2ZWMA

Crystal structure of yycf receiver domain from bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
DKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Antibiotics Target Protein of Gram-positive Pathogens: X-ray Crystal Structures and Search of Potential Drug-Binding sites
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional regulatory protein yycF
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zwmA00
1KRWA 1M5TA 1JDPA 2IOYA 4KZKA 4Z4FA 2QU7A 3LUGA 5TPWB 4KNYA 4W5TA 4ETMA 3EODA 1BVHA 2LIVA 2PUAA 4GNRA 4IGAA 4E7PA 1DCFA 3IP9A 4HNQA 1SXIA 4KREA 3OMXA 4DN6A 2O20A 3CTPA 3QELB 2YHBA 3OM1A 2QR3A 1Z18A 3KJXA 3LKVA 4UHJA 1P8AA 3JPWA 4Z4EA 1R8JA 4QPJC 1FSPA 3KKEA 1AB6A 1MIHA 3RQIA 2KYRA 1T34A 4MS4B 2L19A 4RK5A 3BRSA 3LUFA 3I5AA 5CNIA 5EWMA 3H5IA 4EYOA 3Q41A 4MS1A 2HSGA 4MS1B 1YK1A 1PEYA 1U2PA 4RDCA 3H1FA 4RSMA 2LBPA 2L2QA 1CYEA 3H6GA 3C97A 2PUGA 5KI6A 3JS5A 3F6CA 1QPZA 2HQOA 1JX6A 3A0UA 4JP1A 4RV5A 4O1HA 2MYPA 4Z4GA 3HCWA 3ILHA 3N6VA 1APBA 4EYGA 1IIBA 1M2EA 2CD7A 5PNTA 2B1JA 3CFYA 4G0OA 5JNTA 3I45A 4PYRA 5EWMB 3F73A 3GT7A 4MQEA 8ABPA 2ZAYA 4RY0A 4JAVC 3H5VA 3RVRA 5BQ3A 5ED4A 3EJWA 4MLDA 3CLKA 3GBPA 1Z26A 3D8UA 9ABPA 3O1JC 2AYXA 3DLBA 1DC7A 3MF4A 1WETA 5CNJA 1JLKA 1Z17A 2GX6A 3H5WA 5FWYB 5IEJA 3HV2A 3MYYA 4ZMSA 5IX8A 4KRFA 2P4UA 1AB5A 4G0MA 4W5RA 4WZZA 3N0WA 3GV0A 1XHEA 2A9RA 2MSWA 4XLTA 1QQAA 4RZSA 2FSPA 1MAVA 2H3HA 4EYKA 1DP4A 4PEVA 2QV0A 2HJ9A 3ROTA 3O2JA 4MS3B 4YR7A 3OLWA 5C5CA 2YHAA 1U2QA 4P1ZA 1RPJA 1USKA 2WJWA 3N0XA 4GPAA 3B2NA 5DTEA 4H60A 4MPTA 4F11A 3HM9A 3LUJA 4N03A 2PUBA 2OQRA 3NHMA 3RVSA 4RK6A 5HKOA 2PUDA 5CNKA 2LUOA 4E7OA 2WMYA 2FEWB 1E6KA 1HEYA 2IYNA 2JBAB 3O74A 4EVQA 3L6UA 2FEPA 4PE5B 1JFSA 4IMIB 3ROFA 1VRVA 3UUGA 3DGFC 4Z4HA 1SD5A 4YP9A 5FWYA 1GCGA 4RXTA 3HVRA 5D2CA 1F51E 4G0QA 4KK4A 5I4CA 4RY8A 1DRKA 4RK7A 4XAQA 4IF4A 3HZHA 1K68A 3HEBA 3Q7SA 4Y9TA 5TQ2A 3TMYA 3W9SA 4Z9BA 4RKRA 4RWEA 3DZDA 3DGEC 1QP7A 4OTZA 4M88A 2QW1A 3LUHA 4KQCA 3O1HB 1TM2A 4Q6WA 4ZPJA 4W5OA 1PNTA 4N47A 4KFCA 3E61A 2FEKA 3FDFA 3RVOA 2CHEA 1C0EA 3UKJA 3CG4A 3KSMA 1ZESA 1NXWA 2H0AA 2QSJA 4YRZA 3EDCA 3TD9A 3CZ5A 3KCNA 4O5AA 5JS1A 1USIA 3JPYA 4LE0A 5KQLA 5TQJA 4NCBA 4L85A 2E4VA 3H1EA 1J56A 4LX8A 4MR7B 5IEBA 2PL1A 1M5UA 4MYRA 4P98A 5DGCA 2XDYA 1YK0A 6ABPA 1QMPA 3G1WA 3LFTA 3O2QB 1QKKA 4RXMA 2OENG 5DLEA 4MQEB 2E4UA 1DZ3A 3LTEA 3T95A 7ABPA 2E4YA 4FE4A 5BRAA 3HUUA 4G86A 4G0YA 2L18A 3C6QA 1ABFA 1QNLA 3H5OA 1JYEA 3FMVA 3JY6A 4TLMB 4Q7EA 4IILA 1FFSA 5KWSA 1PHRA 2QVGA 1EWKA 3OMWA 1NXSA 2R48A 3DBIA 1ZITA 3IPAA 4MGEA 4KPYA 3HJFA 1Z2DA 3OQMA 2ZWMA 3IP6A 3SQNA 3GA5A 2M98A 3QLVA 1YS6A 3C3MA 4OATA 1DBWA 2WY2D 3MA0A 3M6MD 1F4VA 2FMKA 1BDJA 3BILA 5EWJA 1PNRA 1LK0A 3DLHA 5IULC 1QQBA 2MYUA 1QO0A 4MR9B 4F8JA 4QYWA 1DCKA 1JYFA 1NXVA 1PUXA 2GKGA 3QX9A 3K4HA 3KHTA 3MM4A 1JDNA 4UHKA 3Q7TA 3H6HA 3OLXA 2HQRA 1A04A 1BAPA 3F7NA 2FQWA 3P9YA 3QK7A 3HS3A 1Z15A 1JH9A 3QX8A 1E6LA 3CHYA 1NXPA 1U0SY 3N0RA 1QO0D 2PUFA 2FN8A 3BBLA 2WB4A 5TPWA 4NQRA 4DQDA 1SXGA 3URMA 5CNMA 5IUNC 3SNKA 1ISSA 3FFWA 4G97A 4RU1A 3UK0A 2QVCA 2JBAA 3C3WA 1GCAA 2WJAA 1ZN2A 1DCMA 2NUBA 4XFKA 5EWJB 3RVLA 1MB3A 2BGGA 5IUKC 1NY5A 3IPCA 5JNSA 3NHZA 1SXHA 2FMIA 4ETIA 2JVIA 1RZRD 3JVIA 1D2AA 3C3KA 2NZVG 3GBVA 4HYEA 2A9QA 1EHCA 5EWLB 3IP7A 3T6KA 3N8IA 2FMFA 1ZH2A 4W5QA 2FMHA 4MS3A 3OQNA 4NCAA 3HDGA 3Q7RA 1C4WA 1TLFA 4MR8B 3OO1A 5E3JA 1TMYA 3A10A 5TE9A 1BDIA 4H3KB 2A9OA 3CG0A 5JS2A 1NXXA 4EVSA 4F12A 4LE1A 2HPHA 3A3KA 4XARA 4YGXB 1TJYA 2RJNA 4MRMB 1W25A 5KQPA 4LDZA 4TMYA 1MVOA 4YLEA 2MSKA 4WXEA 2MYTA 3NNNA 4RK4A 1KGSA 1Z13A 2PAFA 2RJOA 2V0NA 3QLUC 4JA2A 1ABEA 5TPZA 4EY3A 2M1ZA 4F06A 1ZVVA 2VUHB 4MQFB 1FFWA 4N0PA 4QYMA 1YVUA 5CHYA 1ZDMA 1OXKB 2JCGA 3F6PA 5DCLA 1DRJA 1DC8A 5FWXB 3KG2A 1EWVA 4ETNA 3N75A 4LE2A 5IC5A 1QP4A 3FGZA 2NZUG 3M9XA 1U8TA 5C5EA 1B00A 3CRNA 4N41A 6CHYA 1GLGA 2LP4Y 3KLOA 3MMNA 5KQGA 1P2FA 3EQ2A 1LJUA 4WUTA 4ML3A 4OLAA 2FXIA 4Z4IA 1PEAA 1EFAA 3I42A 1W9HA 3Q15C 1ZGZA 1H9CA 1A0OA 2ID7A 2DRIA 1JHZA 2I6FA 4KVFA 2PJUA 1D4ZA 3KS9A 2JK1A 2L17A 3M9WA 3OLZA 2E4WA 4JASB 3H5TA 3OLYA 1DBPA 3FFTA 3Q9SA 3QLUA 1NXTA 4RXUA 3RVQA 2TMYA 1CEYA 3GWGA 5TPZD 3T8YA 4MS4A 4IRXA 4LRQA 4JB0A 4N76A 4F3TA 1VLZA 2PKXA 1VKRA 3NNDA 1OXBB 1EWTA 1JF8A 1GUDA 3IDOA 1BA2A 2FKAA 3VNAA 2FTKE 1JBEA 2AYZA 4RK0A 4MR7A 3HSYA 2GBPA 3QEKA 4OLBA 2CHFA 4EYQA 2ID9A 1D1QA 1YMVA 2MSLA 2PL9A 2X7XA 4O1IA 1L5ZA 1Z25A 1GUBA 3QEMB 1Z2EA 3JVDA 3K9CA 2PUEA 3SAJA 1ZGGA 2MYNA 2FLWA 1URPA 3H75A 4YV7A 2FQXA 1QP0A 1D5WA 4B09A 4FE7A 3BREA 5IBQA 1UDRA 4IMJB 5FBHA 5JNVA 5JNWA 4ZYLA 2JVJA 3EGCA 2PMCA 5TQ0B 1CHNA 1P6UA 2IKSA 5T3YA 4WXMA 1RNLA 3TX6A 3KYJB 2JRLA 4PZ0A 2WRZA 1RXIA 5EWLA 3G85A 4QICA 4KQ9A 4PICA 2WWVD 1I3CA 3SY8A 2PLNA 1VPWA 4LZLA 2GWRA 3KTOA 4LDAA 3ILYA 3EAFA 3R0JA 1MB0A 3EULA 4D6XA 2Q5CA 5B3JA 1JL3A 4S05A 2PE5A 5F64A 2F8TA 3OO0A 1ZAYA 1JFVA 2FN9A 3SM9A 4S04A 2F8SA 2IPAB 1FQWA 3QLTA 3O75A 2E4XA 1DBQA 1ISRA 1S8NA 4KV7A 4MR9A 4N0QA 1U04A 3HDVA 2RDMA 1EAYA 3CNBA 2B4AA 3LMKA 4JOQA 2CWDA 3H1GA 4KK3A 3TO5A 4D6YA 3QLVC 4Z0NA 4WT7A 