05B 4WGWB 5HHMB 2VDRL 3JWOH 1JPST 2V2WA 3P4NB 3G5YA 1R3IH 5CSGA 2AK4B 1MJ8H 1SEQL 2P46B 3JTSB 4NJAH 2YWZA 4TVPD 4N9GA 4DZ8B 1L9MA 3LEVH 4HJGB 3TPUA 5F6IB 3VXPB 4K07A 1AHWC 4CJ1A 3VXUE 5BMFL 1K9TA 4LLVB 5HDQH 3QIUA 3ARBC 4QHNB 5L7XL 2BNQE 4R7DA 1OLZA 4YDVA 1A6ZB 1FV1A 1YMME 3DXAA 4GXVL 1LE9B 3QPQD 4XPTH 3TM6A 5BZDB 2YUZA 4OGAC 2VDNL 1NAMA 2NPLX 4FXKB 4O2FB 3SDAB 1BP3B 1LEIA 5DJ0A 2OI9B 3SCMC 4G9FA 4UIMA 3PHOB 2EIDA 4EQ3A 3BGAA 2W0FA 5FYLD 1WC7B 2QV2A 2IH1A 1RHHB 5T5FL 5L8JB 1ZGLM 3S4SG 4NWTL 3EOYG 1T7XA 3MRCA 1KENH 5LQBL 5FGBC 5HVFB 1NLDH 2E9JA 2QSVA 3C8DA 3PHQA 4HIEA 3MZTA 4PFEA 4XVJH 4MA1C 1DEDA 3R1GH 5CSBA 1U93A 2VC2L 1QBML 1H3GA 3AY4A 1NL0L 1QYGL 4K9EL 2FR4B 3DUHA 3V52L 2PNDA 3O6KL 4L8CB 1PKQB 1JWUA 3RZWA 5CUSL 25C8H 5HI4D 1AO7A 1HQRA 1UJ3A 1CGSH 2Q76B 4Y5YA 1JNLL 1MCJA 43C9A 2F5AL 3REVB 3FB8A 2ZKHL 5IVXF 1MJUL 3QXVA 2A38A 1KB5L 3C6LB 3MRIA 4XCNA 2BSRB 1A14L 4TSBL 2FSEA 2WP3O 3FRUB 2ICES 4YDIL 4QHKJ 2OTUA 1KCRH 4NQVA 1KEMH 4IMLB 5EU4A 4JB9H 2PO6D 2BP3A 3RWEA 5C0CB 4AEIH 4RA0C 4QXGH 5JO5A 1MCPH 1E4KA 3IKCA 2WUBL 3FCTA 4OF8A 5HYEA 4PY7B 4HT1H 2PTTA 5I30H 2DL2A 1G7IB 3RZCB 5GS0H 1JMXA 2BY0A 3IDGB 4L4TE 4NOFA 5CILL 1A4JB 1XF2A 1RSFA 2CXGA 4XBEL 4KZDH 4JZJB 4YXLH 5J11B 4L8SB 3DUSB 3AGVA 1GAFH 2WBKA 2C7UB 2BNRD 1NCDH 2O5XL 3UTTD 2DLFL 5AZEH 4ZS7H 3CFCH 3BT2L 2BDNL 4HIXL 4PJEA 4NRXA 5I1DB 1IFHH 4RAVA 2ICCA 5B4MC 4NNPH 4JR9L 1F90L 1UXWA 3T0EB 1OAZH 3GKWL 4PJ5B 3GUTA 4X4MA 3HC3L 2AEPL 4QCIB 1YEIH 4CN1A 3BEWA 2Q8BL 3TJEH 4WUKH 3DX7A 3QIWC 2P49B 3PWVA 1J1OH 3GSQA 1FZOA 3HG1A 3VXRD 4WHTB 2Q8AH 1MHHB 3PL6B 1HQ4A 5CP7A 3KYOB 1HN1A 1JGDB 4X7FC 4NSKA 2JCCE 3HHRB 1IGIL 4HSQA 1KXVC 1SYSA 1VKXA 3FB5A 3Q6GH 1OSZA 4OZFA 1B0RB 5JOFB 2YR3A 3DROA 1AHWB 2Y72A 1T22A 2BERA 3ARBB 1Z9OA 1FVDB 5EIIA 2YSSB 1EHLL 3PJSB 5L0QC 4JANB 3ZDYF 2EE3A 4LCWB 2P5WE 5KG9B 4LEXH 1OWWA 4KKBD 4HC1L 4U1NA 3QWRA 4GW1B 5HY9A 2NY3C 5JHDB 3QH3B 3MJ7A 3SCMB 1IC4H 3DPBA 3T09A 3HI6H 1VERA 4QTHA 2X40A 5D7SL 3X14B 4NQTA 1KC5H 4YWGL 3NA9L 1EXUB 3EHBD 1IAII 1QACA 2GEEA 2KH2B 5J1AA 5BJTA 4C54A 4NO0A 4PRPA 3KPQA 4ZUTB 1MLCB 5INCB 1T89C 1VPOH 3TIEA 2J7LA 5D5MA 5J9PB 3WS3A 2DBJA 1XCTA 5CEZE 4KZEL 3V5KA 2LVCA 3FO2B 1F4YH 1QTYT 5A40E 5M94B 4HH9B 2I60L 3GRWH 4QRUA 1QFHA 4WJ5A 3ET9F 5CD3A 4JFDD 5F6HI 2D4FA 1KNOA 2HKFL 3OX8B 3UX9B 7FABH 3MJ9H 2W9DH 4RBPK 4AIOA 1KJ2L 3QJFA 4UDUB 2J8UB 5KVDH 4P23A 