2ZWOA

Crystal structure of ca2 site mutant of pro-s324a
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDAAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 129
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwoA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwoA02
3I2YX 2Z57B 3GT4A 1AF4A 1SIBE 5JXJA 5B1DA 2Z30B 4CFYA 1PJ8A 4NMXA 1CSEE 1HT3A 3GCWA 3EIFA 3LXUX 1TM5E 2B6NA 4ZARA 3DVSX 1BFUA 1TM4E 1SUCA 1BE6A 3DE1X 4MZDA 4K8RB 4ZOQI 1SIUA 3BPSA 1T1GA 2G4VA 1TMGE 4LVNA 3F7MA 1WSDA 2ST1A 1V5IB 5JXIA 4Z2AA 1Y1KE 3VV3A 3HJRA 1IC6A 2W2PP 1SN7A 1SH7A 2XTJP 2DQKA 1GNVA 2GKOA 1SUDA 1THMA 2Z2YA 1YJBA 1R64A 1SVNA 3VTAA 1P7WA 2W2NA 3D43A 5JMOA 3DE4X 1TO2E 3F7OA 1A2QA 3WIVA 3VV2A 1Y33E 3VHQA 1EA7A 3CO0S 3DE6X 3TI7A 4H6XA 4H6VA 1AVTA 3DVQX 1OT5A 4YN3A 3SQOA 1MPTA 2SBTA 1BE8A 1SUBA 2Z57A 4OV6B 1SCBA 3F49S 2WV7A 5AVKA 3A3OB 3DW1X 1TO1E 4LVOA 1PTKA 3I30X 1NDUA 1TM3E 1BFKA 1GA1A 4WOCA 1P7VA 3AFGA 2QTWA 3ZXYA 1WMDA 4RYDA 5K7SA 3EE6A 1DUIA 1ZVKA 1GTJ1 3VSBA 1SUPA 4NMXB 1KDZA 2WWTA 3CNQS 3Q5GA 1ST3A 5AQEA 2P4EA 4K8RA 1AQNA 1PEKE 3GT3A 1SCNE 2PRKA 1AU9A 3OSZA 4AKSA 1GNSA 5FFNA 4CFZA 2XTJA 1WMFA 3LPAA 2Z58A 1VSBA 1CNMA 2SNIE 3T41A 4OV6A 2X8JA 1KDVA 3L1KA 3LPDA 2ZWPA 3I34X 3H42A 2E1PA 1Y9ZA 4OMCA 1SBCA 3AJ8A 2PYZA 4J94A 2SICE 1LW6E 5ARDA 1ITPA 3DVRX 1UBNA 2V8BA 1TM7E 1GA4A 1OYVA 1C9JA 1SUEA 3AJ9A 1T1IA 1ZVJA 4I0WB 1SCJB 5JXHA 4JP8A 2ID4A 1C9MA 1AK9A 1KE1A 2WUWE 1R0RE 1TM1E 1R6VA 3DE3X 2PWBA 5JXGA 2W2PA 3TI9A 2QTWB 3DE7X 3GCXP 1Y3FE 1YJCA 3BGOP 1P8JA 3QMPA 1IAVA 2W2MA 5ARCA 3DE2X 2ZWOA 1AV7A 1YJAA 2IY9A 1XF1A 1PFGA 1SCAA 3TECE 3BPSP 4KPGA 4BWGA 1Y48E 3QTLA 1WMEA 5SICE 1Y34E 1TECE 4NE7A 2Z2XA 1GTL1 3SICE 3VYVA 1C3LA 1NDQA 3GCWP 1SPBP 1GT91 1Y3DE 3LPCA 5FBZA 3A3NA 1SUAA 3DW3X 3CO0P 2W2OA 1Y4DE 4H6WA 2W2NP 2DP4E 1V6CA 1NLUA 1SCDA 1Y3BE 2Z58B 3DWEX 1SBNE 2PMWB 4DJ5X 2W2MP 2X8JB 1SCJA 4C3UA 1TK2A 4OMDA 3WHIA 4M1ZA 1KE2A 3H42B 1ST2A 2Z56A 1DBIA 5ARBA 5CW1A 1SBTA 3WQBA 1S02A 3PTLA 1KDYA 2PQ2A 3WIUA 1GA6A 4DWWA 4KB5A 1WVMA 2SECE 2IXTA 1Y4AE 1V5IA 4CG0A 3A3PB 3UNXA 1S01A 5AVJA 4FONA 1BJRE 2Z30A 1SELA 1SBHA 1SPBS 1JEAA 2Z2YB 4DZTA 2DUJA 3P5BP 3BGOS 3D9QX 2W2OP 3Q40A 2PKCA 3DDZX 2W2QA 1Q5PA 2ID8A 3PRKE 3SQOP 2HPZA 2WUVA 2ZRQA 3QFHA 1T1EA 2HD4A 3VV2B 1MEEA 3EDYA 2XRMA 2PWAA 4HX2A 4YN3B 3ZXXA 4WOBA 3DE5X 3CNQP 1C9NA 2TECE 4NE9A 3A3OA 5AMXA 1SIOA 1OYOA 1Y3CE 4GI3A 1EGQA 1GTG1 2Z56B 1S2NA 4NE9C 1YU6A 3GCXA 3A3NB 4AKTA 2Z2ZA 4C3VA 5B1EA 3BX1A 3DE0X 3I37X 5FAXA 1BH6A 2W2QP 4HVLA 1SBIA 1GCIA 3P5BA 4B5LA 4KG7A 3DYBA 1AH2A 5I9SA 2PMWA 3A3PA
chains in the Genus database with same CATH superfamily