2QXYA 4NICA 1D1PA 3LKBA 3MIZA 4YCSA 3N53A 4ZMRA 3L49A 2N9UA 3RVKA 2IPNA 2LPMA 3OQOA 1ZH4A 4XASA 2NT3A 5TQ0A 4G0PA 1P6QA 5JNUA 3LUAA 5HQJA 5KC8A 2P9HA 3KYIB 5GQSA 1E2BA 4DADA 1E6MA 1BDHA 4L4UA 1LBIA 1SRRA 3RVNA 3IP5A 3QEMA 3FFXA 3SG0A 1LBHA 4TLLB 3RVJA 4FB4A 2FW0A 3LOPA 2VYCA 1L5YA 2VK2A 4EVRA 5KC9A 3E3MA 3TB6A 4D74A 3JTEA 1YMUA 2IDMA 2IPLA 4MAAA 1RZRA 2R25B 4EUKA 4H3HB 4MQFA 3CKMA 3KLNA 4CBVA 3LUKA 5IUJC 3QELA 1USGA 1DG9A 4HNRA 3RVMA 3T38A 4ZJPA 1ZHHA 3GYBA 3BRQA 2QZJA 3EQZA 3RVPA 4Q6BA 1ZY2A 3RH0A 4WWHA 3H5LA 2JB9A 4RY9A 3VNBA 5DKFA 5JNRA 5FBKA 3GRCA 4EGSA 4YWHA 3LUDA 3HUTA 1KRXA 4RK1A 3O21A 5BRJA 3MQ4A 3HK2A 2NT4A 3GL9A 1JFTA 5TQ2B 5HSGA 2E4ZA 3I09A 1DJMA 1NATA 3HO1A 1FFGA 4KMRA 5FWXA 1KMIY 4RKQA 4JB2A 1YIOA 5T7BA 3NNSA 3O2SB 3OM0A 3A0RB 4G0XA 3CZCA 4XXHA 5B3JC 5GOTA 4YS6A 5HM6A 1XWWA 1NTRA 2JVKA 1Z16A 2PUCA 3CS3A 2RGYA 1Y1LA 4TN5A 3OLVA 1Z12A 2R47A 5KQMA 2A9PA 4MRMA 4W5NA 4YO7A 1XHFA 1RXEA 3S99A 4Z99A 4HNSA 4MR8A 1YTUA 2VUIB 1K66A 4OG2A 2IPMA 1JWLA 2FLKA 3D02A 3O1IC 2HQBA 4G0ZA 2J48A 3NBMA 3CU5A 4MLCA 2FVYA 2FQYA 5ABPA 1M2FA 4NV3A 3LUCA 4RS3A 4Z9AA 4Z4CA 1YS7A 5BR1A 1LJLA 4OBBA 3HXMA 1TVMA 1A2OA 1NXOA 2R4QA 2W42A 2GI4A
chains in the Genus database with same CATH superfamily
4LGVA 3TTUA 1X13A 4D4KA 3ETCA 2W58A 3A1CA 2CXHA 3PDIB 3CLVA 2PGNA 3P4UA 3ICOA 5HFJA 5EJ2A 3EGWA 4B9AA 2GAFA 1HK7A 4ND3A 2VTBB 2HHJA 5A4KA 2QRHA 3LBAA 2V7TA 1JEYA 3D8RA 4IFIA 3ZN2A 2QE7A 3EZNA 4HNQA 3KXKA 3QYPA 1AGNA 1ENPA 1WRBA 2NTVA 2DHCA 2YHBA 4RQUA 1Q0RA 5E38A 3DR3A 3T0IA 2JLZA 1YH3A 1QUFA 1CUHA 5K0FA 1VJCA 2QUKA 3BZBA 3K0FB 2ZR9A 5FLEX 2FRDA 1B6RA 1WG8A 3PG5A 3Q9LA 2W2OA 1YUBA 4KN9S 5EP3A 10MHA 2D13A 2I2BA 1ANKA 3ZI4A 3UB3A 3GIWA 3TBKA 5BMVB 3CNNA 2VBFA 3WMWA 1T34A 2ROQA 2YWXA 2DH6A 3BRSA 1CIVA 3IAUA 4KH1A 1SCJA 3PWTA 4RETA 2EX0A 3DL0A 4LGCA 5EIBD 4DMRA 1GZ6A 2VRBA 1PR4A 5F33A 3S68A 1MGPA 1T15A 5DH9A 3UV3A 4D3FA 5B6PA 2VJBA 5BSFA 5IJ9B 2WSMA 4AUEA 1PEYA 1S8OA 1TT7A 4W8GA 5G1NA 4YP1A 1CYEA 3HRKA 5IANA 2AE1A 3JS5A 2C58A 3O6VA 2G9UA 3FOBA 1E2PA 2XMDA 4JP1A 1ZK3A 1OWNA 5FBRB 3M2PA 1MQSA 2P7IA 1HDOA 3TOVA 3WISA 1TQ8A 1GUYA 1ZWLA 3B6MA 4DT1A 1X7HA 3WV5A 2R65A 3SI7A 4Z9YA 4AKEA 1NN3A 2ZROA 1OMOA 4JUFA 4OREX 1FX1A 2WIAA 4J0FA 1Z5NA 3BA1A 4MQEA 4R8RA 2ORWA 4WBSA 4EOGA 2HRZA 1G64A 3HR7A 4MV6A 4OJTA 4EKYA 2XQJA 3M1YA 3WC4A 5AVYA 4JI5B 1ELOA 1Y8CA 1OV4A 5H80A 3N2NA 4DV3B 4CKWA 3DLPX 1PKEA 3IOEA 3PP8A 4RYDA 2ILTA 1I30A 1SY7A 2QQ5A 1CDZA 1U2GC 2HBZA 2ZBPA 4U5QA 3SHQA 5HP4A 2IBSA 1U98A 3G3EA 1L7PA 3QVSA 2A7QA 5JEEA 4CCAA 3G0HA 5LBIA 1EUZA 3AUSA 3EGDA 1AZSC 4HAUA 3VR2D 1M2GA 2R00A 4RENA 1RZUA 4IS3A 4XSGA 3ZHTA 2BKEA 4CVNA 1CXZA 1GZDA 2CL5A 2HMAA 3BOSA 3IDQA 4P2GA 1E9EA 4G4IA 1JAHA 3UYLA 3BXOA 3THWB 4PEVA 3FPBA 5CHEA 3GJ6A 5JVDF 4AU1A 1NTOA 2EHJA 2YBDA 3ZGNA 4W9NC 3UKDA 4I50F 1BXRB 2FK7A 1ZN9A 1M1UA 4DC0A 4J0CA 2GAOA 4UNIA 2VP3A 3C14C 3CUTA 4Q21A 1L4LA 2J0EA 1CD5A 4HRYA 3N0XA 4I5DA 3VSBA 1KARA 1S9DA 4IOKA 1HH4A 2PUBA 5JJ5A 1PQYA 2DR2A 1OT5A 4ENQA 1VE1A 3AHGA 3D1VA 4Q3EA 3BWDD 1L8OA 2AZDA 2GHQA 4X84A 2P1ZA 4B74A 4GOOD 3GLHB 2OORA 4R2XA 4CDGA 1OI2A 4OI1A 1M6HA 2BCJQ 1L4FA 2CLCX 4H77A 3U7QB 1SD5A 1IN4A 4DA7A 4IJVA 4IR7A 3PF9A 1B8PA 1AUXA 4AJKA 1HDGO 1Q22A 4G0QA 4FI3F 1HG1A 5AICA 1Y3BE 3MD9A 1YDGA 1SXJC 3N1UA 1Y6QA 1CUWA 2XYVA 3EF1A 5KYYA 4MUAA 1NULA 1KI6A 4Z9BA 1ETUA 3O3MB 2W2MA 4IXTA 4XM2A 3GAZA 1SOAA 1SBIA 4PZEA 5FXMA 3B5JA 4JU8A 2QQEA 1B42A 4OHBA 4R69A 4Q6WA 1T8PA 1DWOA 4WFKA 5P21A 3RLFA 4KQWA 1Z0DA 3A1TA 4OYYA 4N47A 4EEXA 3JASA 5FBZA 3MRTA 2FX5A 3B48A 2XZTA 4MW9A 2GPAA 1NXWA 2RGAA 3F97A 1RYEA 1JSRA 3BK2A 3DFKA 4JFRA 4AN0A 2EJBA 2EP5A 4WLEA 4YJGA 1EGQA 5A2GA 1I5RA 5G4LA 4AY4A 4MR7B 3LWDA 1RJWA 3NAQA 3IMFA 2X5NA 4QQNA 2WIDA 2XDYA 3GJ0A 2YZ7A 3QVKA 5K09A 3WJAA 1NASA 4QX6A 2A8YA 5LKAA 5K0GA 2VXCA 2ZSKA 3TZQA 1EBFA 4AZSA 2A5YB 2FPSA 2VUUA 2OBNA 2HSJA 3AEUA 3DOHA 3H2JA 3MGBA 4BBJA 1NBOA 2PL3A 4CCYB 6NULA 1VM6A 4Y6SA 4KXYA 1EXNA 2PKRA 4GGOA 5JI2E 2R2GA 2VLIA 1LK7A 3WSWA 4EATA 2RGWA 3E9DA 1P1FA 1XNGA 2FPGA 1EVYA 1RRKA 2IZ0A 2Y1KA 4MIKA 3BGWA 2X6TA 4TLMB 1PHRA 3A1DA 3T3IA 4A6EA 1VYHA 4M9RA 1N6OA 4H17A 2JJ2D 4EGAA 2W43A 2XA1A 4MGEA 2FQQA 5IAKA 1FTGA 5A0VA 2F64A 1M5RA 1H0HA 1EZ4A 5H82A 1IPHA 1XEWX 3STHA 3KZNA 4TXLA 1LVHA 2OOSA 4CQMD 2ZT8A 2R97A 4QJBA 5JS6A 3QLVA 5CBKA 4WKNA 1XE3A 1J8VA 5BN5B 1GY8A 2BHRA 4JKIA 3SFVA 2ODNA 3BILA 4EUEA 1EP2B 2JEZA 1TZ2A 2MSEB 3E5RA 4MR9B 4Z3OA 4QYWA 4WFJA 1FFEA 2IDJA 3DM5A 1NUTA 2GCOA 4PYIA 2YUIA 3LAWA 1OFHA 2GD2A 1UFQA 4WGFA 4ALMA 5BSGA 1DIBA 1UZUA 2BTQB 4IUDS 3AI7A 1VGRA 4CKXA 3OIFA 1PLJA 1J1UA 2WM3A 4G3XA 2WDZA 4MW5A 1E9RA 4JLUA 3WX0A 2UUOA 1U0SY 3N0RA 1QO0D 1XTUA 4LYJA 8LDHA 2D0DA 4DQDA 3QWHA 5BWLA 4JJIA 1T2UA 1ZK4A 1R6XA 2QEQA 2WZDA 3KKOA 2D8AA 5EUMA 3BKXA 2QN3A 3OE1A 4CHGA 2QZ9A 5CLLA 3QI7A 2ZJBA 4UZSA 1XOIA 3NJ8A 1AGYA 5FQNA 5K3FA 5TVKA 1GCAA 1XCLA 1Q14A 2OORC 3HLYA 4ND5A 4AQYB 2VNKA 2Z3ZA 2FUKA 3R9XA 2DUMA 4KR9A 1RZRD 1LNSA 3TRDA 1ZK0A 3VO8A 3D2BA 4CTOA 4ZHQA 1RWBA 4BNMA 5CG2A 1ACJA 2ZWVA 5HZKA 2A9QA 3RHZA 3SDZA 5IFKA 3F9RA 3HCDA 