3SJVA 1FZMA 1J88A 1EAPA 1TDQA 4KRMB 1F4WH 1JMZA 3VGDA 3MRBB 1GH7A 3EKCA 1C5CH 1I3GL 2QJDA 3ZKXC 5EZLA 1ZTXH 2YUXA 3NFSL 2DL9A 3BDXA 3MRHB 3ARSA 2B4CC 3GJEB 2F54E 3KPSD 5EZOH 5C0BA 4L3ED 3O6ML 3HUJB 1VACA 2C3VA 4EI5D 3H3PL 5HYSA 3TNNA 3ZHKA 1FYTB 3SDCC 1LP9B 5EA0L 4HPOH 1X5YA 3S9DB 4MX7B 5DMKA 1ED3A 4JKKA 3EFDL 3WSQH 2A9NH 1WWCA 2MPAH 3L5HA 3PE9A 4ONGL 1T0NA 2ZP0T 4NPYA 4DEPB 3NVQA 3H3KA 4XBPB 4M5ZL 1V7MH 4JCMA 5BS0B 1B3JA 4S0SD 3R0MA 5BVPH 2G75A 2AJUL 4YDLB 4MA7L 5CJOH 4PJIB 2RFXA 5GJSL 1DUYA 5IFAL 2ADIB 4J6RH 5C0AB 4JRYD 5T1KA 2A73B 4J3OC 4OTXH 2CR6A 3KYMA 4YHOL 5FM4A 4G8FA 4N0RA 5DD1H 1NCAL 3GMNB 1FP5A 4PP2A 4ZPTA 5F7YC 1SYVB 5E1AB 2UV3A 2R23A 1IZKA 3OAUH 4UIKL 3S37X 1KFAL 1MIEH 1IM3A 1NC2D 4X9GA 1DQLH 2R2CA 3HZYA 3WN5A 1FHGA 1HHGB 5IMMB 5IKCA 2VDOL 3V0VA 2I9TA 1MQKH 3A6OA 4NQDB 4R2GD 3VXUD 3MV7B 4NZUH 1T20B 1WF5A 1ORQA 1YEDB 4DGVH 4QF1A 3DSNA 3D85D 3QCVL 3U79A 1KTKE 2W0KA 3HZMA 4JFZH 1KYOJ 2BNQD 1OOAA 2LE9A 2ILLA 1R3JA 4OSUH 4PJ8D 5I0ZA 4NQEB 4KGLA 5L8KB 5TQ0L 4UV7H 1BWWA 5F3BA 5ENWA 3SKMB 3TF7C 3C60C 3SEPA 5JW4M 5L0QB 5ESAA 1EA9C 2XKSA 4LAQH 3LH2L 4QHLA 3U9PH 4M7KL 3RU8H 3PABB 2Z8VC 3ES6A 4N1HB 2VLKD 2EXWC 1ETZA 4P57B 1KCUH 5I15H 5EUKA 4HHAB 5H35B 3T3MF 4L1HA 3ZYOA 1KJVB 5DEGB 1HHJA 1CS6A 5DF0A 5FKPB 1I9RL 1BIIA 4OD1H 4KH2A 3QDME 1CE1L 4L8DB 4P5KB 4PJDE 3LEXA 4M6NH 4X5WA 1DQQB 3O2DH 4B50A 1HNGA 4DW2L 4P4RB 5L2JB 2OJEA 1HZHL 4F9LC 2PTUA 1MLBB 3SE8H 4NC2B 1E4WH 2VZTA 2ORBH 2MQ3A 1DN2A 1P4LB 5JQ6L 4JN2B 5B3NA 2IADB 2X42A 4Y19E 1RIUL 4OUOA 2M1KA 3MCKB 4KQ3L 4PJAF 2XTLA 5HHOA 1IBGH 1I8IB 4HKBB 4BUHA 1MPAH 5SWZD 4D0CB 5EU7C 3CVIL 4CJ0A 5FA4B 4Z5RB 1CQYA 5EWIH 3B9KD 5GGVY 3S5LA 2VLJB 1AR2A 2XZAL 4ELMA 3KXFB 2HMIC 2NTSP 5L88H 3VRIB 3HZKB 4BH8A 1F58L 1F97A 4PY8I 2YN5A 1TVHB 4M62L 3IRZA 3DOSA 1FL3B 2ZUTA 3CMGA 2CLZB 4K94H 1FORL 3MV8E 3SDCB 2LAAA 1NEUA 4FTVB 3ALPA 5FUCC 3JV0A 1X4XA 4OM0H 4P2OA 4L4TD 3PV6B 3X3FL 1CZ8H 3GSXA 2XFXA 4F7PA 4P5TA 3ME0A 3DUUA 4EKXA 5HGBA 3EO1B 3UTOA 5KVMC 1Q9LB 1TJGL 2XWJA 1HKLL 5DQDH 3X12A 1HYSC 2Y9RT 4B0MM 4L1DA 3D69B 4QRQA 3HI5L 4LSQH 1JYWA 3X13B 1WBZB 1AQDB 4IS6A 4PB0H 4HS8L 2HAZA 2VDKH 5LKNA 1VFBA 1E27B 3QHZL 4U6VH 3CSBA 4FQ1H 1ZS8A 4P2QA 4A6YB 3O8XC 3GNMH 5ADOL 2IFFL 4UINH 3CUPB 5KSVA 4YR6B 1HI6A 3ZT7A 3V4VL 4HCRA 4L29B 2NZ9D 2H41A 2RHEA 3VI4E 3I6GB 5F9JA 2FNBA 2WINB 1D9KC 3MZGB 1P2CB 2J8UE 5AYUL 2R56L 