3A2NA 4FW8A 3RIYA 1ZGJA 1RP5A 4GKKF 1Y10A 1SEVA 4RBTA 1NXOA 2HFNA 2V74B 2PXHA 1SKYE 4DLLA 2PVSA 5CH8A 1V11A 4GR5A 1XRLA 1R0AB 4E3WA 4UOQA 2NW6A 3O9VA 2I55A 1A9XA 3ESAA 2WJAA 5DNVA 3CD5A 1EMDA 3ZO7A 1H1DA 4I1OA 4HTFA 3OT9A 4C4XA 5TS3A 3P2MA 4RY0A 2XMMA 1CDDA 4B6SA 3KPYA 3R23A 4PTYA 2BTQB 5ICFA 1WJGA 4L5BA 2NREA 3POTA 3N5KA 4I68A 2E5WA 2Y1WA 3VYUB 3OL6A 4UE6A 4CTKA 3GV5B 4U2EA 2BP7B 4NLYA 3BKFA 3HB4X 3PDUA 1EEHA 4AZWA 4XW2A 5JZVA 1J06A 1R8HA 5CT6A 4RPIA 2OXIA 3KAQA 4A03A 2Q9BA 3MT0A 2WJGA 1QPZA 3DJYA 3CJRA 3H98A 1JDVA 4YQEA 2A9PA 4D5EA 3FCEA 4AQYF 3C8DA 4HVTA 2GQCA 4LJRA 4QPJC 2OCXA 1SZJG 5J2TF 3ADDA 3MPYA 5AK4A 2G04A 2I5JA 3THYA 4FLFA 2OENG 3EC2A 1QGZA 3KE9A 3SMQA 2A9JA 2ZBRA 3R7FA 1YV9A 3E9EA 1Z7BA 2BUAA 4JI7F 3WNZA 1HW8A 4RUBA 3C6YA 1GMUA 3OSZA 2IXEA 3KJNA 1J6UA 2MZQA 2I67A 4B0PA 1FRHA 1YI8A 4IV5A 3K2EA 5IBCA 2C54A 4C0BA 3KVYA 3ZOZA 2CXRA 1CNMA 2WWWA 4PTZA 1FMFA 3BWBA 1UJNA 5BR4A 1FE4A 2XWBF 4O4JF 1DHTA 2MDTA 2ZSHA 3SJ7A 2HHQA 4JSTA 3ROPA 4F3CA 3BE4A 5IULC 5BSKA 4P6QA 2QORA 2ZBQA 1TTHB 2OMKA 1W2WB 4YMLA 2IS1A 4JJ7A 1VIVA 3ABOB 2PGIA 4FDVA 2IIHA 2BOVA 5CCEA 1AC5A 3WLSA 5JBQA 3TQFA 5GAHU 1DPFA 1AUPA 2HU7A 4USVA 3VR3A 1I0LA 5M3BA 2YYAA 4IQ8A 4UUXA 2VXOA 2G77B 4XVHA 4M1YA 1EI9A 3M30B 4UPEA 3VAKA 5KINB 2J0EA 3QW4B 1NUUA 5AKJA 1I2BA 5EKUA 4QWDA 4CKWA 1PWEA 4JV5F 4OYIA 3ELHA 3RC7A 4E1AA 2PSSA 4MVWA 4RSMA 2C9BA 3Q8PB 4MGZR 4Y2XA 1TK9A 1UP7A 2L18A 3PK0A 4ID9A 3K5HA 2A35A 4MGEA 2ZKIA 3LQYA 2XI4A 1ABFA 1S2GA 5KFNA 2AFVA 3ILVA 5EY5B 1UUFA 1QFJA 4Z5XA 5IC4B 3PI6A 1UK7A 1S59A 1AOXA 2IPLA 1SBTA 4IP0A 4G4GA 5EEGA 3X1XA 1BKYA 3L7KA 3NAMA 1TCAA 4ZZ2A 1X2BA 2YYZA 2XRFA 3ZLVA 2ZUDA 4Y2KA 2OQ2A 3M2TA 3S2ZA 3TAUA 4A6XA 4CIOA 4KKVA 2DKOA 2VNJA 2Y0EA 1YCDA 3JQCA 3E7XA 1IVYA 1CC1S 1HBJA 1OPZA 4UF4A 2CQ1A 2VHUA 4CM2A 4F4XA 4PYIA 1Y5LB 3N2GB 3ZXWA 4MCHA 1GXTA 4YAIA 4IG0A 3WBJA 3KUHA 2TSYB 1K4MA 1YDHA 3U1TA 1Y6GA 5I4CA 2DY0A 1UBLS 3QE3A 3E8XA 4R40A 2PLAA 5IHPA 4OHFA 4YWHA 2B6HA 4BNLA 2OE2A 5ILQA 1HX7A 3N2ZB 3TI0A 1LW0B 3GPAA 1VRVA 2Q1UA 5KTTA 3NZEA 1QKKA 1A6LA 4Q45A 2CQGA 3IBFB 4FS3A 3EGWA 1E2NA 4K8OA 3NHBA 1XZPA 5F5XA 4UW2A 1N33J 1D09A 3KU1A 2HGNA 1MD9A 4C20A 4IDAA 3EQ8A 2BM9A 3A58B 3DYBA 2FZGB 4KQZA 2R7KA 2YY3A 4I2QB 2RHBA 4PAWA 1K8ZB 3UPTA 3LW8A 3I04A 5JC8A 2F7VA 4K26A 3QVLA 4UU7A 1V0JA 4JL5A 4QRDA 4BCBA 2R8ZA 4ZOQI 2OPRA 1W0JA 4L57A 3THXB 5GJWC 3H2LA 3ZJVA 2B0CA 3KL2A 2FG6C 1G2PA 2ECFA 3WXBA 4LY3A 4H7JA 2YHSA 1GDDA 3VALA 5A3RA 5IPFA 4DLXA 2FY8A 5L9NA 4MWOA 4BNXA 3TFWA 2J3IA 2FHSA 4H18A 3RC1A 1HDIA 3LA6A 4LG1A 2QL7A 4QYSA 1NU6A 5KPJA 2V50A 3WKCA 5C3MA 3RYIA 1QGUB 3U7EB 3UK1A 5FUQA 2QYHA 3F56A 3F6RA 4UHDA 4X8OA 4GDMA 2Q7XA 3LL7A 2GF9A 5FOTA 1KY2A 4U3JB 4Q4HB 4AJLA 3W63A 1NSQA 3DXBA 1ZFNA 5IX8A 4F2PA 4OQDA 4BMSA 3PLRA 2EFDB 2KT2A 3RR7A 4LOHA 3CINA 1MLAA 3GSDA 1I1OA 5LKAA 4AD6A 1DZ3A 5I7SA 1E4OA 3R3VA 1VL5A 3IAFA 1E9AA 1QIIA 4BZWA 1U8AA 3W1YC 2E7XA 1J24A 4A8MP 3TNYA 2L17A 4IF6A 3FBTA 3K0AB 1N2HA 3DKKA 4YXFA 1FYEA 4B3HA 4LE0A 3I4HX 4JZKA 1XAGA 5DSTA 3MFHA 4UM7A 5IZ4A 1BHNA 4L51A 1RWVB 2VPWA 2OSBA 4N56A 1UMDA 4XSGA 3K70D 3TNLA 5K2MA 1U2GA 3PQ7A 1KDVA 1TUBA 3G9ZA 4QWCA 4NEQA 4NV0A 2C2KA 4ZT4A 4GPIB 3AHIA 3UO0A 4GP7A 3PQ4A 4B87A 2ROEA 4WAUA 3D54A 7GPBA 1FD2A 1XQIA 2AG1A 2Y0DA 4DUPA 2YJ5A 4XX0B 2UUAB 4M0PA 1I3OB 3WG9A 5A5FA 1T25A 2E29A 2HZCA 1AK9A 1GLVA 2I54A 1Z17A 2XOEA 3KWLA 1Y7IA 5LMUF 3BCSA 4DR3B 4WKNA 4IDKA 4DSKA 1Y9OA 4V19X 2WWIA 5L6MB 3E01B 2CXQA 2XZLA 3E2EA 