1J0CA 3N8IA 1K6EA 1A8IA 1F48A 2CLDX 3BXFA 3Q0EA 1PZEA 2EGUA 3LBHA 2BGKA 4LV8B 2IH5A 4M8SA 2ZRIA 1B15A 2OM6A 1KP2A 3JQ7B 4LY9A 1P7CA 1CRZA 3GOQA 5GADl 4F56A 3O7MA 5I4IA 1VC2A 3RUAA 1T0IA 1BD4A 2H16A 3C6KA 3OG9A 3SNHA 3EUWA 3ZCUA 2ECPA 4IXDA 3S81A 1FJXA 1DLIA 3IJRA 1Y1PA 3I39X 3O8QA 4RK4A 2C4UA 5K4HA 1P1IA 4EY3A 4I36A 1NNLA 5ERYA 5KMGA 3DBLB 5DWVA 4A6PA 4WY2A 4DZZA 4YT2A 2OHJA 4DV7B 4M0DA 4GR4A 4Q47A 4UM9B 5C0OE 4BU1A 5EZSA 3DVAB 4M87A 3F6PA 2AOTA 4DT1B 3HABA 5SYAA 5FEMA 3A14A 3MVEA 1OIXA 3OLQA 4ZVTA 1QGZA 4NJOA 1MORA 2A33A 3E6AA 4PLYA 4TZKA 1FX0A 1P2FA 1V5EA 3FUVA 4FOLA 4FZRA 4QOFA 1ODLA 5KQGA 2A0KA 3LG2A 1DGQA 4B5LA 2GOYA 1JN0A 1UFKA 4MYSA 2VDQB 5J59A 2AFHA 1D4ZA 1LTQA 3OFNA 2QIOA 2WWIA 3EPPA 3C6MA 1TCUA 2IGTA 3W8FA 3DF9A 4C5BA 3B6JA 1QFXA 3DZCA 3SEZA 3OLYA 3UHOA 1S0UA 1V11B 2MINA 1UC5B 2IYVA 1R7RA 2DPXA 2O5VA 2XE8A 5EKUA 1N6LA 4RJ2A 4XKJA 3FWPA 2GN0A 1C80A 3IOYA 3G5UA 5P8WA 2PXHA 1XA4A 4BKPA 1YZFA 1FDSA 5C8XA 4HQLA 4DR7B 1TQ4A 2NV0A 2PKXA 3HEMA 4HL6A 4GVLA 4P4LA 1A7JA 1JHYA 4KDCA 4PFQA 2O2EA 2XKKA 4OFXA 1WXXA 3OQ6A 1R50A 3SHWA 1ZNWA 2FP4A 3C6ZA 5EVCA 1AOXA 2PD4A 3AIKA 2QORA 4Z86A 4ZU6X 3JD3A 3RWBA 4BFCA 3OEHA 3NM6B 2C2GA 3DMTC 1CS0A 3UMCA 4DMUB 5JPCA 3EASA 1MRSA 3IPXA 4Y9UA 3UJDA 2J0SA 3L9XA 4F3TA 2FPPA 3B7WA 2ZWIA 1SBCA 1F6BA 1AURA 1ST3A 1XEAA 2IU4A 2IYSA 3OWXA 4BVFA 4TTTS 5I4KA 1CHNA 5HEKA 4B79A 1RNLA 4LSMA 4F4UA 1N0VC 1YR3A 2HA2A 3I4LA 3HUEA 1UEJA 4Q16A 4CG3A 1TOAA 2TRSB 1I3CA 2PLNA 4EJSB 3E5NA 3MBOA 1D0SA 3HGMA 1MXHA 2RHCA 3L41A 3NHBA 3S1AB 1QHHA 1F0YA 1RRVA 1KXJA 1CY1A 5AXBA 3MT9A 4GKAA 1V71A 3VV3A 1A2QA 3TSOA 2F1HA 2YWBA 3BFJA 1L7XA 3AF4A 4D79A 1W9MA 3O9ZA 4WSOA 5K8IA 1YQXA 4LWZA 3ZBUA 1NP6A 2DKOA 3LRXA 5K0NA 1A71A 4MYCA 4JBNA 2QW8A 3VYSB 4DVJA 5CFQA 3EY9A 1HNXB 3LM8A 3QVWA 4JOSA 4MR9A 5AVSA 3H05A 3I9V1 4Q9HA 2DWOA 2CKDA 1TCCA 4QQ8A 1LTKA 4W5QA 2PYDA 5REQB 2B4AA 2IOFA 3EXAA 2UUAB 4L50A 5LB4A 3OOWA 1N2ZA 3TIIA 4KO3S 5BUZA 3U9TA 2P90A 4LJ8A 1OCEA 5KVVA 5ELXA 2IP1A 2QY9A 2W70A 1GCOA 5ALUA 3ZCSA 5J4VA 2IPNA 1WXIA 1PLLA 1Z6ZA 1P1KA 2R86A 4H7KA 1JR2A 4BEVA 1O0CA 4ZVPA 2K6GA 5KOJB 2FPPB 2Q8PA 1J9ZA 2QN9A 3NUQA 3KZMA 3ND8A 4GS5A 3WLRA 4P22A 2I6XA 2Q5FA 5K6AA 1T5IA 4KUHA 3IVRA 4AMZA 2DFVA 4LQDA 3PD0A 4N82A 3ZR4B 1HBJA 2H2AA 3CNEA 3GPCA 2G83A 2P1DA 3W8RA 4QNNA 5EMLA 4II3A 1TT5B 3H8WA 3SPXA 1SZJG 5AW3A 2XMCA 3N86A 4ON9A 1JHOA 3QMWA 4KKVA 1EIZA 1E9CA 1KDVA 2P8JA 2DXIA 3JTEA 1CIJA 1FLDA 4MAAA 4WXPA 3NV7A 1WR8A 3EY4A 1QB8A 4X00A 5JWHA 5BURA 4MQFA 1MB4A 3KB1A 1M54A 3MGKA 1QQ7A 1V7CA 1W34A 3E4DA 3HA3A 3P9SA 3QPAA 4KDRA 1IZYA 1ZJ6A 2WF7A 3DT6A 2QUHA 3D6UA 4WWHA 4XM0A 3ZGXA 4BNVA 1MZVA 2DR0A 5DTIA 5JADA 4L15A 1X14A 1YU9A 5IBPA 4E21A 2H5LA 2A35A 3Q3CA 1L7VC 1ZUD1 1OAAA 1LPMA 3WDKA 3BJMA 1VBKA 2QD1A 5LOVB 5H9VA 1JUDA 2P5TB 3UJCA 1E6UA 2ZVDA 4D8UA 1UEIA 4DMKA 2NVWA 4GYYA 1H9AA 4INPA 3CCBA 3NIDB 5HSGA 5KYYB 1EB9A 1YB7A 3ZY2A 1EX9A 3I09A 4DCOA 4JGGA 4XIYA 1LNZA 1JKMA 2X5OA 3V4SA 2VXBA 4JB2A 1L8LA 1NVXQ 1NE2A 2OCIA 1WVMA 4JJKA 4IICA 2JLYA 2H06A 3WL4A 3IUMA 1DADA 4QRIA 4WEQA 2WC1A 1RPZA 2DWQA 5ECGC 4QREA 1EA7A 2RB4A 2EZ4A 1IWBB 4D4HA 5FT9A 2OM2A 2ZYTX 4NH0A 5D5QA 4XIFA 3WYBA 3TW8B 5IM4F 2G0NA 1R6UA 2AKEA 1S8FA 2R6R1 1WCIB 3D7NA 3E9CA 4OHKA 4RCZA 1EK1A 4YBZA 3JQ7A 1J4AA 1KOFA 1E79A 1UOPA 3KELA 3MFQA 4CF4A 1HYGA 2DFNA 1NPDA 4HNSA 4XPIB 1KP9A 3SSOA 2JIQA 1W88A 3H1TA 1YTUA 2BN4A 5D3MA 5DGTA 3DPUA 3HYCA 3DE0X 4RMJA 4KAFA 1EB8A 2WOJA 4LGYA 3T3GA 2YC2C 1Z62A 3VSDA 4HWSA 1UBEA 2C4HA 1MW9X 4LC1A 5EHIA 1PGPA 1Z0IA 4KVGA 1SBQA 2AGVA 4XWYA 5DSTA 4B7ZA 1CY6A 1G2PA 5BR1A 4DZRA 2OXCA 1T4GA 1JZTA 3CX6A 3CUEF 2SICE 3MLEA 3C74A 4IIFA 1EHIA 2WOOA 3TVTA 3K9HA 2PZ8A 4UTOA 1NF8A 3PICA 4V0SA 3JX9A 5IXJA 2X8JB 2P2ZA 1FZTA 1O94A 4GNRA 2A9VA 2ZIXA 1L7EA 4E7PA 4NZOA 1U99A 1DCFA 1E96A 1J70A 1U2EA 2QV7A 1XO1A 1B8UA 2ZSBA 3LD9A 4MITA 3A6HA 1T13A 1A2BA 3OJLA 3V33A 2GM3A 4D0NA 2BM9A 1YBAA 4MQLA 3GNTA 2CT8A 3EDRA 3OE5A 1QCYA 3PJFA 3FBTA 4A8PA 4E3WA 3RQIA 3B1KA 4JZYA 4D80A 1IXZA 2W6JD 4MS4B 3E3LA 1JWAB 1NKVA 2Z4RA 4E5SA 5F51A 4YMUA 1HZZC 1UJNA 4IIJB 2JD1A 2M6RA 4KFTA 3RANA 2EQAA 4G67A 4GMXA 4E2WA 2P5SA 2YJGA 2WW8A 5BSEA 2VBIA 1K4YA 2WU1A 5B57C 4CTKA 2CUZA 2VAMA 3A4LA 2VHQA 3R8XA 5AI9A 3VDNB 2GMWA 4KXUA 3WWYA 4DA8A 3IE2A 2I29A 2YV3A 3PDUA 1HEUA 2EEZA 5I51A 3ZE7A 1A9XA 3CB4A 2OUIA 2XR1A 1HRKA 1U8YA 1ZUWA 1GT6A 2BFCB 2WWGA 3TVYA 4CKEA 3QMVA 5H4HA 5FPKA 3QVLA 4QLAA 4RY2A 2Z5FA 3CVVA 2OK8A 3G59A 1BYIA 1VG8A 2WKWA 1PZHA 7REQA 4OV6B 3J81k 4FDLA 5I7UA 4R8LA 1RAAA 1EFDN 3F0TA 3SZMA 1XMPA 2OHVA 1Z0KA 2G1KA 2QAIA 2IA5A 4M1MA 4EG1A 5JV5A 5ER6A 2G5GX 2XDAA 2ES4A 4BO8A 1I7LA 4DMCA 2ERXA 3R40A 4EECA 5AOBA 4ZZ1A 3PYXA 4LRUA 2BDUA 4FBGA 4HFNA 1U0FA 4G36A 1Y8ZA 4EMUA 1SHUX 2BH2A 1T3SA 3E8MA 1CVIA 2DY1A 1RLUA 1XALA 1E2EA 2QN6A 5JXWA 1E63A 3TAUA 4QO8A 2BSXA 4EA7A 1KAQA 2MSWA 3DQZA 3KWLA 4KWEA 1D6MA 2YV4A 5I5GA 4PM4A 2PH1A 3T94A 4LOHA 4BDTA 4GOXA 5GVSA 1Z83A 4QE3A 2PSDA 4NEGA 1NNEA 1TZJA 1E61A 3D7MA 4PZDA 2O1WA 2MWMA 2WLTA 2WIKA 2IIVA 3ZWCA 4ZAFA 2NO7A 4TKZA 2DBRA 3FH0A 2A5FA 1IHYA 4DIBA 