2FBOJ 1TIUA 2VE6B 5J3HD 1OF2B 4XPGH 3UTSA 1O0VA 1YECL 4I3SL 3U82B 5BXFA 2M2DA 4OZ4A 2X5PA 2DS4A 4DQOL 1QA9B 4FOMA 1QLRA 4PGCB 5EOCJ 1ZGLB 4QHMA 3P73B 4HX1B 5CZVH 2EXYD 3BJ91 4JPKL 4M00A 4CNIA 1FFNB 3NZHH 3QNYA 4CGTA 5KZCB 5SWSD 4Y4KA 2OTWB 4MCYB 4X6CF 4XC1H 2P5WD 3STBA 1OGTA 1FYTE 2RBLA 3MBEC 2H2SC 2Z9TA 5FIEA 3C60B 3MBXL 1G9ML 4AJ0A 4JQIL 3GBLA 4RFOL 4TUJB 1MJ8L 2FECL 1N5AA 3HMXH 3O11A 2GI7A 1AGFA 5AUMA 4NJAL 3S6CA 1S7QA 3N1GC 2JIXD 4Y4HA 2F8VA 1U92A 1EAJA 2P8LA 5BS0E 1JPSH 2ZNXA 2AEWA 5IEKA 3MRPA 2BC4B 5T5NG 5CEZD 2EECA 1NDMA 1J0JA 2WZPD 3TH3T 4ZNEE 3WNKA 5C0AE 4PJCE 1MWAH 1IQDB 4HFWA 3ZDZE 3NIGF 3MFFA 1A5FL 1MCDA 3H2WA 4DK6A 2V9TA 4EOWH 2XNAB 2Z93A 2P48B 4WTZA 2AXHA 5JOPD 2X10A 4NO5B 2JJTA 3OKEB 5CD5D 5JW5B 1RZFH 1DUZA 2MQ0A 4UDTB 1IARB 8FABA 4GG8B 5HHMD 1ROWA 1U3JA 2ZJSH 3HRZA 2EH7H 4MB5A 5DFVD 5KJRH 3W11C 4NUJA 2AK4D 4D94A 4O2CA 3BZ4A 4LU5L 4HWEH 1D5MA 2VRAA 5GS3A 2NW3A 4AEFA 5TJWK 3OZ9L 2CRMA 4NQDE 4I4WA 1VEMA 3CFBA 4N0FB 4Z7QF 2D7MA 2DJSA 1DANU 3ZO0A 5GSVA 2O61A 5FM5O 4MGXA 4MNGE 2V6HA 1QHPA 1WJ3A 4AMKL 1GHFL 2H32A 2OJZL 4NOBA 1JV5A 3U9UA 3P3YA 4OQTH 4ZFZA 1MCBA 3SDAD 1EEZA 5KAQG 4OF6A 4YFLI 1BECA 3KPNB 5I75B 2B20A 4H1LB 3GB7A 2BNRA 2DBLH 3LN4B 1ZEAH 3WLBA 4XPHH 2V5YA 5DSCA 1WWWX 4M6AA 1S7WB 2E5EA 2GTWA 5FECA 4YHPB 1T5XA 5DYOA 1HWGB 1YY8B 4X5XB 4Z0BH 2ATPB 1TTUA 4NZDA 5F3HB 3QQNA 3CLEL 1MCRA 4YO0B 2ARJQ 4KWUA 4EIGB 1A47A 5C0GB 1JBJA 5DLMH 5D70L 4PV9B 1WTGT 1JCKA 4KXZH 5B38A 32C2A 4JPWL 1MCPL 3B6SA 1UEMA 4C83B 3VXRA 5I30L 2EH8L 2AJZA 1NUDA 3ULVD 1U8LB 3RIAF 2ED9A 4Z7OF 4M93C 2FX7L 2ZPKH 4P46B 2DM2A 4H8WC 5F1IA 2R0KH 2VB5A 5IMLA 4YH6A 2APXA 3BP6B 2ATKB 3GSNA 1HH9A 4BKLB 1D9KB 5A1AA 4EXPX 1U8OA 4G42B 1G7HA 1E4XH 3GSUB 4TRPL 3RIAK 1IFHL 2V2XB 4BSVB 4OCXH 1I75A 4LCCB 1OAZL 1QBAA 2VLJE 3VRJB 3Q6FB 3PUCA 2PCPB 1NBQA 2X4UA 3BD3A 3CMOL 3N50A 3NACH 4S1DD 5CSZB 1JNNH 4BZ2H 2BXYA 2DIJA 2XWBA 3I75B 5C0CD 4F7EA 1ZV5A 2P5EB 2UZYB 3FZUC 4ENED 4FTVE 1DLHB 2Q8AL 2D31A 1QLEL 5I66B 3RZCD 2IBZX 1BQHA 2ZUVA 5IHBA 3IF1A 3P9LA 2VDQH 4YXKL 5E94A 5E9DE 4U1LB 5ICZA 5KS9B 2AQ1A 3Q6GL 2YXFA 1FG2A 5DRZB 1V3MA 4EDXB 1J1XH 1XR8B 3A6CL 4BM7A 5CJ5A 1MH5A 3P0VH 4J3WA 4OZHA 3H9YA 4Q6IC 3TBWA 2LV4A 5TFSH 1BD2E 5JR1L 4Z7WE 3RWJA 3K2MC 4FG6C 3TLRA 4JFDA 5KANI 2RAMA 1A6AA 1UZ6F 1VADA 3NZ8B 3C5SB 5IT2H 3T0ED 1QFWH 1R3KB 4PJ5D 3OKMB 5C0NC 1A6UL 5KTEH 3SGKC 1N64L 5I1IH 