3IVAA 3O7MA 3DVAA 2P1ZA 4MGHA 4OF4A 2HREA 1FQKA 2Q4DA 4CMKA 4MA5A 3DM2A 3MIZA 4BO5A 1WMEA 1J5PA 1LW0A 2G28A 2GYVA 4ZFNA 4XUEA 1XZGA 3SICE 2J9RA 4PTLA 1H93A 3GPIA 2JI8A 2IY5B 3UT5A 4QRHA 1RYRA 3E9MA 3HXKA 3ORYA 1QVAA 3OOJA 4LNUA 1SCDA 3OQIB 4XQGA 1Z82A 2ORYA 4TMZA 2HCTA 4YUXA 2GFFA 1X0VA 3GR0A 2M8HA 3ZDYB 2OD7A 4MIWA 2X8JB 1ZIPA 3DOMA 3BSAA 2VDPB 4X61A 2V8VA 1GZ4A 3JTPA 4EYKA 5HQ3B 2DRDA 1B7FA 4GOMD 3B5IA 4XWAA 3GBSA 2WPDA 5FBQB 3KKMA 3GJTA 3X2SA 4NENA 2R4QA 3PHIA 1CULA 1U1DA 2QGZA 3DOIA 3PX3A 4LCBA 5ITZA 1NKBA 1DMSA 2P2ZA 1T9TA 1PJAA 1MQSA 2FE1A 1G4AE 2WTBA 4LF5B 1LI4A 1NW3A 2AEEA 4Y2HA 5B1HA 5J2NB 2AC7A 3ZEIA 1VIAA 5KQPA 4HO1X 1Z5WA 1C0LA 3CVJA 3UK6A 4Y6PA 1K5GA 2XODA 1VSUA 1JVSA 3A31A 4CM6A 4O3OA 4EHLA 4PZZA 2HWXA 1I9GA 2HWIA 3OAAD 3O9ZA 4CF5A 4EKEA 4CO3A 4ZVRB 2O57A 2HYDA 4M5JA 3AIOA 1FFBA 3CCES 2H08A 1UL1X 3E9DA 4IRMA 2D2IA 1RCTE 1JHVA 3KOOA 5JO9A 2EP7A 4P7FA 4BATA 4MIYA 1LDEA 5CVTA 3JRNA 3PEEA 4MAMA 3OE5A 1KP9A 5JCJA 3CCCA 1UPUA 3P5BA 2CFOA 4DMLA 5JY1A 3AEYA 2ZIVB 3SSAA 1U1OA 1XAHA 1P1HA 2BUNA 3GT4A 2VQDA 4LJMA 4OZNA 4OZJA 2ZBDA 4P31A 3ZQ6A 1SC6A 5C46F 1BFUA 1V2GA 2CPZA 3J7YU 3TPFA 4XDCA 2A33A 2RBGA 5ICGA 4JELA 1RLOA 2QI9F 4TKUA 2IPNA 1QZ3A 1RD4A 2QKYA 3QMQA 3PC3A 2QTVB 4DCNA 2XMPA 3ESXA 1N5LA 5DGHA 2QSJA 3PJEA 4AJKA 2TS1A 4H4OB 3OFHA 1OH8A 5FDLB 1QLWA 3VTAA 4R84A 3G1WA 4D46A 2DGVA 4HDMA 4DX7A 1NMXA 4NHOA 1NQTA 3EZ6A 1P5ZB 3PE4A 4JI3F 1WIWA 4UNNA 2W4MA 3VU3A 4X65B 4TU8A 5HQTA 3PS9A 3NEKA 1OC4A 4CM7A 2CF6A 5U4XA 2X0NA 5TE9A 2NO9A 2ZUBA 1ZNYA 3JR3A 4LRXA 1P9RA 3H3XA 2VG7A 2GBIA 1GA1A 4ELVA 4MNTA 4TZ0A 1EQ0A 2EKZA 1E6UA 1JFLA 3VR4A 2XADA 1O7JA 1PZHA 3VDNB 2KHZA 2QG4A 4ZWNA 1SC3B 5LYJB 4JFRA 1I3OA 2R3VA 4JROA 4J1TC 2ZIWB 3K3PA 3IRUA 3NC0C 3DN9A 4HDKA 3TOZA 5A4JA 3BE6A 3PM9A 1AZTA 4ME6A 4LYHA 1ENYA 1WBBA 2PD1A 5FDFA 1AHPA 2LDYA 2ZD1A 2P5SA 5EZYA 4TQUS 3DR5A 2A1TR 4RCVA 3EUAA 2EIHA 2AVNA 4DHWA 3HU3A 3AEQA 4KHRA 3KOWA 3KQHA 2BTQA 3G13A 2REQB 4DQSA 1LZKA 1NW6A 1H0RA 3ZI7A 2ZPTX 1DDGA 1TAUA 4FFLA 1BROA 2HIYA 3PVSA 1Z62A 3SIPB 3DYAA 1KRWA 2GM5A 4YRLA 1N9KA 2KYRA 2X3GA 1Y0HA 4C6TA 1WF3A 4BX3A 4H7HA 1AGRA 1LLDA 1WM1A 2GLUA 1LTHR 2LKZA 3ZW9A 2X1HA 3LNTA 4BV2A 2GCOA 3FMPB 5IAGA 1HR0B 1CP3A 2QN2A 5L4SA 2R2TA 2X8WA 4ESEA 3GLGE 5F2EA 5HK4A 4C0SA 1NSFA 5TEVA 1U8UA 3AR8A 2JCVA 1QJCA 5JASA 3O3OB 3SQDA 2Y3IA 1HL6A 2H54B 3T3OA 2GXSA 2YWXA 1IEQA 1OQ6A 4B45A 4LQ9A 3NC1C 3MOSA 1SCAA 4MO2A 4NARA 2QTLA 3PW7A 5ED0A 1DKRA 4PABA 2O7RA 4W82A 1RJDA 3VNRA 3G2JA 3KJIA 2R7OA 5I3PA 5E3QA 4FB5A 1WHTA 1RTZA 3PDIB 4X3CA 1SUAA 2X1LA 3A04A 3NNHA 2C61A 2H3HA 2VC1A 4FDFA 2IYAA 1XCGB 4QG7A 2AZXA 2R86A 4PSDA 3OTQA 4OATA 2YQZA 4YRNA 1E7SA 4PNZA 1O8CA 3EDOA 4OLJA 3JB9k 1JTEA 4X62B 2BM1A 2IWRA 2OC9A 4U4AA 4UHEA 1BD6A 1LV7A 6AT1A 3NBPB 3ROXA 2HAFA 4FNMA 1PZFA 3D4LA 1YRHA 2QD1A 1TTHA 5HIMA 1FQJA 2NLOA 1N4LA 2JIMA 3C3BA 1YDMA 1TKAA 4MV5A 1M6HA 4UOGA 1ISRA 1ACMA 4C8MA 2E37A 3AV0B 2IE8A 4OXRA 4NCXA 1CY6A 4AJ9A 2G07A 4OI3A 2QN3A 3JPWA 4CG3A 3FKJA 3E3OA 3H4DA 2JGAA 5CM9C 1HA3A 2G09A 4TL9A 2NZ8A 5KNDA 