5IJWA 3V2HA 4P1ZA 1PR1A 4AO6A 1YJ8A 2A94A 4MPTA 5LLSA 1QHGA 1QK4A 4N03A 4Q7LA 1YAJA 3DTVD 3WKAA 1N3IA 2JJ1D 3C7KA 3UT5B 5DGHA 2AMLA 1E5XA 2JBAB 4ZZ0A 2I4IA 1Y34E 1OVGA 1OT3A 1H8HD 2VCYA 3H5NA 1QTIA 4GOKA 2D0PB 4WFQA 1VRVA 3V8QA 4S0ZA 2LCQA 2FZVA 2CXOA 4KX5A 5A5FA 2QTGA 3QWAA 4IWNA 4UNQA 2PWYA 4YCAA 4KVZA 2CDNA 3TLYA 5AFSA 4N65A 1WHSA 2JGRA 4KOEC 3UJNA 2X77A 3HVRA 4OHWA 4EA9A 4MQUA 4F72A 1ZMTA 3H4TA 2QE7D 5LL6P 1EA5A 1IB6A 1AH2A 1TMOA 3GG2A 3UJ8A 3RSQA 4UEWA 5BT8A 3K09A 1KAMA 2XRZA 4X1IA 1A9PA 1E1RA 1R9JA 2CVPA 2QM8A 5EXXA 4EZBA 1QP7A 2B1QA 1QTQA 4FU0A 1ONBA 3R7LA 3V7YA 1MO6A 1VSVA 5AW0A 3DCIA 3SJZA 3THWA 2I6UA 2DFPA 4WI1A 3NBAA 4QSMA 1EM6A 3BRWA 3EPJA 4HY3A 3TIFA 1J5PA 1GL3A 1JGTA 1CB7A 1M10A 1XZEA 3A2MA 4M38A 2JFVA 4OKSA 1QORA 4D4LA 4TS4A 1AJEA 3TCNA 2XE6A 2WAOA 3QMPA 4W7IA 5LOVA 3KZKA 1RZVA 4L16A 2FN4A 4EG0A 4YAKA 1HNNA 2BGWA 1YK0A 1ZXXA 4JJGA 2YCBA 4MZDA 3LIIA 1CZRA 4YGYA 4HH1A 4ZXFA 3RUEA 5AW9A 4NKRA 4OJNA 1Z22A 1QGUA 3LTEA 5EJ9A 1V41E 2QN1A 3OZSA 1HYBA 3ZHZA 1WDTA 3WHLA 4H08A 3RJ5A 1GU0A 2FJPA 1AC5A 1ZYUA 3FNBA 3NBYC 3VC2A 1QNLA 3DE5X 3NIBA 2AUNA 3OOYA 4I8IA 3C3BA 2C7PA 3BERA 3AJAA 1P4RA 1RPTA 5A7FA 4OYLA 1O2DA 2AW5A 3U13A 3HKBB 4Q1FA 4TMFA 4I1IA 1QWSA 1JJAA 1NL3A 1SO8A 1Z74A 2RHOA 3MWJA 5JRDS 3J7TA 3PNBA 4ZVUA 1II9A 2H65A 1L4UA 2JLUA 1QYDA 3HBFA 3TFOA 5LA6F 2CNWA 1C9KA 4FI3C 4WECA 1L5VA 4EM6A 2WD7A 5CVEA 2VSFA 1XTJA 4GRDA 3HDQA 1Y7IA 1ZN8A 1XRRA 2EOAA 2YDYA 3BXXA 3GEDA 2AA3A 3KR2A 3LS2A 1W8DA 1E5QA 2H1IA 3ZK7A 3MCUA 4X45A 3UKOA 421PA 3T0GA 2QX9A 4HFRA 5HYVA 1O8CA 1XVLA 5EE9A 3MEQA 4I08A 4DY4A 1S5PA 4AXXA 1R16A 2WHQA 3KHTA 2ST1A 4C4YA 2PWPA 1T5SA 1O94D 2ZRKA 2IBTA 2DPMA 3OIUA 3OLXA 4IGFA 4JH0A 4LZJA 4C9BA 1EFVA 4FSXA 2BM1A 4Q34A 3FRJA 2P9QA 3QK7A 1B0PA 2F9MA 3ACBA 4GWKA 4QFBA 3KLPX 3NG1A 5DHRA 5U4QA 4UFNA 1OD6A 3VPGA 3TQOA 3FI0A 1YR2A 3I9MA 1YTLA 4YJDA 2YMQA 1VHWA 3UA3A 2E6KA 3K73O 3HWSA 3AM4A 3FKSD 3SNKA 3VU1A 3FE2A 1AUOA 3F5QA 2WT4A 5AUPB 3IKJA 1DB3A 1H1DA 13PKA 1U3FA 2P2GA 4LGMA 1DCMA 4P5DA 3I8XA 4AMUA 3KWMA 4PLFA 2BGGA 1KC1A 1VL6A 3WK8A 3ENZA 4BJ3A 1PYDA 2PS0A 3GLUA 1U7ZA 3ZY4A 4ETIA 4QVIA 4DM4A 4G9EA 3WE7A 1T2AA 1TQDA 5ALSA 3PXEA 5AHOA 4HYEA 1V96A 4GDFA 5TJ9A 4XYEA 1T8SA 2PGOA 2NVBA 4QO7A 4TMKA 4ZI7A 5HHTA 3PHHA 4HO1X 3CZRA 3HB4X 1OYVA 2Y0EA 3CLUC 4HX2A 4XFDA 3RW9A 3WL3A 4BX8A 3BH7A 4P35A 4D9KA 4DTCA 4FLMA 2XITA 4Y2VA 1CEYA 1QJCA 1BMFA 1QYCA 4WLUA 2R1VB 1BKYA 2D1QA 3IO5A 4LE1A 2R44A 3A3KA 4P7KA 4B3BA 3ELYA 2QNRA 2D4AA 2W22A 5T6MA 1ISIA 1N7HA 1UR5A 1Y5IA 4P4GA 1HEIA 5CCDA 3T99A 1EFVB 2XB4A 2OCKA 3UHPA 1R88A 5DI9A 3G2OA 1R2QA 3W79A 1QLHA 3QLUC 1PTJA 2D7CA 5HE9A 1KIMA 3IV6A 1ZVVA 3O3OB 2UYHA 4KE9A 4QYMA 5DB4A 4A23A 5ITSA 1ZMOA 3PCRB 4KI0A 2LDXA 1GZ3A 2AX4A 1EGAA 1OXTA 1W46A 2IIBA 3F2VA 3GD5A 1W19A 1S02A 5FUBA 3W2TA 5H3HA 1A9XB 1DSSG 3VTFA 1VJGA 2SKDA 2CMKA 4JEHA 3H2ZA 3AF6A 2IEIA 1U8TA 4Q4AA 5F7JA 5JAZA 2VYFA 2UVDA 5B1SA 4D26A 4BDSA 4N41A 1NMSA 1V11A 2MINB 3C16C 3EGXA 3MMNA 1RWPA 1V5IA 1XPJA 4IZ6A 3UHJA 2V55B 2K7FA 3SOZA 4DIDA 5CIWA 3W6NA 3CF4A 4PLWA 1VMEA 2D5CA 5IC6A 1Q95A 5FLKA 1XCPA 2F2TA 2GH1A 4F2PA 3BF8A 1TTPB 1I3NA 3A7DA 4KIJA 1JS1X 3T9FA 3ZY5A 3UV7A 4FR5A 4WFIA 1RJDA 4UM7A 1A8QA 3KYDB 4IOJA 1UK7A 2N1MA 1XXLA 1M8JA 3VC1A 3UUWA 2DAPA 1NR5A 2R8YA 3P2EA 4ZZIA 2QMZA 5KOHB 1KEVA 1W2GA 2CNNA 1KZ7B 3L0DA 3LP5A 3PXAA 4FYWA 4M1YA 5FUYA 1YQ9A 3KVRA 1FDIA 4H9GA 1G5HA 4QEKA 4JOBA 4XDYA 2JC3A 3DVAA 2FTKE 2CBGA 2PEZA 1KDPA 3HSYA 1OBOA 1VPVA 2F4VB 3JYNA 5K8TA 1O6ZA 3DJFA 4UDOA 4YMVA 1TMGE 4KR0A 1KI4A 1XQXA 4KHZA 3ZWQA 3SVTA 3K0AA 4QOGA 1NV8A 1ZGHA 2BLNA 2PGAA 4OQYA 2Z0MA 3I73A 3PRYA 5DYGA 3BAFA 2B5WA 3BTSA 2HFJA 4YX9A 3PJDA 4B2YA 4HTAA 4WNYA 4AJNA 5CTJA 5CH5A 1IN1A 3KB8A 4MKRA 3ONEA 4PLHA 1W88B 4S2EA 3HJHA 1QIDA 5FUVA 4MWOA 5K6RA 1JG2A 2PH3A 3UWMA 2PY6A 3IH5A 3PZBA 1RWQA 1XEXA 5KDDA 1O97C 2SKCA 3AW8A 3W90A 2B20A 2X23A 3NKLA 2VLBA 2CCGA 4MV3A 5DNVA 3GCDA 4G56A 5IDVA 3JQRA 1Z0UA 2WJIA 3VR4D 1MB0A 1UPFA 3W2IA 4LW8A 4JBLA 4ZICA 2A1UB 4S05A 1RRPA 4DPLA 5KNCD 2GJ9A 2ZSHA 2VVTA 4HJRA 1NMQA 1XCBA 2P68A 3T7JA 4NSNA 1S3GA 3MBIA 3WAJA 3ZK9A 4DJAA 2E4XA 3L3BA 1ISRA 4RDIA 4M9UA 4K1XA 2JFYA 3IBGA 4JWTA 4XGRA 5IAGA 3G7SA 3STWA 1YR9A 4XWGA 3L2OB 1CW2B 2PUWA 4DCUA 1YDMA 1NV9A 1AQLA 3M3HA 3RRFA 2X7HA 3S70A 3WNZA 4BNIA 5C34B 5L9AA 2CFCA 4Q03A 1B6SA 4PY2A 1Z0JA 2AOUB 2QENA 2EAUA 5KHAA 4CT5A 5A02A 2I6SA 3TGWA 4ARBA 4HEA1 1CWUA 4KRGA 5HFNA 2WHPA 4HLUC 2JPDA 3U7RA 2HDNB 1CJUC 1G5TA 3D2LA 3CUWA 4HDQB 4KWTA 5DK4A 4AD8A 1SRRA 2C59A 2FWMX 2OD9A 2HEGA 4JT4A 3UNXA 5D00A 1JLMA 4FDAA 3MLAA 5B58C 4PS1A 3U81A 3HZZA 2FW0A 1ZQ1A 5HW0A 3ESRA 3AYZB 3ZHQA 2EV9A 1DG3A 4UHCA 3E7DA 3NR2A 5HTKA 9ATCA 1XJWA 3BD9A 1UDXA 3F4BA 3E3OA 2Z8YM 1OZFA 1YMUA 4MVJF 1N57A 3EIOA 4Q66C 3PD1A 1CUXA 4JXKA 3AEUB 4KLNA 3SKVA 3M4XA 5EJIA 3EF0A 3WWDA 3VJRA 4HGNA 2DKNA 4ZTZB 5CTAA 1W76A 3AFIA 4JDPA 1ZHHA 3AVOA 4D4GA 3CO5A 5B12A 1EBUA 3JRXA 3G0CA 3R6WA 4HDAA 2W2LD 3OZWA 1KETA 4CQMA 5GAJA 4LMRA 2EU8A 2HOQA 2QX4A 3GG9A 4FR2A 3VU3A 4D82A 2EYQA 4YWHA 3ZHSA 4WZAA 4JQSA 5KYUA 4M83A 3T3NA 