4BQ9A 3OR7A 4WEBL 4XCYB 1RFDL 4PJFF 3WIFA 4WUUE 4GG6A 2NY6C 1XGPB 4FZ8H 3PL6D 3G9VA 1GCFA 4JFEE 3ZE2F 3BHBB 5FHAH 4L3EA 5E0QA 5FK9A 3QCTH 5I1LA 1NCCL 2AAVA 3MLVL 3BP7B 4EI5A 1MNUH 1OGAE 5H94B 4MA3A 5L6YH 4KDVA 4C58B 4XNQB 3KWWB 2CKBL 5SV3A 4MSWB 3DVNA 4TVSa 3W39B 2AJVH 2ADGA 3ARBD 4LL9A 4NGHH 1KIUA 3CDFA 2MTPA 1A0QL 1I3RB 2HFFB 2ZUXA 7FABL 2YOCA 1Q9OA 1PZUB 4NJ9H 2UZIH 4LCWD 5FA3A 4OGAD 5J4MA 4KJWD 4N5EC 3OGCB 3T04D 2GSGB 1EH9A 1UWEH 5JHDD 3VWKC 4YHNB 1I8MB 3SCMD 4K2UL 2P8PA 3D39B 1NGYB 3IFLL 1PDKA 2LFGA 4PB9H 1G7JA 1G7QA 5CBAA 3M07A 1CD9B 4UNTA 4I1NB 4HWZB 3SHSA 1PQZA 5DVNA 2YD3A 1RZJH 4JAMA 1SJXA 3KHOA 2OL3B 5B39A 2EE9A 1P7KB 3FQNB 4HPOL 5IOPA 3TCLA 2YPLB 4YXHL 3S88L 4R4BB 1ZA6A 1BZ7B 2A9NL 1URLA 3GFUA 1QR1A 1YEKH 3CXDL 1G7PA 3DX6A 5I0DA 4M93B 1NFDE 4Q9BA 5I1JH 5I8CA 1JZ2A 3VXUA 4BA8A 5CJOL 2Y36L 5DWUH 4G6ML 1YPZB 2VDPH 2Q86B 2VXQH 1K6QL 2BNQA 3FRPA 4DVBB 1JHTB 4GKNA 1FGVH 3WIHH 1YMMA 4PJ8A 1YUHA 5DJDA 4ETQB 3FQXB 3ISWA 3UBXI 4OTXL 1J5OH 2A0LC 2OM5A 5INDA 3AVEA 5C0EA 1CFSB 5ICYA 3DX9B 3FQWB 1LMKA 3QJHB 4GW4A 1QP1A 3JWNC 3CX2A 3WFEL 1FYTD 3TV3H 5DZOA 3MRGB 3TYGH 4WDIA 4DVRL 5IQ9B 3OAUL 4R3SA 4JM2F 4JGUA 1CVRA 2J3SA 4HBCL 4PJBB 1EJ6A 3RUGF 1TTFA 2EYTA 3G6AA 5MEPB 5BS0D 4HS6A 1P6AB 5IB5A 2NW2A 2KUTA 4LCIH 3O3BB 1ZLSL 2W1NA 1IEAA 4ZOAA 2FYYB 4X6EB 4X6BB 3DTXA 2Y25A 2Y6SD 5C0AD 2Z31D 3HKFA 1M7DA 1IL1A 2AJYH 1DSFL 3RVUD 3HE6A 2J5LB 1ZT4A 4LLMA 3S34L 1F3RB 4PJXE 1MRFL 1M4KA 2OSLA 1FIGH 3ARZA 4JPVL 1R24A 1N3NA 1YDPA 4UNVA 5I15L 2R1XA 3W81A 2FX8H 4WFHD 1D5XB 1YEFH 1GGUA 3MOAL 3QNXA 1GRWA 1ADQA 3CSGA 5I1KH 4LFHD 3B9KA 4OFIA 4OD1L 1T66D 2LTQC 3VWJC 2CR3A 3MRRA 4LVHC 4OZGF 3CDCA 4NQDD 4M61B 1Q9KA 3MV7D 3P4OB 3ULSB 4P4KC 4PV8A 5E2TL 4ZPVB 5DQ9A 4OZIB 3QFDA 2QSCH 3RKDC 5K59F 2AK1H 2YMXL 4NQED 4H26B 1CXEA 5GS1A 1E4WL 1UH2A 2DI9A 4L4TA 1XGTA 4XP6L 3PWJA 1WV7T 4WWKA 4IRSC 4MB3A 1OTSC 4K7PL 4TUKH 3TNMA 1VGKA 5E8DL 3UZEA 4RIRA 3KNBA 5EBWB 5L8LB 4TVPL 3B2VH 2DM4A 2CGRL 1OWRM 1CGUA 3FT4B 3TH2T 4IBLT 5F7FA 2VLRE 3L3KB 5ETUB 4I2XB 3HC0B 5DD5L 2GJ6B 4LCYA 3THMH 1TMCB 3W9EB 3MLSL 4JDVB 4NQXA 2V9RA 3C9NA 3LQZA 1OB1B 4KJPD 1EO7A 1GZPA 2VQTA 5HI5C 4LGRB 4K94L 4NN7C 1MAJA 4KMQA 4R0LA 5DHVA 3JBG7 4LNVA 1SY6A 1XH3A 2IQ9L 3ZT6A 1NAMH 2YZ8A 4OM0L 5TF1H 3PQYE 3IS0X 3QZWA 1LD9B 4AEHH 1AQKH 1HIML 5EFIA 5FYLL 3V5DA 2VAAA 3BRGC 3WXWH 2HT2C 3O45B 1MFBL 3LAFA 4XWGH 