3R3UA 4WUVA 4M1EA 1WVIA 1R8PA 4TXJA 3AODA 1DAHA 2FTRA 4WNYA 1UVLA 4Q9KA 3NNAA 5J4YA 2JI7A 4KWCA 1XZIA 4BQOA 3GHHA 4NE9A 1G7CA 3P9RA 3CH7A 3ET4A 5LZ2A 2PCLA 4NJEB 4LTNA 3T5MA 2D1FA 2YXNA 1K6XA 2X0DA 2DLDA 4OJQA 1SUQB 4EQ6A 4KBIA 2PX4A 2WIJA 3B7WA 4XH9B 1NPKA 2LV8A 3L3BA 3B13B 3DLCA 3AQPA 1YB1A 3K1YA 3ANTA 4JEIA 1ENPA 1BOOA 4F9EA 4C4TA 1FQOA 1GZ5A 5C53B 4DQXA 3E8MA 2JFPA 4ID8A 4EECA 2K7JA 1CZLA 4M0MA 4DRXB 2PO5A 2QY9A 4PG7A 3CF4G 5D3MA 4NCHA 4Y6GB 3PXGa 4M49A 1C0EA 2BGMA 3KDSE 2WPNA 5C8YB 1U8EA 4Y34A 3BYRA 5JVDF 1S77D 3K5WA 2B78A 3OP4A 3VI4B 2QV0A 3SNHA 1DEHA 3INYA 5K20A 4ILRA 3EYWA 3PCXA 4LSMA 2Q3PA 2Q3MA 2HLPA 3K17A 2J4DA 3KBBA 4ES6A 3P2OA 3H1FA 2X9VA 3EDQB 1VZ3A 4NLTA 2B5OA 3T3NA 1Z1ZA 1VGQA 5KVSA 1JLKA 1LJ8A 5KUTA 1XVIA 1MSWD 3GLUA 1IJFA 1IULA 3NL0A 3C5HA 5A62A 3BBLA 4KYIB 2AFHB 1A4IA 2A0FA 1NVGA 4ZK2A 4FNIA 1TFWA 3I0NA 4KAJA 5DWVA 1PRYA 1CUCA 1EM6A 1L5OA 2C7GA 2J3EA 5A7GA 3ASUA 1AKNA 3Q7IA 1KDTA 4EITA 4P73A 2B9YA 2X0JA 4C7OA 4CUZA 1CUAA 1NRXA 5BW4A 5HKAA 4UMVA 1YI2S 4FGJA 3JSMA 5TGZA 2FMHA 3G8AA 1P73A 5HCIA 3FSGD 2JJQA 1TL7A 4WOKA 2AKYA 4LBVA 1B2LA 3SVZA 4CLFA 4DL2A 4XAKA 5K5EA 3CVKA 4B6PA 3HCRA 4ZA2A 1E3WB 3IP8A 2ZUFA 3BL6A 2R6JA 5LMCA 3CXCR 1QR2A 2BFCB 5BYQA 3QIVA 1VS3A 5BSTA 2BC9A 4RNCA 2QA4S 1FDNA 2BE7A 1NVVR 3V2GA 4KE8A 3Q8QB 3S44A 2WSMA 4LTMA 1N8KA 2QNRA 2GN1A 2GPJA 3WQQA 4Q93A 8GPBA 4KQKA 3PNLA 1AKEA 4PXYA 2F90A 1VC6A 4X3PA 1RTIA 5K5MA 1G59A 1L4KA 4O4LF 1SCQA 2LXUA 3HU2A 1KDRA 2IXFA 1HQUA 1YJ9S 3P9CA 1M8PA 3DM9B 4PQUA 2CRLA 1DJMA 1UBGA 3CIFA 5A2QU 2IDMA 2UP1A 4ARZA 5B4UA 1RRKA 4UULA 1FDUA 1L5VA 2C2DA 1G8PA 4YB1P 4ILMA 3ITEA 1AZSA 2ZAGA 5AI0A 1QYXA 1L5HA 4AULA 1S3IA 6YASA 4PC3A 3FG9A 2JW5A 2NYIA 2ZOSA 1VCIA 5EN1A 4D98A 1JA0A 5CH3A 2HDOA 2O48X 1UTAA 3B70A 1EUDA 3PUJA 4Z7CA 4EJSA 3DUFA 3CLSD 1W85B 3G49A 4FXPA 4FFBA 1KIFA 2GAOA 3HJFA 4RESA 2CNBA 1Z18A 2D1SA 4MCAA 2Z8YM 4MPPA 1VG9B 4XYLA 3OE1A 3OM0A 3D6TB 1M66A 1FZTA 4ZDJA 4XQEA 1SY7A 3TEMA 3FGPA 1RXEA 2GKSA 5D51S 4YRPA 2QTCA 1ZG3A 4MLZA 4KGXA 3UN1A 1H1TA 1Z2PX 2QPAA 3B36A 3VNBA 3HJUA 1AZSC 1KTIA 5JJLA 4C8KA 3R2CJ 2VKTA 1W46A 1GO2A 4DVGA 3QUTA 2EW2A 4D26A 4OYPA 1TD9A 1E0DA 4G09A 4ZYXA 3SCLE 1E60A 3T7AA 2A10A 1O89A 4I50F 5J5CA 2BGJA 1HKHA 3W8DA 3W0LB 4RNHA 2HPZA 1T9WA 1RWQA 3TQSA 2F43B 4NFSA 4F91B 2VRCA 5IAJA 1AT1A 1FJGB 1NWCA 1Q78A 2O5VA 1KI2A 3NVAA 2JJMA 3LBHA 2ZJ2A 4UNSA 1Z06A 2VSQA 3IX7A 1JIQA 4C29A 5HKKD 4MKAA 4L74A 3STTA 3AY7A 2DG2A 3KEGA 4LF2A 4E5KA 1U1RA 4JXXA 5M5BA 1E1QA 2DH7A 3BXPA 3UWMA 4IX1A 2WTFA 1DTSA 3BWDD 3W2WA 1C7RA 4NYZA 3B6MA 3GA5A 1YU9A 4YP1A 2DT8A 1G3OA 1ECBA 1V8FA 1ZNXA 4AMZA 1SWWA 4A2PA 4QBIA 1ABBA 2HDWA 4I69A 5NULA 3NOCA 5A7HA 3ITHB 3SVLA 1SC1B 2I7VA 3B38A 2J30A 3I4FA 1XP5A 3HZRA 3CCQS 1N34B 4J7CA 4W5OA 4ZQFA 4OYRA 2OFXA 3I9MA 2ZW9A 1IUPA 4PX9A 1UFRA 2AMYA 3RW9A 3B6ZA 2CQ2A 4KIWA 3ER6A 1EWQA 3DE4X 3KQPA 3TSOA 3HWRA 4J91A 4COKA 5DASA 4RH0A 4FB4A 2AQKA 2Z95A 5FJJA 3UICA 3NPMA 1DAIA 3QLHA 1U2DA 1B4DA 1YUNA 4O2AF 3UJ6A 4ECAA 1LDGA 1JLRA 2F63A 4REMA 3JWPA 3BTOA 3N59A 2HDNB 2I76A 