2XCOA 4ENRA 1P7ZA 2GILA 1KY2A 3NT5A 2QLMA 1T1GA 4HXGA 2B9EA 3I9KA 4HC4A 3R8FA 4QUGA 4BNJA 4OQXA 5FB3A 2XIJA 5AI0A 2ZTLA 4EG8A 2R1ZA 2G4VA 3DHVA 5LLTA 2DERA 3D1JA 3AU8A 3PWZA 4N7BA 2EWMA 2J7PA 3DS8A 2IWHA 2XCQA 2C5SA 2DYKA 1BA3A 4GI5A 4JQCA 1KMMA 5GOTA 1VL8A 5A5VA 4K3UA 1NW3A 2W11A 3ABZA 1Z16A 3CRRA 2QLNA 1SKYB 3LGSA 2DBVO 1V35A 4HDMB 3FMFA 4PLVA 4BB5A 3VHXB 1G55A 2JA1A 4MWDA 5AK5A 1SXJA 1N5DA 3KJEA 4H0FA 4E2FA 2FGKA 3VJLA 3E9EA 2J5KA 1E64A 1AV6A 3FIJA 2YJNA 5KYXA 2FFAA 2O2IA 4YJ3B 1XCMA 2HKIA 4HR7A 5JLAA 1UPXA 1XG5A 3O47A 4LDNA 5AVTA 3RIXA 4AY3A 2Z5GA 4TM7A 4ADSG 2MSCB 2HQBA 4KAAA 1N2GA 5L95A 5ABPA 5KTMA 3I53A 5TDHA 1QRSA 4R7GA 3LUCA 3I0MA 3DZFA 3BQ9A 4Z9AA 2YIMA 2O8FB 3AV3A 4B32A 3M5CA 2XQVA 4N9QA 1OPRA 3LK7A 3PLRA 3PFGA 3BDVA 3CLSD 3AHCA 4FIZA 2GI4A 1WF6A 2CDCA 2AC2A 2CLKB 3E84A 3PC8C 4REOA 5FPPA 3RBZA 3W2EA 1XKLA 3B2QA 2I9PA 4O1MA 3JQ8B 4B47A 5LQAA 3RRNA 2DBYA 3EODA 3PT9A 4LYYA 2AKAB 4XVCA 2JGIA 4PONA 1AF4A 1PZMA 2GUGA 2FW9A 2I4OA 1C0LA 4IJ5A 1NR1A 1XZ8A 4EDHA 2JGDB 3VNUA 4KLAA 3IP9A 4IIBA 4RD6A 3OMXA 3WLEA 4KREA 4QHTA 4KE7A 1KZHA 3AEKB 3RIHA 4AZ3A 4UHJA 2I7DA 3BSWA 3NPAA 2YJ3A 3P9CA 4EKEA 5ALHA 2ZBUA 4G1EB 2QTTA 4I8XA 1WA5A 4JROA 1FP2A 2R1UA 3FXAA 2J9XB 4RA9B 2I2FA 5KX5B 2E4AA 2KYRA 3QNUA 4ZQIA 5BNIA 3BCRA 4JBIA 3CVOA 1XU7A 3NEPX 1PNOA 1TIPA 2VWGA 4TTPA 5TEVA 4DR4B 1K4MA 1JW9B 4NZNA 1FXUA 1O5OA 2H4WA 5HJ7A 1GGEA 3Q41A 4M7RA 5IF9A 1ZU4A 1G1AA 2JI6A 1HZZA 2GPSA 2IUYA 3H9BA 3A2NA 3HZRA 3KAJA 2GZ3A 3QP9A 4G5QA 1H2FA 2L2QA 3GJ8A 2X13A 3L8ZA 4Y1GA 4ZO7A 4LXQA 4WBNF 1U7PA 2WJVA 4TQUS 2Z08A 5E2AA 4HGOA 1QPZA 1LLQA 3AVYA 4J0EA 2FPMA 3V8PA 4DDTA 2RK6A 3HCWA 5CGZA 1KK0A 1XLTA 5D5HA 3THOA 3FMPB 1NI4A 4A6XA 4EJMA 3P7MA 2ZSFA 2CD7A 5KOYA 3NMUF 2DTDA 2B1JA 3L7OA 4OHYA 3UCEA 4I4NA 1MVNA 2LR0A 4KQJA 4TM8A 1SBNE 3WKBA 1SJ9A 1YZTA 2QOEA 4K6FA 4XYMA 4AS1A 2ZAYA 3ORRA 4RY0A 1ULAA 5BQ3A 3A6FA 5DLDA 4FEGA 3DL4A 1RVDA 3PVZA 3TNYA 1Y8QA 2Z4SA 4U63A 5AXDA 3MAJA 4OFWA 1KMHB 4DJ5X 4NJMB 2DHRA 1JIQA 2H07A 2W2XA 1E9VA 1YOVB 3NVDA 1ORIA 2JAUA 3R6DA 2V5UA 1PFYA 1VI5A 4TXMA 1NI5A 4UPEA 3FNEA 1YACA 1MP0A 1EH5A 1SG9A 2HB6A 4W6QA 3THYB 5KVCA 5JHHB 2A14A 4CIXA 4NWIA 1H5QA 3FX2A 1MPXA 2JJYA 2EJCA 3TLBA 3RUPA 8MHTA 2ZSAA 2FJUA 2W8BA 2B2NA 1OILA 2H3HA 3HWRA 4WBXC 4UMVA 3R9XB 2VZ0A 4NOKA 1DKUA 1I2AA 2ZPUA 3A9WA 1C7QA 2HJ9A 2FZ5A 2R1TA 5K3FB 3WGMA 3O2JA 4AG5A 3UO8B 4YR7A 4AI6A 2XMZA 3PHJA 4O4IF 3G5AA 1YI0A 1WULS 5B37A 4E3ZA 2EEPA 1Y9AA 4GPAA 4F11A 1MOSA 2BBOA 3K5PA 1HRDA 4TYMA 5ALVA 2ZYVX 3NTUA 4P32A 1E5LA 3W77A 4PF1A 1T43A 4LJ7A 1I9CA 2C9BA 3ESXA 2JLRA 3PRKE 4IKOA 3VI3B 3ZLUA 3PL1A 1S3FA 3HJNA 2LV8A 4N3BA 2FEPA 2ZYAA 2V03A 2WPNA 1ZR4A 4R1QA 3LQYA 5JE8A 2PKQO 5LM3A 2R84A 3QLEA 2ZIEA 3V5NA 1M9NA 4FCCA 5F1OA 3OT1A 1MO4A 3MS4A 1C3OB 1XZKA 4YRCA 2UYQA 4RCVA 5DBGA 3WA6A 1Q7CA 4KCGA 4WNCA 4U7HA 3K1ZA 4TWBA 1N4AA 3T3DA 5LA6B 1TNDA 3ZS9A 3RT9A 3UOAB 2I4TA 1SUBA 3PC3A 2YV5A 4PHGA 5ETJA 3WMXA 4Z2YA 2CJWB 2XD4A 1WD7A 3HR8A 3CH4B 3BXPA 2QDKA 3QF7A 4PZZA 2QVXX 1CUAA 2GKOA 1XC7A 3ONFA 1BEUB 4DLUA 4XQ0A 2IYRA 3JAWB 5SZIA 1G2OA 4CNBA 1XEFA 2CLSA 5IN4A 3T12A 1U3GA 2OFWA 2WIJA 2AIRA 2W6OA 4BQRA 1OB5A 3RBVA 1R4NA 1GPDG 1N1MA 1DIOB 1L8QA 2H0AA 4DE5A 2W48A 4IBOA 5JQWA 4EYSA 1K75A 3C1UA 1SA0B 1PJQA 3FCUB 5EKSA 2E9SA 1JMYA 2ZJZA 3I2KA 3TN7A 2AH5A 3NAGA 4ZI3A 1EQ2A 3SJ7A 1UPTA 2XBMA 2O7SA 4WH0A 5AI4A 3U61B 3SN6A 4OHRA 5EZQA 3WZLA 3RS7A 4DC9A 4ZXPA 3NDJA 2HMYB 2P9EA 3LFTA 2OXRA 2OENG 3V8MA 1D9ZA 2E4UA 2VA8A 3R7WB 2V6FA 3EXEB 3W8NA 3GBSA 5DXJA 2JHFA 4MUEA 4DUGA 1XP5A 4H2DA 1TUBB 4UAJA 3IQGX 4H7DA 2SBTA 1Z6YA 5A9TA 4YAFA 4DLWA 3H5OA 3JY6A 3HE3A 3ANLA 1Q83A 3OSZA 4B6OA 2KPOA 1RI4A 1W4RA 4JUIA 3GFVA 4RGYA 4REQB 1R4MB 2UZ4A 4DYDA 4D81A 2ISSD 4Y98A 4CODB 2ZBQA 1Z5VA 2V6BA 2I2WA 5A62A 1IHDA 2RC6A 3NBQA 4FZVA 4JUDX 7MHTA 3VMFA 2AFIE 4II2A 1FX0B 4FFMA 1XVIA 4LRTB 5KTNA 4LMPA 3OQMA 5AMXA 4G5RA 4JL6A 3L8EA 5CB4B 3O38A 3PVSA 4PW0A 1QYRA 4GMKA 1XZCA 4TZTA 1JAXA 4AMBA 1Q3KA 1QIMA 1Y8AA 4LTMA 4YRBA 3CR3C 1TI7A 2O8NA 2FMKA 4EB0A 1EKXA 2O8EB 3T1VA 1WDKA 1K3TA 4U2GA 4OOEA 1JALA 4A91A 5BP7A 1GNPA 4LX0A 1WKCA 5AW1A 3GLFA 1Y6FA 4M0UA 5DM60 1QLJA 1SXQA 4L02A 4CMGA 8GPBA 2YXBA 3OI7A 1IBLB 4ZDWA 3C6BA 3Q7TA 2QZSA 3H6HA 4F3CA 2REOA 1BAPA 1EGMB 2KI5A 3E8XA 2DB3A 1E3JA 4X7MA 1U6JA 4KQHA 1YQEA 4NZZA 4TWAA 4QFDA 4CWAA 1FOEB 2O6HA 2ZSUA 3BRWD 1Z4PX 2IEBA 5J47A 5LP6A 1SVOA 1T4MA 2H92A 1MEOA 2OAP1 2VHXA 2ZDHA 2ZAOA 1BVRA 1E2LA 1OZAA 3N2YA 2IK8A 3BQMB 5AVQA 2A67A 2LIPA 2Y1LA 2Y9MB 3GROA 1P7PA 2FWBA 2I80A 5EWJB 1MB3A 3EWIA 4GL2A 3GWZA 1KKLA 1QIIA 1UXKA 2UUPA 2XUZA 3E7XA 4NPCA 2I7VA 1YULA 3PFIA 3TQRA 5ADUS 2BI7A 3U4DA 2CCKA 1ODIA 5L4LA 1PJ4A 2ZW9A 1NBMD 3PD7A 3I28A 3QA9A 4MKGA 5EI5A 1AQUA 3L8YA 4ALKA 1QE0A 2ZB3A 1YVRA 4X20B 1LDBA 1NQUA 5AW7A 1VHLA 4H3KB 3GEBA 3VVBA 5KUTA 3D4OA 1FTSA 1DIRA 1M6WA 4F12A 1FFYA 4BQEA 3JRWA 1G8KA 1FU7A 3GPLA 2R85A 1E99A 5J40A 4LVNA 1XQVA 1IY0A 5ALWA 2IS1A 3A4VA 1ABEA 3C3EA 5BN1A 5LU8A 4Z6KA 1KY4A 4CGYA 3R0VA 1CERA 3KOYA 4BMOB 2WVGA 1DUVG 1UBHS 3LSYA 4DCMA 1RBYA 3N59A 5JCZA 2HSZA 4HDKB 