3L3JB 4ODSL 3AAZB 3BMWA 4POZC 5AZ2L 2X4SB 3NCJL 1A3QA 5MERB 4LNRA 1NGQH 1QFPA 3TZVB 5ACLA 2DB8A 3VGAC 1T5WB 3QDAA 5KSUB 1RUPH 1KT2B 4NHCH 1YYLH 3L5IA 2VLJD 2P5WA 3KXFD 1BHGA 3ROLB 2UVFA 4JDTH 3CFEA 1CGTA 4DAGH 2VISA 5E24E 2NY4B 4E41E 1VFAA 1FPTH 4P3DB 4DWHA 3SDCD 1ZLUH 4FTVD 4G3YL 2JIXA 4GSDH 2YWYA 5ITFB 4LLAA 1D5ZB 2NCMA 3WIIH 5FCSH 1VEOA 3BZFA 2BNUA 4DFIA 4FQJL 3LZFL 3TWCL 2JE8A 4V2CB 5HYQB 1HHIA 3B43A 3ULUE 2D9CA 2XN9B 1RULH 2DQUH 1R3HB 4N8PA 1W0WB 5ALCL 1E28A 2C1OA 3NZHL 1CL7I 4HKJB 3HS0A 3EAKA 1CXHA 4OLZH 3D25A 3WFHB 4XMLH 1CLCA 1UJTA 4LARL 3ZKQD 4XNZC 2MFNA 4KJYB 4U7MA 4L3AA 3WMSA 1RIHH 2ADJB 5CINL 4ZUWA 3L1OH 4LSPH 2BVOA 4DKAA 2FO1A 1D6VH 1BVLB 1SHMA 3QEGH 2KDGA 3OKKB 1CI5A 4YHZH 5GGUB 5CIPA 3IXAB 1U8PB 5GGVL 2OXGA 4HJGA 2IGFL 4C4KT 3VXPA 2F54A 3KYNB 2R8SL 4FQLL 4LLVA 4WHDA 4QLRA 4QHNA 5I16B 3KYKL 4WW2F 3VWJB 1B0GB 4LPTA 1MWAL 3GHBH 4LVHB 1QHOA 3HPLB 5FDWB 5BZDA 1Y18A 4P4KB 4YAQB 1ZWIB 4FXKA 4CDHA 5FYKH 3QQ3B 2X1PA 4K3HA 5F89A 1JTOA 1X5IA 3D9AH 1RV6X 5KZCD 1EFXB 4MA8H 4N9OB 4U1IB 2DM3A 5E8OA 2Z4QB 3IGAA 3G5VB 1BZ9B 3AROA 5DC9B 3WDIA 5E56A 1GZQA 3C60D 2F74B 1N0XL 2FB4H 2X4RB 1XGQB 1G0YR 5HGHB 4FQHA 2QEJA 5EU5A 2XG4A 1I7ZB 4HXBL 1BGXL 4MVBC 4F58H 2EXWD 1U3HC 5LWYL 2A1WH 2P44B 2NXZC 1WFTA 2J8OA 1FL6A 4PGEB 4OZFH 3EJJX 5DUBB 1KCSH 3QR2A 3FN9A 2FR4A 1JZ7A 5ALBL 4L8CA 1Y6MR 3O81A 1WUNT 1IGMH 1A7RH 4LF3A 1FVCB 2EYRB 4FRWA 4LSRL 4X8JA 4QT5A 4CADB 3O2WL 1NGPL 3G6JB 3P0YH 3REVA 1U8IB 4LRIA 4U3HA 4Q6YA 3L95B 1UCBH 2XWTB 3CVHL 3WS6C 3T4AA 1C5DA 2HFTA 4C56B 1I9IH 3H9SB 2UY6A 4X4ZA 3LQAC 4UILH 4LRNH 2H8PB 4NZJA 4NN5C 1T7WA 3FRUA 4LLUB 1MCCA 3VA6A 1KB5B 2EO1A 3SE4A 3L3IA 5H2BA 3C09B 3MUHL 5DDHA 2E9IA 4U2YA 2IANB 4XAWL 4IMLA 5LGHH 4MJ2A 3VGAB 2EC9T 5EPMB 4EN3C 4GLRH 5D8JH 1OAYH 4GKZA 5I2IB 1XR9A 5C0CA 1KCVH 4QRPB 1OVZA 3DVGB 2X4QB 2B0SH 4Y4FC 1J9CT 3QHFL 1O7SA 2DIBA 4ZFGH 4PY7A 2IAMC 5FO7B 3DETC 2DQTL 2HYMA 1G7IA 3RZCA 2OMNA 5BCAA 3IDGA 4F57H 1QRNB 1YEEH 1VHPA 3D3VB 3UPAA 1R5VB 1PJ9A 5DJCA 1JGLL 1Y6NR 3QUKB 3SOBH 3BP4A 4L8SA 4Y5XC 4UQ2B 1B4JL 3V6FB 5BV7C 4HKZA 3QDMA 4PJDA 2Q6WB 3DVFA 3CX5K 3LV3B 3EOAB 4J2XA 1A6VH 3VFTA 1CLOH 3GIVA 4LGSB 3Q48A 5LG1A 2GITA 5I73C 2FH8A 5GISH 4MNQB 1UB5B 4KRNA 1ZANL 3NACL 1Q72H 5BVJB 5EOQH 1DBBL 1S7RB 2Q1EA 1ZHNB 3CDGA 2L7UA 3PHSA 3FOLB 4PGBB 1DE4B 2MQCA 1S7TB 4GBXB 1JZ6A 3TJHC 1FE8L 1Z9SA 1ZT7B 2H1PH 3WEXA 3LRSA 