1FXDA 3O3LA 1HBUA 3UJ3X 5B12A 3B6JA 1FMCA 2J8ZA 1OAAA 4D8VA 4YONB 1QJ4A 1ACJA 1V96A 1GX6A 2W4CA 4AP6A 1ORVA 3LQKA 2EYQA 1M3SA 2Y1DA 3KL4A 3GJYA 4LSZB 4YMTA 2CNLA 5AD1A 4TLRA 1ZOPA 2IXDA 3LYHA 4JJIA 5B7NA 1SXPA 4TY8B 1FDOA 4F38A 4H1TA 2WKWA 1QCYA 2DHSA 4KMRA 2XZOA 1TPYA 3VNSA 3BXGA 2D2VA 1CZNA 2ZCJA 4OHZA 2EZUA 4U39A 4QGHA 3L46A 2P5TB 3LBIA 1TIBA 2ZJ5A 3DRSB 1T36A 4E1VA 5LDDC 2AJDA 1KFBB 2DH6A 4GKJB 1NVTA 1CY0A 4V24A 2ZHOA 3RUBL 2PFGA 4GI1A 1VRQC 1V45E 2MKHA 4F8RA 3SQNA 2K5UA 3CRNA 4RELA 3FWZA 1TDJA 3LK7A 1SULA 4I9HA 2W8KA 3WLLA 1FJXA 5AKEA 3TOQA 3FFXA 2F64A 4P80A 4Q00A 4HQ0A 3P27A 4OHCA 5IFLA 4X95A 2P9TA 1OH5A 1XFAA 4MI9A 1JHUA 2QQEA 4DR7B 4AT1B 5DN6D 3WKEA 4L9RA 3T3HA 3S7RA 1ZD3A 3QM1A 2CDAA 1XELA 5LYJA 4MVCA 2D5IA 2EL9A 1OF1A 4HDKB 3EH2A 4EUKA 1GPKA 5KFRA 1KIMA 1BQ3A 3CKYA 5EHXA 4F93B 2C7BA 1YS1X 3I12A 4I4CA 3U37A 5I48A 3GSIA 2VPQA 4OMUA 2O7VA 4UOZA 1L7EA 1ECCA 5CVDA 2RD2A 4H3VA 5CNJA 2NUUG 1HZZA 2F8MA 3QPCA 5ES4B 1IK6A 3IT0A 1K06A 1XQ9A 2FPIB 2XSFA 4HX9A 2XYGB 3K9HA 5AESA 1UAWA 4DF4A 4NXNF 1W0JD 3D3KA 3ZCSA 4PE5B 3B6BA 2DGUA 3TCXB 2YW9A 1Q50A 3KG4A 1R7RA 2GJKA 2P90A 3U7QA 1VMIA 4XFDA 5E4FA 1U8YA 1UWAA 4IH9A 4ND7A 1OFVA 2FPPB 4P3PA 1Z4LA 3MCWA 5CFRA 1JXQA 5B4VA 5KT2A 4C8YA 1PS9A 5J4HA 4KR2A 4BWFB 1NNDA 1JR3A 1T6NA 3RU7A 5ESWA 2IGBA 4QDXA 3IAM6 2OFWA 3LYLA 2PGOA 3ILJA 5AKKA 5GTDA 4UU0A 1HBMA 4KMOA 3BHNA 5EKXA 1NT2A 2AOTB 3OBBA 3IA0A 1ZGCA 5IBQA 5AKIA 4BLQA 3NP7A 1MO4A 1G4HA 4AO8A 4UUWA 2UU9B 3MFIA 2P9JA 4L0DA 3I8OA 3A4MA 2HEGA 3RUIA 3G86A 2X6RA 4ETNA 2HRDA 1C41A 1YBFA 3S55A 1OA0A 4WKRA 1XKTA 3GDWA 2ZI6A 2Z04A 5DNDA 4N8DA 4KUEA 3H4IA 4LHVA 4XDZA 3DXFA 4XB2A 3AY0A 4GC6A 1V47A 1SH2A 1DJQA 4JP2A 3HHLB 1E7MA 3D5EA 2IIQA 3C24A 1BRTA 3QK7A 3WK6A 1HRKA 2Q2OA 3FBBA 1E96A 5L4LA 2I6TA 3BK7A 1AXRA 2R62A 1DXYA 1QGAA 3GRYA 4DA6A 1NRIA 1N6HA 2RQ4A 5AW7A 3PD1A 3H4VA 2IEDA 1W29A 1C9EA 3HZHA 3ZYZA 4JASB 4PG4A 4G97A 4U5QA 1C7JA 1J2RA 2B8WA 3JQ8B 1A8QA 4O8ZA 1LXCA 1WC6A 3I01A 4NXMF 1V3UA 3F97A 4NV3A 5KFKA 2BGGA 4KHPB 3CDEA 3BS4A 1XWLA 4IG3A 1Z26A 2VDJA 2XAAA 3E3NA 2Q07A 5BQFA 4K03A 3S7ZA 2QLMA 2OO3A 2CNNB 8AT1A 1LS1A 2P91A 4X3OA 1PAEX 4P54A 4DSIA 4FTWA 2F9DA 1IE3A 1UDBA 3MK31 1ZICA 4FS2A 5AHWA 4M83A 4DX5A 3IN5A 3VJLA 4L9SA 3AOBA 4FYYB 3PC6A 1E61A 4OX9B 4UTOA 1GPAA 5U47A 3L43A 2E21A 5FA5A 2V7WA 5J2QA 4UARA 1K3UB 2XW6A 4DL0C 2FVRA 4X65J 3DKPA 3F1LA 2GGPA 1NF3A 4MUYA 1R3NA 4B4UA 5DYTA 4W5RA 4BVLA 3Q5DA 1OSDA 4EUSA 3I62A 2Q6CA 4F84A 2BWJA 2HZBA 4PPZA 1SCUA 3DAYA 4AN0A 1ZNZA 4O4HA 1P0CA 3HX9A 2EKBA 4K6HA 2P2GA 3S3TA 1G8KA 1JAYA 3ICCA 1N7JA 1BWQA 1BCSB 5E3HA 4DLGA 5J4LA 3DOCA 5LP1A 4RDHA 4Y0FA 2EFYA 2B7BA 3QELA 2FG7C 4D4JA 3CY6A 3CKLA 4CTAA 3FSGA 3W77A 2KFNA 1M2FA 1LPAB 4L9WA 2GVZC 1JB9A 1UZLA 4GC9A 3R9LA 3C1OA 4HT5A 2P4UA 4I3GA 2DETA 3G6KA 4F46A 3V8BA 3LALA 3TZ6A 1DBRA 1CSJA 3HCFA 1GNLA 2W6CX 7ADHA 1TA4A 4C4AA 5D4PA 2NSYA 4YR9A 4M1TA 3SM3A 1I5EA 3JZFA 4ROTA 1SIWB 1RXVA 1MFZA 2VWPA 2NIPA 4LF7B 1WOMA 4BKOA 2Z5LA 2PH7A 4INAA 1I3NA 1HFJA 1Q1GA 4BRUA 4MA4A 1TL3A 2VK8A 2WJ3A 2CJPA 