3VZQA 3FGZA 2BKLA 1B8VA 3RS3A 1PR0A 1W30A 2O3RA 5CT4A 4BQIA 1UKVY 5A4MS 4LRYA 2HHLA 2IOHA 1BCRB 1FFAA 3JATA 2J85A 4HYYA 4OA5A 1EDOA 4RTOA 1EM8B 1YT5A 1E18A 1GRRA 1YDHA 3I42A 1Y6RA 3WLNA 5DVZA 1SBHA 2ZM6B 3QTTA 3DAHA 2OO7A 9MHTA 1JVNA 4HVCA 2P6OA 4EO9A 3B6IA 2H08A 4HAZA 4L4XA 4LBWA 2E4WA 2FUG1 3TIVA 5IM4A 1KOGA 5FAKA 1PP4A 4JT8A 4YHHB 5K2MA 5BYKA 3T7TA 3BIWA 1E4EB 1FP4A 3M6AA 4YDSA 1WE2A 2V59A 3TD6A 4ARCA 2EVWX 3PKJA 4E4YA 1Q1ZA 2AX3A 1Z45A 2OQIA 2IV3A 1SG6A 3LT4A 3V6MA 5J43A 4QJIA 2VPPA 3NEAA 4JR1A 1WP9A 1TT5A 4HDSA 1RKBA 2AR0A 3ZV5A 4YJGB 3NUZA 3PGA1 1EUDB 3EVTA 1NMXA 2Q1WA 1JQDA 1X39A 3WNCA 1V5FA 4YLYA 2O5CA 1AZWA 1XAHA 1FJ2A 2W6PA 2OY0A 3BT7A 1ZGGA 2ADFA 3H4VA 1SVIA 3JZMA 4EYKA 3H75A 4F5EA 4TLEA 4X62B 3TXAA 3EB9A 2FQXA 1JDJA 4FE7A 4I4LA 1UDRA 4IMJB 5K03A 4CEJA 1GPJA 5CJPA 4O4HB 4RSGA 1LBTA 2IKSA 5ARCA 3CNHA 3WNDA 2TS1A 4MDYA 3GVXA 3A6KA 1L1FA 1WKBA 3V80A 2CJWA 4MDHA 1CFZA 2G4CA 4MI3A 1UPUA 3FW1A 1KYQA 1BQ4A 2R7NA 3QTBA 3C39A 2VQDA 2X2EA 1UADA 4QASA 1NVGA 1V1RA 3LYAA 2YASA 4MLPA 2WU3A 3SQMA 3H19A 4AM8A 4J75A 2JAWA 1JAIA 2CSUA 3H99A 4NZPA 1WY7A 4LXUA 3WK5A 3CPEA 4DWVA 3SM9A 3PKIA 5HPYB 1EZZA 3MWFA 2F8SA 1QYVA 4PN7A 1UMDA 3PKZA 5HVNA 2Y6UA 3NBKA 1V3QE 1EAYA 2VBGA 2CFOA 1PZGA 1Q1AA 2WJ4A 3AETB 3KJQA 4FEYA 1L1QA 1XVTA 3O73A 2YJZA 4UTXA 1LDEA 2KS6A 1A72A 2A0XA 4UBMA 2OO5A 1VLLA 3UATA 3GZTB 3HA5A 3T1OA 4B84A 4F3YA 5U9CA 3OQOA 4GDMA 2YYAA 3V1KA 3E0QA 1W0KD 4RL4A 5TQ0A 1L4KA 3PXUA 4X5OA 1IAVA 1W1WA 3RVDA 4IY1A 3HCRA 4B3FX 4WKBA 5IXYA 4GM0A 3I61A 3H2GA 1QS0A 4MLZA 3NFYA 1WDWB 3AGPA 1RKQA 3OZUA 4MMYB 4G4JA 4QODA 5FOWA 1DG1G 1Y7TA 3B60A 4ZD6A 5MF6A 3N0VA 2ZTSA 3AK4A 1H1LA 4XLZA 3HR4A 1OWOA 5E7QA 4COOA 5AVRA 1UL1X 4Y7CA 1UC4B 3F6BX 1K7SN 4TLLB 4LNUA 3TKYA 1EXVA 2BUAA 2FG6C 4CKBB 5EJ6A 5GZ1A 1IOZA 1CP2A 1AKYA 3DEZA 3K9QO 3LNTA 4BKQA 5KWEA 4AMYA 3Q8WA 1ZPDA 4WIAA 1GNVA 1VJRA 3UJHA 4BVJA 5CPBA 3S29A 3DFZA 1R9GA 1WOYA 3JR7A 2FFJA 4WTOA 1QWOA 2OV3A 4L07A 2AJBA 3Q2OA 4YROA 3O8LA 4TUYA 2FSVA 2W2TA 3RREA 4MHSA 4EHAA 2JHCA 1SU6A 2RHTA 5LMUB 1INLA 2NTEA 3O83A 3RVPA 2J3LA 5JBIA 5F7OA 1N78A 5AKLA 5A6SA 2G28A 2AC4A 5LNK1 3O93A 5KYXB 4B80A 4UOQA 4TKUA 2DKFA 5ADHA 1U80A 3GRCA 3ED1A 5KS2A 2D2IA 2HCJB 1PJSA 1YJQA 3JWJA 1I3KA 3JSAA 2CVFA 1YJXA 2QUBA 3PHIA 2WF9A 3MJHA 3DOCA 4CV1A 5DP2A 2OLEA 4U2BA 3B36A 2ZOSA 1PJBA 4JLDA 4JR2A 5I3ZA 2R8EA 3MWLA 4ERNA 3FGOA 3D4PA 2EKQA 2B8WA 2I3BA 2WU0A 5LA6A 4AYTA 3CF2A 5TT0A 5EJAA 1VB3A 3FA2A 1MLDA 3QU4A 2VOJA 1G3UA 3FTCA 3K0FA 2F3TA 2EFHB 4PLTA 2C54A 3NWEA 3RRXA 4PQYA 3GNQA 5BSKA 1N33B 5HM6A 3P9RA 2HJWA 5FNVB 2GZDA 4LCJA 3SEQA 1FZQA 3PUHA 1DAIA 1Y9JA 2I76A 4QHYA 1NUSA 4TN5A 1K8QA 3H0EA 4WLNA 2HSDA 4XUCA 3D6MA 3LYHA 3AHEA 3I9LA 4FUQA 4YLGA 4I9FA 1DOZA 1R18A 4UTPA 4W5NA 2JIOA 3VYWA 5KIAA 1W5SA 2PGIA 3AEQA 2FE4A 4NLLA 1KAHA 3HKEB 1T0PA 4YV2A 4MR8A 2MT9A 1L2TA 1K66A 2FE1A 5JMOA 2CMHA 4OG2A 4LF5B 2E82A 4FKBA 5J2UA 3GLGE 2FPOA 1IL0A 1DL5A 4RQBA 1UBMS 3TL3A 3IBYA 3U1TA 4AMVA 3VZBA 2Q9BA 4DCSA 3OQPA 1MJGA 1VI2A 2WA2A 1L7NA 2NWQA 3A37A 5GONF 3QXSA 3AF0A 2R00C 4X92A 3B70A 3JYOA 1QOPB 3LDHA 2GZ1A 4NESA 5EYPB 2R4QA 3MN1A 4K9MA 1ULSA 3HUFA 3B3QA 2XLBA 3G23A 1MV8A 1PFKA 4O4JF 3VYVA 4RTQA 5EJ8A 2VT7A 1DARA 2C4WA 3PXBA 3HN7A 5SY6A 1EDDA 1BVHA 1QO9A 1ZD9A 2EHDA 2HF9A 3VHXA 2RHLA 3F6YA 3KPJA 4ERXA 3IUQA 5LP1A 4FCVA 3NDPA 4XOUA 2PYIA 4M2LA 4X63A 4DLLA 2R6ZA 4F9EA 1AQJA 4LJRA 4EKGA 3ZZNA 3MZ0A 3RUIA 1EP9A 3LCJA 1WNTA 3ETGA 3JPWA 4R4JA 1WP4A 3FYTA 3HXPA 3UOWA 5C7IO 4HK4A 2R7MA 4HAXA 1R8JA 4B4UA 3TB4A 8AT1A 1ENYA 2QJFA 3KKEA 3TEJA 2C84A 5BN5A 5AJXA 1T1JA 1IY2A 2PVPA 1JIUA 4F45A 4OFZA 3OEHD 1F5NA 1ACLA 1UMBB 3TSAA 2QZPA 2CXNA 1C8BA 3TX2A 1YC2A 5DHSA 1K0UA 5JSUA 1YK1A 4RDCA 4RSMA 2J9FB 3U7IA 3VKVA 3YASA 4M1QA 1KBOA 3MIIA 5AUOB 3V1YA 2NTJA 2PV7A 3KVOA 1XNJA 2VYQA 2Z2KA 4L1KA 1UKAA 4GSLA 1T26A 3EOAI 2ZAGA 2XVMA 1N6KA 1ODFA 2FP3A 3K1AB 1M2EA 2V3WA 2CXQA 4I3FA 1UQTA 2H51A 1OI4A 5DNEA 4OEHA 2BPOA 2VTKA 3JQFC 3GT7A 3J7AC 1LDYA 2PIAA 1H93A 1DXHA 2HF2A 3DV2A 3SS8A 5A2QA 4XYLA 2Q5QA 1E1LA 2HTFA 4EJ0A 1QKJA 3C3AA 3FSJX 3ZD7A 2QTBA 2AYXA 3OZ7A 4JJEA 1KQOA 1DWQA 2Q62A 2JI8A 4HVTA 2PZBA 1FBNA 1GTG1 2BI4A 2GX6A 2B7LA 2YXNA 2AB0A 1NRIA 4YT4A 2ZT5A 2Z98A 2O1EA 2ZJ8A 2GEVA 1ULUA 1H22A 2QTWB 2VDWB 4IP0A 4JA0A 4LYFA 4XJTA 1LK5A 3MHPA 2J7KA 2PX8A 1D03A 4WCDA 3TTYA 2F62A 3ZU6A 1PN3A 1GTMA 2P9JA 5MGBA 4RZ3A 1TJPB 4G0WA 3ORFA 5LQSA 4C76A 4CCWA 3IRUA 3Q8XB 1ZIOA 2JHPA 3IMEA 4KKXB 4YXWA 3PX7A 1IFXA 3BMCB 3HVKA 4QRDA 4ZYWA 1N5MA 3CIOA 1U2QA 4AFNA 2H4JA 2PTHA 4JC8A 2R751 2V98A 1NQTA 4RPLA 4CN9A 3LHSA 1L4YA 4GR9A 1C2YA 3P45A 4OXQA 4FOPA 3CKKA 3L1KA 4FWBA 1Y6GA 3BF7A 1TF5A 4EPXA 3DAYA 4RH1A 3KT8A 1IWPB 2ZRGA 3O74A 1JYSA 1K5GA 3O4GA 3GJ5A 2B4RO 4MV5A 4C0JA 1OR8A 1UQRA 2PJDA 1RPNA 4JHXA 3U49A 3K53A 3UCFA 1BE0A 2VSXA 1UBRS 2QJTA 3U7QA 1TEXA 1YRLA 3DB1A 5FTKA 5DASA 3OHSX 3AU9A 4ZALA 2XEXA 6LDHA 1JQKA 3FKSA 5B4TA 1MDBA 1NVDA 4OYRA 4ZAGA 4KODA 4E5UA 1KERA 1OXMA 4D0LB 4HQKA 1ZOSA 3K30A 3ZJ4A 2Q6KA 4Z7NB 5TQ2A 3EDQA 3KVVA 1QQTA 1J33A 5CM2Z 3GFSA 4TT3D 4XJSA 1GSAA 1DUIA 