4WHTA 3PL6A 3ECBA 3KYOA 2FX9H 4E42B 3WE6B 1G0XA 3U36B 2XA8H 1NEZG 1GC1C 4P46D 4OI8A 3GHEL 1WT5C 5C0JB 3L3HB 4LIQE 1FLTX 1GGYA 3B4NA 1U41A 2HVJB 2X09A 1RUMH 1QSFB 3MUGB 1B0RA 4MDIB 2I5YH 1D9KD 4FQXA 1AHWA 2C1PB 4P99A 2N7AA 3T2QA 3B8SA 3MOBL 4PRIB 2F8XC 4FFZH 1PGRB 3UCRA 1OPGH 1KIQA 1MCOL 3PJSA 1NMCB 3MV8A 4JHWH 2CDFB 4K3DH 5HYFA 1RJCA 2EYSB 2MJWA 5F1SA 1UA6H 3NIFF 3DURA 3WO3B 1RJYB 4K8RC 1TZGH 2P5ED 2DI7A 3X14A 1YEJL 2H2SD 2DQJL 5JXAL 1FFQA 5JUEL 1EXUA 5F1NB 5BQ7A 5T5NF 2AXFA 3RGVC 2NY5H 4LLYA 1EMTL 1WCBA 5FHAL 5DO2D 2XOTA 3O3AB 3VXSB 4N68A 4XP5L 3EDEA 1MNUL 1FYHB 1MY7A 3DMMC 3EO9L 4GJTB 1N6QH 3UDWA 4PG2A 4DJMA 5ID0A 1MFDL 2H26B 3QNZA 4TN9A 3TO4A 4BH7A 1ULVA 3AS2A 2C4XA 1ITCA 5FOBA 3BKCH 1K2DB 4GKOA 4NJ9L 4I5BB 1EJOH 2Z92B 5HGAA 2IBBA 4MAUH 2D0HA 3N9GH 4UDUA 2J8UA 5MEOB 1G7MB 2DF3A 4ORGA 1FDLH 1LDSA 3KLAB 2GT9B 1RZ7H 1Q0XH 4XNYL 3FHQA 3RDTA 3BD4A 3F65A 5MI0C 1RZGB 5HGGS 3GJEA 1JYVA 3W11D 2FBJL 4HFUH 1RZJL 3QXDB 4CVWA 4WFGD 4Z76A 2DRUA 3OG6B 4XCCH 4JO2H 5D2NC 4GAGH 4X80H 3L9RA 3DI2B 1FYTA 2DQEL 4MD4B 5GRUL 5KAQF 5JNYA 4XMKH 4EN3B 1MCIA 4W6XB 4MX7A 4Y1AB 4HMDA 2W0PA 2ENSA 2Y5EA 3DBXA 4XPFH 1LILA 4HUWB 4I18C 1T0PB 4ZXBC 3H7BB 5IBUB 5D71H 4ZFOA 5I76B 1EUTA 1LO2L 1BJ8A 2HG5A 5BS0A 4MQSB 4IM8A 3BAEL 3P9MB 1LNUA 4PJIA 4X4XB 4F7MB 4K7PX 5BOZG 4LHQB 5JIIA 1FJ1B 3D39D 4LOUC 4WCYL 5IVXE 4ZNEA 3BQUA 2DLIA 3DVIA 4PJCA 5C0AA 4B7IA 1MRDL 2Z31A 4B7LA 3N1FC 5EUOF 1F2QA 3QWOA 2A73A 4EUPB 2Y5TB 5D96C 1I7TB 1M1SA 3MLRH 5E5UB 2APVA 3NPSB 1XMWA 1S7SA 3F8UB 1QPPA 5I73B 4NCC2 3OBAA 1GSMA 1FO0L 2N4IA 4U6TA 4EJ1C 3TYGL 3GMNA 4NWUL 1KTDB 4TQEH 4X4YA 3F6IA 1ZT1B 2YPLD 4JKPH 5E1AA 4RISH 1LO0L 3SDDD 3WUWB 4ONOA 4A2MA 5F7MC 3DWTA 3MV9B 4YHIB 3VGGA 1PG7W 4AT6B 3QO1A 3CXHK 3EYOA 5KANG 2WQ8A 4DN4H 4Q9RL 3U0TB 4C56E 4NQDA 3IU3A 2VJXA 1QKZL 3CZFA 2WWKT 5CEYA 3KJ6L 5JPMB 3VFPB 1JHLL 2VAJA 4MNGA 3GJFB 2QHRL 1NUGA 3QUZC 1CE6B 4WFFD 5GJTH 5E6IC 3QG6B 3SKMA 3ESVF 1FIGL 4EDWL 4RCAA 2R0LL 5BZWB 4O4YL 4QRPE 1FSKC 3JWOC 3WFBH 3PABA 4G8IA 5D1XC 3JXAA 2HRPL 1U91A 5C2BL 1U8MB 5IIEA 3WD5L 4P57A 4HCRH 4G80A 4HHAA 3PWLB 3FZUD 2VWEC 4N0CC 1TCMA 4GRWB 4RWHA 4YBLC 4LSVL 1JPTH 5ICXA 3BGMB 3I6KA 3GSVB 4KUZH 1MRCH 4H1LG 4L8DA 1UWGH 2VKXA 4QOKB 1DQQA 3WFDL 2VXSH 2D3VA 1P9MA 2XT1B 4ODHH 3DMMB 1Q0YL 3MNVB 1G0DA 1JF5A 3D2UB 5D72H 1I85C 5E99H 1CICC 1VB9A 1FBIH 1T03H 4FG6D 1NC4B 1J8HE 3PIQA 4JN2A 