1R74A 3NP9A 3C15B 3AR3A 4INZA 2D69A 2HA6A 4GH5A 4QUDA 4MKBA 2W4QA 4KHMA 1XQVA 1RXUA 1C0IA 5E3JA 2H4YB 2GN0A 3ZXUB 4GR9A 1CUXA 3DWEX 2MYUA 2AE2A 3LO3A 4MUBA 2BCGY 1XA0A 2DLCX 1H2YA 4RKRA 4PNEA 3PXAA 5HAOA 1U0SA 5FWXB 4QYTA 4TYYA 3PPWA 1HLPA 1NVFA 1IUOA 2KT3A 3HG7A 4I9FA 4RVSA 2QS9A 2INGX 3R0JA 2G8LA 2V4MA 1EBFA 1ZESA 1K7CA 3MS2A 4ZEMA 2WSSD 3VR2D 3UNXA 4I0WA 4D8YA 3HHLA 3JQ8A 2VJPA 3ZY6A 2XYRA 1PJZA 3ROQA 3PRJA 3OBIA 4EW3A 3H2JA 1MXFA 4UOEA 2IX3A 2KZMA 1JHOA 3UGTA 3I01M 3KAPA 2OTCA 4KFRA 2QUHA 4B8WA 3TRHA 1B3BA 3MJDA 2QUKA 4X62F 2C9OA 3JVIA 4EGCB 4UAGA 2HNYB 4HLBA 3TVYA 3DDWA 5DDPC 3PTWA 5IHXA 4MUIA 2AKWB 3O4FA 3SFZA 5HX7A 3PQ2A 4YB5A 3RWMB 2GIQA 1BHO1 1H2AS 3RAPR 3GJTB 3OMLA 1A9YA 1SQ5A 3JSAA 2BEWB 1KQPA 2JKYA 4BN5A 2O2IA 4E1BA 2XQGA 3F0NA 4A91A 1JQGA 1NHKL 4EG6A 3RR2A 4MYUA 2HQ3A 1ZL0A 4HFNA 3H17A 2B7LA 1YDFA 1J25A 1SU8A 3A14A 2XUDA 3MJSA 1WHYA 4TN1A 3M05A 5MN6A 4ZVMA 4MV3A 2HO5A 3RYFA 3WV4A 1F60A 3FDJA 2YNMC 2NUTA 1L1QA 3PUWA 5AVQA 4ZEVA 4RQTA 2VWGA 4JV5J 1GNRA 3RUEA 3BAFA 3PFGA 1OUMA 2OXTA 2QMUB 3ROFA 4M1SA 4D74A 3TRKA 2DC1A 4WA7A 1VSTA 2C83A 2Q4RA 3CG4A 4AZVA 2HFUA 5TVKA 3A25A 4I6WA 4FSXA 3JXEA 3W04A 3BQNB 1YE8A 3ZCPA 4V2IA 4AM8A 3D5TA 3GDFA 3EUFA 2YZ2A 1RABB 1DPGA 5AOVA 2R4UA 4CCYB 1E3MA 2MKYA 3K2BA 2PLWA 3PGJA 1GPH1 4IHAA 2X0FA 5CDYA 3WL4A 3D8HA 2WJZB 4RR5A 3AUKA 4NYMQ 4JT4A 5F51A 3KQVA 3BGIA 2FW8A 2A59A 1UJ6A 4HAOA 4N1AA 3TOXA 4C4SA 3QGPA 5C18A 4JI1J 1QK5A 4V19J 4RMIA 1HNXB 4FUQA 4UDNA 1T0JB 1ORTA 1EXDA 3CIZA 5DXFA 4E08A 2VICA 3M7IA 2BGLA 3VOAA 1ZD9A 3K0JA 1FFYA 1RT7B 3TJ8A 3GQVA 1TP7A 4N7MA 4BO6A 4C1BA 1YR2A 2IDKA 4MR8A 4I8IA 1FSGA 2VF3A 1E2FA 5H8WA 1OKKA 1PHPA 5E33A 1ZUIA 5KNBD 2CPIA 3E03A 3QX3A 1CZOA 2QSZA 2WM8A 4UHKA 3TZHA 2QC3A 3DONA 1DC3A 4HZUA 1D8YA 3PQ8A 1RI5A 4A8YA 1V5FA 2JKVA 1C1XB 3A27A 1JTVA 4UQPA 4LYAA 5CXTA 1U7DA 3L7DA 3AD9C 4D9FA 1PZMA 4ECYA 5ALZA 4A10A 1Y3IA 4UUOA 2OKQA 1Z68A 2Z9BA 3OL8A 2GB4A 2REBA 3IQFA 3PA6A 2CMGA 5GADU 1UC4B 4QDOA 3WO0A 3ELWA 3N8NA 1R8BA 4F2HA 1XHEA 4JLNA 1KE1A 3I0MA 4FYXA 3HKBB 3R0VA 4ED7A 4X8HA 2B30A 4CYMA 2WIGA 3LWDA 1OWNA 3CLTC 3Q8VA 4PLWA 3AHHA 2H16A 1N56A 1FX1A 4IFEA 2A4MA 3O1LA 2VJUA 3MAHA 4EB8A 2XUGA 5BSEA 2TMKA 4YIKA 3DDKA 2R42A 2QUJA 1CB0A 5ALSA 1T4DA 5TRTA 3QTLA 3KUXA 1BQNB 1CDEA 5HVNA 1CIPA 3TUJC 4O44A 4YRQA 4O63O 2Q8QA 1F06A 1ZK0A 3STXA 5D00A 4TY8A 1JAIA 4JB2A 3EEOA 4EA8A 3SIPA 5JJCA 2J3LA 1VBNA 3OIFA 1UKEA 2DR8A 4QZVA 4YP3A 3GLJA 4CLOB 4GVPA 3GDOA 3STWA 2OPHA 1EP2B 3VZPA 1G21E 2FG5A 3WYFA 5KT4A 1RJ9B 4HLUC 4DEYA 3I9ZA 3GYBA 2B8TA 1XC9A 3CPHA 3GDGA 5AO9A 2B4YA 3BD7A 4K9MA 1SU7A 1AN0A 3REQA 3THXA 2LU2A 2DBBA 4BP1A 3VX3A 621PA 3PT5A 3IUEA 1D8TA 3IHTA 4NRUA 2RDIA 1UT5A 4K4XA 2NQ2C 3I2KA 1SD2A 4K6KA 2J8SA 1NXQA 2ABYA 1L4EA 1HD1A 2FPXA 2EBUA 3KBOA 1KD1T 1SKSA 3VVTA 1VQNS 2OAEA 2P6NA 3D66A 3OD1A 2DSTA 5MGBA 4LF8F 3QZUA 4I67A 3B9PA 3AVXA 4MHSA 1USIA 5E9JA 2H3EB 1QLHA 4DX6A 2UU9J 1E5XA 3C3DA 4K05A 1JFSA 1IEVA 3DL7A 1TMKA 4OQEA 3UVEA 2UYYA 3CJSA 1MROA 1Z22A 4OZ3A 3WR5A 2WD8A 2YFYA 4B40A 4KLAA 5ENVA 3LP2A 