5BNWA 2D1FA 3ENNA 3AUTA 3MWKA 5KYUB 4JB8A 4LDRA 4BNXA 1BS9A 3TFWA 1T2FA 3FLBA 4NX2A 4AJLA 4LFCB 1H5NA 3SHVA 5TC4A 5A0TA 4ZI7F 4LYDA 5BWMA 3AVVA 4WESB 2YINC 3FDFA 4L73A 4D9EA 3H7IA 1ZL0A 3K8QA 4ZCPA 3UKJA 3K70D 1JDTA 4C1NA 5EJ4A 2FPLA 3EBLA 3ER9A 4C7OA 1DJNA 1EVEA 4OA8A 4LI0A 1ESNA 2QAGC 3IC5A 5G4KB 5SZHB 1Z07A 1WQ3A 1Z37A 3AIIA 1T2VA 5B64A 1XZBA 4NCBA 2Z5LA 3PYLA 4NY1A 5FNVF 4UUMA 4YPFA 4EUHA 3FHTA 3U4CA 5IEBA 4TRRA 4DILA 1NQOA 3T7DA 1YNOA 2GXSA 2HL6A 4ZYVA 4IGKA 1SOWA 3LL7A 2YICA 1CUDA 1VJTA 3EMVA 5JTTA 2NQ8A 5IYZB 1BJRE 3TAXA 2OMKA 2X0JA 2VEDA 1BFUA 3MUEA 4P3YA 3K2IA 1ZGAA 4KG7A 4I1YA 3O91A 4M0PA 4N4AA 1JP7A 4M6WA 4JNCA 4DIEA 1SVNA 2E87A 5JAPA 1E79D 1PJAA 1VJ5A 1GQFA 3FCEA 4IILA 4YAJA 4ZCQA 2IV2X 3TLEA 5JMPA 1I5EA 4R1PA 4PGHA 3TL2A 3CUYA 1HG0A 1UJMA 5ALKA 2BVNA 4A26A 3SF8A 1N1EA 1ZBQA 4Y0NA 3UYKA 2EG9A 1JPJA 4JUCA 5G4KA 1TTHA 4E31A 1SELA 1FE8A 3BTOA 1K8YB 3EFOA 4NK5A 1CY8A 3SQNA 4P3KA 3LPDA 1JIJA 3H9JA 5C8YA 2VQ3A 5MN6A 4RKYA 4PFJA 5JARA 2WK1A 1OGYA 4QOHA 1I7QB 5IULC 4MV7A 3GIDA 1M0EA 3LX6A 3L8HA 2R7KA 2C5LA 2NYRA 3K4HA 1CDOA 4YMIA 2A1UA 4UULA 5DNWA 1AD2A 4F6RB 5BNFA 1JEYB 3ODPA 1RKXA 3A6ZA 1QPGA 4A2PA 3V7WA 3SBOA 3D59A 4GI3A 4QVKA 1CQWA 2PPVA 5B4VA 3LO5A 2HU2A 4WHMA 2Y1WA 3R6TA 4ENSA 4PC2A 2EX1A 1NBHA 4LVUA 3GMTA 4DDWA 3MJCA 2B78A 4PNHA 2IYQA 2C95A 1ULBA 1B74A 4ATNA 1ISSA 1NYLA 3HNPA 1JSZA 3QU7A 5E6RB 2F8MA 2QP9X 1F8XA 3IR6A 5GP1A 5J5VA 5LYJA 1USWA 3D1LA 5ED0A 5JVDA 4FR0A 3QZUA 1K06A 3JQDA 3KE8A 3LCVB 4HNHA 4TRJA 3UCXA 3DVSX 2NZVG 3SC2B 1P60A 1AK9A 2CL6X 3NFRA 3O9VA 2PBFA 1KJYA 3D3EA 1VLMA 4B4DA 2VR1A 2FMHA 2O7VA 3HVHA 5EKDA 3QE0A 4D3DA 1II8B 1TLFA 1DKOA 3OO1A 3KL2A 3AIMA 4BVBA 2YRXA 1QE3A 1DKNA 5KVAA 1PUIA 1V6AA 1G8MA 1TJYA 1ESMA 1X92A 1FU4A 1BX3A 3KHKA 3N3BC 4R1OA 1J1ZA 1DRVA 1NQAO 1TW2A 1YFKA 1UBLS 2IYXA 2MYTA 1M2OA 4LJYA 4QGFA 2X5KO 3GCXA 2F1JA 4MQ6A 5CXXA 1OX5A 2BMEA 1QMGA 2A0WA 4KO4S 2C9YA 2O14A 3LHKA 1ST2A 5ERGB 3MCAA 3H4IA 4HZUB 1OXKB 4TVBA 3O4RA 5KCMA 2QPOA 2IEDA 2C3PA 4Q4JB 5AM5A 2WYWA 1CR6A 3HY6A 4ITRC 1QP4A 2HIGA 4EA6A 5JRJA 2VT3A 2C82A 1H2YA 2NU7B 4I5GA 2EFJA 4BQPA 1B1AA 2LP4Y 3MBKA 4YAIA 4TSKA 4M1KA 3UJ7A 4TV9B 1RE0A 3V1LA 1PEAA 4URYR 1U2TA 1LEHA 3DR5A 2H1OA 3NYWA 3ZZUA 1FNMA 3N87A 4DWWA 1SCQA 4GI1A 1BGXT 1NNI1 3QVJA 2ZZMA 5AVVA 2HA6A 2IHZA 3FCXA 3INTA 1Q77A 1HLPA 1XU4A 3PFFA 3OSUA 1Z2PX 3WGTA 4AJPA 3ZDAA 1LWNA 1IZ9A 1P0PA 3IB3A 4LQ4A 3RAGA 2PKCA 5LXTF 3SS7X 2HD4A 1U0JA 4YBRA 1RRCA 1RHJA 2FPRA 2ZRDA 4PHFA 4JI3B 4R6WA 5JBNA 2QBYA 5G0UA 4BFYA 5KTYA 2HRRA 1QH1B 3HL0A 2BEUA 1L5GB 1OGIA 2DOKA 4P53A 1L5LA 4JWKA 3EXFA 1S2IA 1P4SA 2V58A 2X42A 3EBOA 3MHTA 1TRKA 4MEBA 1UT5A 4MW2A 1EWTA 3GPIA 3JAMA 2ZE5A 3KKPA 1YS2X 1WPRA 3OY7A 3TBHA 5C37A 3PLNA 1J39A 1PNQA 2BBWA 2NYAA 3AP3A 4GZ3A 3QXGA 2ID9A 1D1QA 4WX2B 2W5UA 1V16A 5CFZA 1Z6TA 2DQSA 1NDQA 3QEMB 3QE2A 1EFPA 4QUBA 4W5HA 5E6SA 1GUAA 1JAYA 3D3KA 3F4KA 3GEEA 1H9BA 1O96A 3B9BA 1T8YA 4QDKA 3UANA 1BWSA 4DA0A 5HM8A 3TYXA 3U5TA 1B16A 1WPGA 3OCWA 3OTHA 1YBFA 4JMLA 4DGQA 1E92A 4AW9A 1PEDA 2FWJA 4YMGA 3JZFA 5LYYA 2XXAA 3NRJA 5DWDA 3RSOA 4KBYA 1R3DA 5KB3A 5KU7A 4QGAA 1GPLA 4PZ0A 5ENZA 1Z0AA 4MVJA 2GO1A 4X1IB 1P1HA 1T8RA 5J23A 2K7ZA 3AEQB 4B3RB 3AR6A 3SY8A 5T3UA 1GCUA 3ILXA 4D5EA 2RGNC 1QRRA 1W52X 1IJBA 3PTLA 1GFWA 5JMTA 4ZRDA 3AY7A 1C4XA 5F9HA 1KK1A 1XZQA 5H70A 5JASA 1CX9B 1MABB 4PG6A 3RE1A 2WM8A 2ZR7A 1ZAYA 1TVEA 3UAVA 4S04A 1YVDA 3QEAZ 1KNXA 1FEZA 2V6MA 4URVR 3CZQA 2D8MA 1N2OA 4KV7A 4OIFA 2G71A 3ZDZB 1VZ3A 5IT0A 4R54A 4DM7A 4I9NA 3N8DA 2GT1A 5CLIA 5JECA 3CEAA 2XI4A 3WY9A 4NF2A 5AJYA 3KEQA 1FP6A 3FPAA 2I34A 3GVPA 1DC5A 1RE1A 1SUEA 2P4QA 5JZOA 5GONA 4RIFA 3FWHA 3TKAA 4EFMA 3MFYA 3E15A 2H6EA 1ZZEA 4HTFA 3QU5A 1IHOA 2DSTA 4Q37A 4TLCA 1QE5A 1JH8A 5EZYA 1VJ0A 2GUWA 3RD5A 5J2UF 5DLPA 4DLVA 1LC3A 2ZETA 1AS2A 4XW2A 2P79A 2R6CA 3E81A 4ABYA 1KSJA 5IWCA 4DRYA 2Y68A 2IZZA 4X90A 1X9IA 6GPBA 3RUHA 3RVJA 1D4OA 3PR2B 1T25A 1U28C 3WLPA 2YKGA 1PJCA 2OO3A 1RKVA 4FFVA 1XB2A 1KQPA 4ZHQF 5CB0A 3E5MA 3VNSA 2BEWA 2OBXA 4EVRA 1L3CA 2LE0A 3TB6A 3MGGA 4X3PA 3L7DA 1Z73A 5HCIA 4DUGD 4F9FA 2Z1MA 1J24A 1E2FA 1GIAA 1PL0A 3EXFB 5AJUA 4HJXA 5L6LB 1D1SA 2XQKA 2PR2A 3IP3A 2P9FA 1YDWA 4E0BA 5IKMA 4P0QB 4PBTA 2VWPA 1TVKA 4UKDA 3HNOA 3TZKA 4BGEA 4V1CI 4IRUB 4GSKA 5BNTA 4PZPA 4ZJPA 3K6JA 3RVMA 3E7FA 2NGRA 4AX4A 5K6AC 3UQYS 3MTIA 5AHXA 3R3WA 3BH6A 2OCYC 3T52A 1ZICA 2R8PA 1DEKA 1KSFX 3MD0A 3SYNA 1L4BA 3OCZA 3VR4H 1P75A 4XGQA 5IN5A 4D9NA 3AUKA 5JNRA 3WRYA 2MCFA 2Q4DA 2ZJ1A 3T1YB 4M55A 2AI1A 4IQGA 4BTLA 3EEQA 3H86A 3ADPA 2J09A 2BKUA 2ADMA 3ESBA 3A05A 1XTPA 1C9YA 5LZ8A 2P78A 1J25A 2VIIA 1I2MA 1M76A 2IE8A 4R3NA 3HK2A 2RG1A 4JJAA 1NJ5A 4C3VA 1DBRA 5AKEA 4ZAXA 1L9XA 1VJ1A 4WCFC 2WFZA 2DECA 4U2KA 3W5AA 3HV0A 1PDVA 3ZU4A 4CCSA 3HU3A 4TZ0A 5F2EA 1G9XA 3DMDA 2V3CC 1FFXB 4GSYA 1YIOA 4LJLA 4RTKA 3L4KA 4CIWA 4URXR 4H1WA 4V1CB 4I1OA 1R8QA 3U3DA 2O4UX 4LCBA 4A3SA 2RGYA 1KAOA 4FILA 3BORA 5EKTA 1G16A 4WK6A 2QE6A 4EO4A 3ZH2A 1DEOA 2R47A 4GI7A 4J91A 5KJEA 1ZR2A 4WKGA 3GLFE 4B8YA 3BHIA 4K9RA 1A1VA 1ECBA 5CT6A 4F5DA 4DDMA 3ZDDA 2ZI4A 