4LQ1A 3ZDYE 1FC2D 4RMQA 1EO8L 2GY5A 2KPNA 4JFQB 3ZHLA 2WV3A 5C0ND 2NNAA 3RVVD 1XGYH 1BOGB 2HVKB 3INUH 4FFYL 1I8IA 4HKBA 5HVHC 3HE7C 1IGFL 4HMEA 4DKFL 3OAYK 5DGQA 4JFYB 1G1YA 1OAUH 3BEVB 3FO1A 2CO6B 4H0IA 1PLGL 3O41A 4MXWH 5FOJA 4C59B 2Y06L 3THML 2QR0A 2VLJA 2YK1H 2APWA 4HGMA 4AH2A 5C07B 5F44A 3QEUA 3ZKSD 4ZUSB 1F3JB 5JIPA 4PRIE 3PDOB 1FL3A 2MCPH 2CLZA 4G9DB 3GO1L 5IBTH 3SGDH 3VG0L 4FTVA 2ZG2A 4F3FA 5EDXA 5DD3L 1MJJB 2E7LC 3PGCA 3CH8A 4PRAB 2EDDA 2YEZB 2ZZUT 5F21B 3A67L 1G9NH 2ITDA 4BSJA 4XXDA 5E9DA 4ZXBB 4UOW0 3H7LA 5A16A 2BRRL 3OHXB 2W9EL 5HJ3A 4N5ED 2QBWA 4B53A 2ZCHL 2DWDA 4ETYA 5JLZA 4WTXA 1JP5A 3D69A 1JRHL 4D8PB 1AQDA 4IOIA 4Z7WA 3UZQA 2D4DA 4NHCL 4XVTH 3ROOB 4MYWB 1UGNA 2XTJE 3V6ZA 1E27A 2GJ6D 5D96B 3JV5A 4RGOL 4A6YA 4F33B 2P43B 4I0PC 1FPTL 2W60A 2XQYG 3CUPA 5E08L 1RIVL 5GGSB 1AJ7H 4OF7A 4YGVB 2H32H 4X6CB 4XCEA 2AKRB 5GS0C 5IGXH 2FIRT 4U1SB 4KDWA 4J1UA 1Y6KR 2EZ0C 2DKSA 3I6GA 3WV0A 1A7OL 2WINA 4JFEA 3HAEA 4QRTB 3WL9B 1P2CA 3S7GA 5EBLA 2EEDA 1CGYA 2P7TA 4CU7A 2WBJC 5IHZB 1OF2A 1OGAA 3FT3B 1FCCA 2D7NA 3STLB 1QA9A 4LEOB 4PGCA 1JTTA 5L2KE 3QXAA 3CGTA 2F53B 2VERN 1F6AB 3P73A 5I8OH 1ZLWH 3V6OC 3TZVD 1T0MA 1QZ1A 1Q94B 1C08B 3RWFA 1FFNA 4OLZL 4PLKD 2A0LD 4HQQH 4MCYA 4HV8A 4S0TD 1XF1A 5E6IB 4UQ3B 3AXLB 2OK0H 3P30H 2NY4D 3ULVL 1IE5A 3QEGL 1FSKB 4HF5L 5D1XB 3HRPA 1XZ0B 5CGYD 5FUOH 1CFTB 2YBRB 3GMPA 1QLFA 1BAFH 2DQIL 3ILPB 3EDJA 1ORSA 3O9WC 3P4MA 4JO1L 1UACL 1RURL 3GSNH 2MNUA 5IV2B 4YBLB 4EBQH 5M7QA 2NYYC 2E27H 2CK0L 2JB6A 2P8MB 4ZOBA 3VFGL 4G5ZL 2AJ3B 4XHJD 1FVEB 2PW1A 2XN9D 4JFOB 4DGIL 3TYFB 2XNAA 3DRQA 2YD5A 5DJ8B 3IFNH 3U4AA 1BWMA 4F9LA 5J0BA 3AS0A 4HLZG 4PUBH 1I1AC 5LBSH 1WCQA 1CICB 1ACYH 3ULVF 1NFDA 4PS4H 1E6OH 4PYGA 2LVEA 4M5YH 3ETBF 1WBXB 3ARXA 3MV9E 5EC1A 4FXLA 5TDPA 5IG7A 4HZLB 3QP3A 3BZDA 5HVHB 3V5HB 5EN2B 3T3ME 5DK2A 3VMPA 4LQFL 4O5LH 3GMQB 2R2EB 1QBLL 4YC2C 3VWJD 3P11L 1FNGB 4MLIA 4AEEA 1EBPA 1KLGB 3ARQA 2QSTA 1YJDH 5I8KH 4OLYH 1AC6A 4XXCC 2FGZA 1PZ5A 4P4KD 3GIZL 1A7PL 3BIAX 3L7FA 1WFOA 2FD6H 5CAYB 1EFXD 1FNSH 5B8CC 4H25B 1QEWA 5IESH 1DQJA 1P1ZB 1CLZL 1N7ML 4YIQB 1OTSD 2FATH 3U46B 3RY6A 4LRNL 3UAJC 5DVLA 3WHXA 1S7WA 1OD9A 3TT1L 1C16A 1YY8A 2L7JA 4LCUA 4IJ3C 4L4VE 5EIVA 3GDBA 3LB6C 4P2RB 4PJAE 4WI9A 2HFGH 3PWPB 4JREC 4YO0A 1PSKH 2CLRB 5IBLC 5ID1A 4PJXA 1JPFB 3B3IB 1KCVL 4PTUA 2ICWB 1I3VA 5GRJH 3OXRA 1WBYB 4HS3B 1IQWL 1NCNA 