4NY1A 1X8KA 5JO0A 3KT0A 3M8YA 1KVIA 1MQ9A 1T2EA 4XD2A 3PPYA 1H3DA 4O8CA 1VJGA 2VHEA 3NS7A 1G8JA 3E3LA 1DTTB 1WV1A 1HNWJ 3G6YA 1PGOA 2R8KA 1VCHA 4O3MA 5IM4F 5M2PA 2Q6TA 4IR7A 4AL6A 3JQBC 5FTLA 3RRHA 2YDYA 2BI7A 2PUTA 2WM3A 3E22A 1KYQA 3RIXA 5GZ3A 3H5NA 2P0AA 5B3JC 2QV6A 4CIBA 3U39A 2CJWB 4A48A 1N2SA 1YZNA 2HO4A 1K9VF 2BJEA 2XEXA 3FOZA 1R8XA 3EXHA 5KOYA 4GKKB 1IKYA 2Q4EA 2ZRJA 1IVZA 1RAGA 1OSNA 1LW2A 3UH0A 5E1MA 4DV5J 1D2GA 4OIMA 5INTA 2C3MA 4NL4H 1R64A 1RTJA 4E8UA 1FYWA 3RG8A 3NDIA 3VFDA 4B6GA 2OGUA 4KY3A 5JVHQ 2Z4TA 1F2DA 3RABA 4OXXA 1PQ4A 3NM6B 2AP6A 3ADCA 1ODKA 1W8IA 1XTRA 1Z8FA 2OSVA 5K0FA 4GMHA 2FSUA 2BF4A 2FB9A 4KX3A 3JQJA 4DABA 3D3NA 2XUZA 4MT1A 3HWX1 1ISJA 2MTBA 5CTAA 2C5SA 5HF6A 1JLHA 4Z1MD 1A4XA 3V4LA 2X2PA 4C2UA 1LJLA 5FJ4A 4LNAA 3DEHA 3N6NA 2Z4RA 4RTSA 1ZRHA 4B3IA 1U09A 4KLNA 1EVZA 4LJYA 1EBBA 5HILA 4G6ZA 3A9VA 1P6TA 3HVIA 5AKZA 2QTBA 2EFNA 1UXKA 2XMTA 4U2FA 2RAVA 4EJ6A 4BBPA 3HA3A 1A88A 1KY5A 1BSVA 1SCIA 4M5MA 1TKBA 4F12A 4X8MA 3BL8A 3NTOA 2QJOA 1VLOA 4M36A 4C0LA 2XMQA 2EWHA 4E5DA 4J0EA 1NXPA 3EMVA 1CLUA 2CADA 4HAYA 5EVJA 1W35A 1ESZA 3A9TA 2CVIA 2LRHA 1CYEA 3EXEA 5F98A 3QLVC 4OPMA 3DU6A 3V4VB 3GN1A 4AWBA 4X1OA 5JARA 4G1FA 3EM1A 4J29A 4WU2A 4FDUA 3A8EA 3G0BA 4CDMA 2H9IA 5F2OA 3FNFA 1XD2A 3RU0A 1XO1A 3I5UA 1V6SA 4GL4A 1E6VA 3IDAA 4RZ2A 1PFQA 4BV3A 2GEUA 5TXGA 2ZE2A 2KMLA 3W5IA 4QFCA 5H1YA 2V5VA 3RJZA 2F4VJ 2VBYA 2QJFA 3L7CA 3NWPA 1FSFA 2GJ9A 4EW6A 3UD4P 3HFSA 4GKJJ 4UATA 2PSEA 3MS4A 1IIBA 3GVCA 4U7PB 3UWDA 4PRFA 1O6ZA 4ARCA 4LJKA 3D7LA 3DFMA 2GASA 1SL0A 4H9GA 5KX5F 2H57A 4OUDB 2HK3A 1FRZA 2F3QA 4X94A 1P39A 1UM8A 4O5AA 2H1RA 3W3SA 1LF0A 4M76B 4G2TA 1E2QA 3LRPA 5ETRA 4BO1A 1CY1A 2JGDB 2E5HA 4DR5J 1FKPA 3ZNPA 4WXHA 3GUVA 2B99A 4R8VA 1JEDA 3QU5A 2FUKA 5J43A 3ZG6A 1PNTA 3Q5EA 3PV0A 1OY6A 1XDWA 1P6UA 3KLEA 2BRUA 2X1GA 3ASZA 1P61B 3DYVA 2BVNA 3D0RA 4PGHA 3NS7B 2YCLA 1S02A 3Q3GE 3NY0A 3M4YA 1UMCB 5GIOE 1TYDE 1MWZA 5FBRB 3IB3A 4CV2A 5A8RB 4CL2A 4PX3A 4AI6A 2QAGB 4ZVGA 2O0JA 2P5UA 2D3ZA 4IH1A 5LOVF 2GQ2A 3L4KA 2MKCA 3MWJA 2HBRB 3KTAB 4RKYA 5JQWA 4L5CA 4FHFA 3MCUA 2KYZA 3JTNA 1CPZA 4MGIR 1ADBA 5FUXA 4J9LA 1EK1A 3ID6C 4B9MA 4NFHA 5FH9A 1KONA 1P1CA 5DYGA 4B8YA 4DIUA 2ZVQX 4ZP7A 3DF9A 1XNRF 3PJGA 3FLEA 2CPYA 3C3LA 1RHUA 1IXZA 3TKLA 4OYMA 2Q9AA 4RVOA 2X7XA 4XOUA 2Z2ZA 5B1EA 4PHGA 2PVPA 1V48A 1PJ4A 4KHPF 3BDAA 1GZ3A 4KGVA 4OX8A 1T9UA 4BQRA 1J49A 4DWJA 1YBAA 4C7MA 1F1BB 5HFNA 4PXBA 3N01A 1G63A 3GIIA 1LVHA 3UMMA 1ODCA 3RHFA 4DFJA 2IA6A 1K1EA 4EHKA 4DPXA 4EK9A 4Y8VA 1HBUB 3PRBA 2IZ7A 4TS3A 4B9NA 5E6UA 1YFJA 2YWKA 2A0WA 421PA 1ARZA 3UJ7A 2O3TA 4KDEA 3W6PA 4RW4A 1Z7WA 3VGPA 4OI0A 2RAUA 3W61A 4DPWA 2HLDD 1S1CA 3PQ6A 3MEDB 4X4PA 4H0CA 4FFWA 3DQPA 2R6AA 3KEMA 2AD1A 1W4CA 4OL9A 1UFVA 1HSOA 5AI6A 4AJNA 4A0HA 1JH8A 2NVOA 3ZK7A 2AE1A 2LR0A 2GZSA 1X7WB 2ZK7A 4Q3BA 3COZA 2G0IA 1C30B 4U6PA 2X6TA 1OX4A 5EXSA 1ZBTA 4CMBA 2PKWA 2FQQB 1Z6YA 1I01A 3HJCA 3WL3A 2MR5A 1YZLA 2E87A 4DUGA 4TYWA 5CH7B 4ITVA 1AK1A 5DNYB 3LGAA 4B6FA 1TEHA 3TP2A 2D3O1 2JVIA 4Y0NA 2G1KA 1UA1A 2GEJA 3BZWA 