2PR7A 5C52B 3UH1A 4BIMA 5FORA 1ZGCA 2JFUA 3ZIAA 1VE6A 1B6TA 4DCCA 3BYZA 5CA1B 1TQ6A 2QLTA 1C7EA 3MK31 4HPWA 5SZJA 1QH8B 2J48A 3GMDA 2GN8A 2QTNA 4M4SA 1EVJA 1D0VA 1P4JA 1GKLA 1B6GA 3DZBA 2HPAA 3TE6A 1JEJA 5DBEX 5ADWA 3SF0A 2OGTA 2KMLA 5EP1A 1XYGA 1OREA 2H2GA 4RLQA 4IDQA 5LXTB 5LMZA 4MICA 3VAYA 2ABWA 3ASZA 4C0SA 2VP4A 3G8BA 4HDSB 5B55A 5IKPA 4KZKA 1QIFA 2P2SA 5GVRA 2GYWA 3DT8A 2P6PA 4XSVA 4NJEA 4YUVA 1ZGBA 1IPFA 3ZX5A 4C5AA 5C8ZA 3BHJA 4B2IA 1XD9A 4BZZA 1E8MA 2FG7C 1V37A 1TIKA 1MQ8B 4DA6A 5FKJA 2BTOA 2I7XA 2IHUA 3MSCA 4DAEA 4MVJD 1E1CA 1U5BA 3TLCA 4EZIA 1X7ZB 1MKYA 3FPFA 4GNKA 4V0RA 5SV2A 3BXHA 2R60A 2WG1A 3FFBA 1Y37A 1CVRA 1TCBA 5JQGF 5JH7F 1G6OA 4DS3A 2HK8A 1B1CA 1DINA 1XTKA 5EIBC 4CYMA 1KEEA 3I2HA 3RB8A 4R83A 4DIFA 2AOWA 1XCOA 3GHYA 2BGMA 4UBKA 2IUFA 2UAGA 2WA1A 2GPYA 3BAZA 3NAMA 3Q0TA 4HXEB 1C4OA 4WACA 5CNIA 2RBGA 1SUPA 2ZE8A 4N40A 3GJRA 4H3SA 4MS1A 2ZRAA 1CT9A 4D9FA 5T4FA 3PCXA 1GADO 4WXYB 2H7CA 1DQPA 1K1EA 2AF4C 5FPQA 3C97A 5K0ZA 1UOOA 4F4HA 3MTAA 1FRZA 2LXNA 3PS9A 1WXDA 2PTGA 1GCIA 4RHEA 4DR5B 1CU1A 2V7WA 3W6UA 5DM70 3QG5A 4KDFA 2VN8A 3NYQA 1BMFD 1TFRA 1PJTA 1ACMA 1ZN7A 1ZUHA 2Z9DA 1W29A 1YB1A 2C03A 1U3DA 4NULA 4YQZA 5DFAA 3I45A 4ZT3A 3U60B 2Y99A 3RHFA 2RAFA 2GB4A 4NR0A 1PGOA 5C2JB 1T6BY 2E21A 3OZFA 4LBYA 4ZOBA 5F2OA 1CQJB 3DM9B 2O0HA 3UAZA 1K98A 3SC6A 1HL7A 1OLXA 4MIEA 3L0CA 3VUFA 4NBLA 3TLKA 1L4MA 1DC7A 4LY0A 1VHJA 1P17A 3DMNA 1RLJA 1KI3A 2IDZA 3IAHA 2PMFA 1T4CB 2WFLA 5G1OA 2QRGA 4IFEA 3N39C 4XQGA 1ZCZA 2C0PA 4A5OA 4KO8A 1SKAA 2FUNB 1I13A 4EMTA 7MDHA 2FDXA 2HCBA 3E82A 1KHTA 2YXLA 5COBA 3IRVA 4B4VA 3VGJA 1AGXA 4B48A 4PNZA 4F4DA 3K9BA 2D00A 3S4YA 1Q0HA 2OYCA 3DWIA 4IF6A 2NW6A 2G6TA 4YECA 4W99A 2YV2A 4D9JA 3GR6A 5DP1A 3ROTA 3UM9A 4DQXA 4QFCA 5LQRA 1HT1E 4C0HA 3ONVA 4JLKA 3WJ7A 2PZJA 2XXBA 5ALIA 3VVLA 1C7IA 1XZAA 3BUSA 1D6SA 3ZZMA 1USKA 4A1FA 1SEVA 2FV8A 1KRHA 3UK2A 2WTXA 2A78A 2XVXA 4ZEOA 3OCXA 5LQCA 4K0KB 1SQFA 1XWFA 3CSSA 4IINA 4URFA 3IPRA 3IUBA 4AG3A 1AKMA 4WN9A 1ZMBA 5JANA 4PG5A 4FFWA 1ZHOA 3CZ4A 4K6HA 2NU6B 3DXXA 2QWXA 2XCLA 2OE2A 3IILA 4FC7A 4J94A 3UY4A 1CE8B 4J2TA 4DZTA 2AHOA 4O2BF 2C0CA 3EIWA 3WK6A 4GG1A 2HQSA 5L3SB 1Z7BA 3GDOA 1R5JA 4GRIA 4IDPA 3SOPA 3SX2A 5K3OA 2LGJA 3HB5X 5CYOA 5DISB 3AR4A 1Q92A 3E23A 4EJSA 3SEFA 3IYLW 1GZ5A 3ZCTA 3TZHA 3KQMA 4OU4A 1X7WA 3OP4A 1V9SA 3OT4A 3KYDA 3VSAA 3CE6A 2DC1A 1J0AA 1RMYA 4W1QA 5FA6A 2UXCB 1NUUA 4YPOA 3GLQA 2C92A 3U40A 3CONA 5DLQC 1U8EA 3G0IA 3HCAA 2XDQA 5GINE 1JI3A 3PXXA 3RV4A 2VPIA 3QYAA 3CG4A 1C1YA 2Z8YA 3BMNB 3WB9A 1JILA 1STOA 3FOAA 3R1IA 4JEUA 4O0LA 2PSHA 4Z7JA 4IDHA 1BVYF 5FTWA 5LP6F 4LE0A 5CVDA 2OHHA 5TQJA 1RRMA 1FMCA 4NYJQ 3JWPA 3P9QA 4X8LA 4DMLA 2BZ1A 3WB2A 2JRCA 3KQQA 3H3XA 2V54A 3GK3A 4EYEA 1YSCA 2GASA 2Q9CA 3DUFB 1UDAA 3P19A 5B6JA 3KKMA 3W04A 4LXGA 1GLVA 1LS6A 4XWOA 2CXPA 3R7AA 5JW6A 2YHIB 4MI6A 1R0YA 4GBED 1K4KA 3WVNA 4BRWA 1RU3A 4U02A 4X3OA 3DEJA 2WSSA 3HUUA 1W0CA 3SU8A 3H17A 5K6TA 2J1LA 3IQFA 1NOIA 2DX7A 3G6KA 1N2CE 2QZ4A 4H35A 2AXQA 5HZGA 3ICEA 2HK6A 1K86A 3FTDA 3Q2KA 2ET6A 1FFSA 1JEDA 1LRKA 1N8SA 2MJLA 1DV2A 1XTSA 1SBZA 2YW2A 3AQIA 2H7XA 3AVPA 3N8GA 3MJRA 4X3CA 2FDRA 1VHTA 3S2YA 2V7QD 4G6ZA 2AVDA 2WUEA 4QZVA 4X60A 3HADA 1Z2DA 3WQBA 4LF6B 1WEHA 4YN3A 5DN6D 2NQ2C 3TLGB 1ZJZA 2B5VA 1YS6A 2XADA 4YRKA 1SUSA 1LI4A 4WOPA 2GM4A 5JC1A 4J1SA 1IJEA 1NOKA 2GN9A 2VZ9A 4ZVQA 3H8SA 2E1RA 3JARB 5EZYB 4PPQA 2GTHA 2VJYA 3K92A 3PITA 5CA1A 3DDOA 4RFVA 1K92A 1OXXK 3OKFA 4I2NA 4AF8A 2B0JA 5KYGA 1DCKA 1TKCA 2Q6VA 4QJ3A 2F55A 3BFVA 1EUQA 2DEUA 2JLAA 5CLGA 4BS9A 2C4NA 5E95A 4BX2A 2NZ2A 2RGXA 5I4BA 4GX1A 4CETA 1IUOA 1J20A 1O77A 1P91A 3D0QA 4JKYA 5ESWA 1M2VB 5F3WB 5JUWA 1L7OA 1U3UA 1X8KA 1XA0A 1Z29A 3I01M 2WB4A 4H4DA 4NQRA 4ZOEA 5K0CA 3DOEA 4M1EA 1JEEA 3V2UA 2Y1EA 4QHSA 4Z7QB 4QPNA 2JARA 1CUZA 3MUFA 3SHFA 3PIIA 4RVCA 4V3CA 1Q44A 2CLOB 2VNAA 3C3CA 1I8TA 1RC1A 4YB8A 3ZVRA 3A70A 2HRDA 2XGGA 2PO5A 2XUHA 3IERA 3NDRA 4KGZA 4LHEA 1L7RA 3IB6A 1B0AA 3JXEA 3NHZA 3OHMA 3OZBA 3PIRA 1SXHA 4LBVA 1QPBA 3A9RA 4BVGA 3A9SA 1QXSA 2G40A 4YREA 3ROEA 3L6OO 1HI9A 1FYDA 1QAOA 1E89A 3CQ9A 4NU6A 5L3QB 2V7GA 1RJ9A 3U6BA 1E3EA 2HFKA 4MB6A 4FNOA 5LC1A 5IDQA 1RJEA 2GAJA 1U2GA 3PBKA 4UMDA 2OKCA 2Q45A 3JQAB 1DO8A 3GD7A 4KQGA 1PBNA 5JS2A 2WZBA 4KPGA 3HU5A 5IP5A 5ICFA 3OWOA 4Q3NA 1QF9A 4EPWA 1UFRA 2GCNA 3THYA 4NONA 1F8YA 3V42A 5I45A 2MDTA 3ZY3A 2FSUA 2GYVA 4JLNA 2XGOA 2QD5A 3H2KA 1H0KA 5IZCA 1FFWA 2Q5JA 2F67A 4IZHA 4CMIB 3MMPA 3OE7D 2HK7A 2JCGA 3MINA 5DYIA 5JS8A 5ILGA 3GT0A 1XDZA 1HE2A 3FPJA 3IUJA 3VM6A 3A2KA 2DT8A 4F85A 1CULC 1GPAA 4MV4A 4BMXA 5C5EA 4C2UA 2AK3A 2A3RA 2CLMB 1T9KA 3CLHA 3D3QA 2QBYB 1RZ3A 3NKFA 1NQ5A 1ZEMA 4RD1A 3G2IA 4JLJA 1SU7A 1ZJJA 2X3YA 4XRRA 4DEYA 1C1DA 2GF9A 5H68A 2NVUB 4C05A 1W9HA 4RHUA 1ZGZA 2IF0A 2IS4A 1N1GA 1AXRA 2A4MA 2CBXA 3UJAA 1NVKA 1CDEA 3KEOA 4KVFA 3WTCA 1IRXA 4FGJA 4R2KA 4RA9A 5A6SB 2I8CA 2OZEA 5KX5A 2G72A 5B7QA 2EP8A 4KHPB 1NW8A 2MR5A 1NJGA 4JMPA 1XTTA 2I6GA 1CUIA 3SYKA 2FSGA 2O3QA 4BEBA 1FYEA 4EH1A 3DE4X 5KSWB 2R8RA 2WWYA 1Y9ZA 4RA6B 2ZUVA 4UC0A 4S24A 1PYGA 4QOJA 4HWRA 3L0IB