2Q7YA 4C83A 3BE1H 3TN0C 1AD9A 3MNZB 3ARDC 1QBBA 1I1CA 1U8LA 6CGTA 1AY1H 1OL0A 1UEYA 2CQVA 4XPAL 4P46A 4X98A 3K8MA 4RNRA 2AJXH 4NYLA 2XZCL 3C2AL 3RX5A 2V7NB 4ZFFB 3CU1A 2DQGH 4RDQG 3W0WB 3BP6A 2ATKA 1TETL 3LMJH 4U1JB 3BUYB 4C56D 4EIZC 3LKSB 3CFJB 4PREB 5BO1H 3H9SD 2WBJB 4UU9A 1CLOL 1MCWM 2HT2D 3BPOB 4Z18A 2X4TA 3O6LL 4POZD 2V2XA 4BSVA 2GK2A 3UBXA 4BSWB 1HXYB 4LCCA 3VFOA 5HYJE 1LE5B 5C8JB 1Z3GL 2IAND 1BVKA 2ZG3A 2DQDH 5C08B 1DZBA 4M9OA 4YQXL 1HHKB 1IGTB 4X7CC 4QRPD 4HWBA 1DJSA 3UPCA 1O5DT 1R3LB 4XP4H 3BVNA 1RU9H 3MRQB 3ZKMC 1XEDA 3SE3A 5I66A 2FX9L 1G7LB 3MA9L 2NY2C 1UXSA 3NCYS 3D0VA 2FECI 5A3IC 1CDYA 4GMTL 2B2XH 4OCLC 3D3VD 4GAJH 2I07A 1DLFL 2VLRA 4U1LA 4PJFB 2RCSH 3VXME 2A6IA 1MCLA 4Z7UF 4NP4L 5DRZA 3RQ3A 4EDXA 5F7EL 5FO9A 3O9WB 4ZOCA 1LEKB 4WHYG 5BRZE 1DBJL 3ZTNH 4I77H 5HGDB 1SJEB 1ZMYA 1NMAH 4JHWL 4JRXE 5IR1A 4MNQD 1B6DA 1KBGL 3OKMA 4R26L 4KMTH 1PYWA 4GOSA 1IKFH 1JE6A 1QRKA 4KK8D 1VDGA 4GBXD 4KTEL 3WKML 1IGYA 4IRJB 4XCYA 4X6CE 3VFMA 1ZE3C 1I1AB 4XZUB 2DWEA 4NKDB 5MENE 1ES0B 1J18A 1XGPA 2ZCLL 1BJ1H 2DYPA 4UOJA 2F58H 4MXQC 1MFNA 1ND0A 3F7VB 3VH8G 4I9WD 4DKDC 2IPKA 1QSFD 3EGSA 3RWIB 3OPZH 1J86A 5F9AC 3STZA 4XNQA 3KWWA 1OW0A 4MSWA 2C3WA 2G9HB 4KVNH 3BWAA 1SM3H 5FM8A 5L9DL 4PRID 4E41A 3VFNB 5IB3B 2DMBA 4NO2A 5FAAA 3HUJF 2FWOB 3BIKB 4YC2B 4DTGH 5T1DH 2CKBB 2HFFA 3AM8A 1C5BL 1LP9F 4OLXL 1MHCA 5IEHB 1P4IH 5EO0B 4M4RA 3NIGE 5FFLA 3SKJL 1QFUL 3LPGA 2ARWA 5E8NB 4X0KB 1UWXK 4YHNA 3O4OC 1T83A 3PXJA 5CWSB 5T3ZD 5B8CB 2H2PC 1NGYA 4NQSB 4GQ9H 1KUMA 2VDML 5KVEH 2X70B 3Q5YA 1ADQH 4XP1H 4TTDD 4HFUL 1NSNL 4HWZA 4PR5B 5D7KE 3IDUA 3VXSD 1B4RA 4IJ3B 3TH4T 4UB0H 4MVBD 2HLAB 3OXSA 1A1OA 2OL3A 5FUZH 2BVUA 4JREB 4HK3N 3NN8B 4J3XA 4V1DE 3E3QC 3BPNC 3JVGC 4K94C 3SDDA 4Z7QE 2DTML 1O7VA 5JA9A 3MLXH 1BMGA 5TGBB 5D71L 3ARDB 2Z0BA 2APTA 4JHBA 3ORJA 4XC3H 5HSFA 1NAKL 3BH9B 3EOBB 1N5YL 2EDWA 4JM2B 4HUVB 2I9LA 2BVPA 3AREA 4GMSL 4H0GA 4KRPC 3ARGA 3FB7B 1FAIL 4F15C 3BGFB 4QGTA 1JHTA 1YMHB 4ETQA 4DKEH 1XF3A 4TNVF 1BEYH 4X7TA 2BK8A 2BSSA 1HILB 2FJFB 3FQUB 3DX9A 3QJHA 2I24N 4Q0XL 3OAYH 3F6LA 2OX5A 1PY9A 3CZJA 4OIIH 4IMKC 1HINH 4EN3D 3QCUH 4Y1AD 5GIRA 3W2DL 1I7UB 4M7JH 1SY6H 4BQ8A 3PP3H 1NFIB 1SEBA 5TQ2H 4I3RL 4OAWB 1ZHKB 2LAGB 4XNMA 3FN0L 4PJBA 4KROB 3ZT5A 4WI3A 3QUYC 3DETD 3M8OH 1JN6B 3T2NL 5HHXH 2NY2B 5KBNC 4WIQA 2Q20A 5E2JA 4RFEB 4Z7OE 1TJHL 3FT2A 4NC1C 1U2CA 5T1LB 3FL7