3HJVA 1Z0UA 2GZMA 4KXUA 1HGXA 5LXYA 3QWFA 4EO7A 1WABA 1OBVA 5HJ5A 3VGJA 3V4OA 5EYPA 3M6XA 1T5HX 2Z98A 3IJRA 3TBKA 1KAMA 2XM3A 4PG6A 4D4GA 4OH7A 3M1IA 4ECXA 2BEVA 3AUYA 5FEUA 4XJSA 4RTQA 3EQZA 5L7WA 3N4WA 4M9UA 3FMVA 5JNLA 1D5CA 2MKIA 1QKJA 3EASA 2M1XA 2B20A 4OAQA 3DWFA 5DLDA 2FLLA 1XVAA 1NRJB 1UANA 4PAQA 2G88A 3N6XA 5EHNA 3IGVA 3EMBA 4RZUA 3ZD6A 3CZAA 4J1NA 4UCFA 1Y98A 4NWIA 5DJ5A 1S1UA 3CJ0A 2XS7A 5AIAA 1TYCA 4B9TA 4PX2A 4H6PA 1Y1LA 1PAUB 3SHTA 2P1DA 3HA5A 3OZDA 3MB8A 2AGOA 1EWVA 4G0OA 2VJLA 4CR7A 2OWDA 2H7XA 3S8SA 1OX6A 4TRJA 4DIOA 1RRGA 2J9GA 3O93A 2ZU0C 3W7AA 4TUYF 1EUCA 2CWWA 1Z0JA 3BMOA 1WDLA 4NHEA 3RHSA 2GMWA 5JXHA 2I4MA 2PZKA 2QNBA 4F4JA 4EMUA 3HVUA 5IZHA 2AJ0A 2NO0A 5HSPA 3W4KA 2CMHA 2GA8A 1FTGA 4IRCA 4ILLA 1Z73A 4C22A 1PL6A 2FDRA 2FMIA 3U6KA 3FMWA 1TU4A 2MSSA 4FBGA 1O0CA 1Q84A 1K68A 4LSNA 3JD4A 2DHEA 3LBAA 2ZT7A 4PNPA 1OILA 1ZKDA 1QFZA 2Y9PB 3DLTA 4Z4QA 1CUSA 1SQFA 2FVSA 3GFFA 2ZB7A 3M6WA 4ARSA 3ODPA 4Z53A 1R9GA 4R8UB 3DW3X 4B79A 4TTVA 2C9CA 4J0QA 2GBLA 3BJMA 4H2DA 1J0EA 2RDJA 3BS9A 3DMJA 2IKQA 2X86A 3OCZA 2QENA 2FEAA 3G0IA 1KEKA 2V6MA 1TA0A 4IDOA 1KHVA 3IVXA 5ITSA 4UVDA 4NDAA 1G5FA 1T1RA 1QF9A 1G2OA 4KT0C 1PG0A 3FOFC 2P67A 2YBEA 3UAZA 4WEQA 1MJGA 4S3MA 4E03A 4UMFA 1Q22A 1UK6A 2F3UA 4RZIA 5KWJA 4XX0A 1FYFA 4FINA 4X45A 3U0BA 5BVGA 1POWA 1USWA 2VNIA 5FTKA 2OGTA 1BJRE 1U0RA 5CH5A 5IUNC 1VCOA 3KTDA 2H51B 4ZHRA 2Q1YA 2DUJA 4DCGA 5JAHA 4F4DA 1UK8A 2W9BA 2WUVA 5K4GA 3FPHA 1S72S 1TL5A 2P68A 3I42A 1SEPA 3OL9A 4XVRA 2I87A 2PWAA 1FB5A 1MW7A 3OQIA 2P7HA 4OSPA 2F17A 4GRAA 3QY0A 1O54A 4I1VA 5KI6A 3GJSB 4IJKA 1NY5A 1A9PA 2PXCA 1BEEA 4UUBA 1A8IA 3SY8A 3KR2A 4ZZIA 3K73O 5B58C 4JYAF 3I2IA 5TQ2B 2MYTA 1T26A 4M5KA 5A03A 1TKXA 4B5LA 3MXTA 4JXZA 1N3YA 1J0DA 2HS4A 4PXEA 2IZ1A 4UNIA 1URPA 3KHLA 4NA3A 5JXJA 2PD6A 1B73A 3ORRA 4LBZA 4MEJA 3DGPA 3RTVA 3NONA 3IRWP 4MYCA 1YE3A 4UUQA 4CETA 3UYKA 4NICA 3GRVA 2C4VA 3T5DA 2C4UA 4JOSA 5BO5A 1G64A 5L3ZA 3T38A 2PKRA 3K9FC 2ZHAA 3SEZA 5EJ6A 4J9OA 2NO6A 4WXRA 4F6RB 4MV6A 2ZB8A 1XU4A 3Q8UA 3IOEA 1KH3A 4A3SA 3HD2A 2MQNA 4N39A 4J3JA 5SZJA 1F6DA 2G5PA 3DOLB 2R25B 1UZHA 3B20A 1K66A 1SZCA 2I1WA 3N76A 3B9RA 2WUGA 1FFWA 1A2QA 2HPVA 5TF0A 4CJXA 1D6SA 3T5JA 1E4EA 1VIMA 1J4AA 4DV7J 2FQ1A 4D99A 2PJDA 9ABPA 4JBIA 4PXSA 5LMNJ 3DT9A 1BXNA 4MP3A 5T5QA 5LQSA 3C1TA 2HGZA 1UMKA 1S1MA 4W7SA 3AFGA 3WZ2A 1D5WA 5HMXA 5HATA 4W1RA 1ULSA 1Y1PA 1IHDA 2C2EA 1VRCA 2AG0A 3VPFA 1RNLA 4ZT5A 2D3WA 3FCUB 2DEUA 4XCXA 5A8WA 2ATCA 4I5EA 4LSNB 2W90A 3QX7A 2ZHBA 3HB1A 5DETA 5AVTA 5DM70 3T0IA 2FJEB 4UY8T 3UH1A 3I31A 4MW2A 2DWOA 1JEEA 5KYGA 4K87A 3CJ4A 3UN5A 3Q8KA 2ZR8A 5AK3A 1EGVB 1EX9A 5CBKA 1KQOA 2C78A 2QQ0A 3PFWO 1OLXB 4Y2CA 3FDZB 2CSUA 2WWGA 4Q2LA 1A1SA 4OM7A 4DJBA 5FPYA 5HIJA 5FBLB 2E4VA 2MOKA 2YTZA 2AG5A 3OX2A 5JAOA 1IY8A 4MQBA 1Y8RB 2YYSA 2PBLA 3X1JA 4C07A 3CS3A 4W7IA 4RWZA 1SIZA 4NI2A 2GZ3A 2ZTMA 5HRUA 4U2GA 2QR5A 3C3JA 4R8UA 5J1PA 1KVKA 1T4MA 2JCXA 3Q8YA 2WTUA 1LBEA 3ZZPA 4ECQA 2GEDA 1PEDA 2O20A 4QL3A 1IU9A 1JNZB 1FU8A 5IZCC 4EX7A 1FLDA 2FETA 1GN8A 3LCJA 3SI7A 1C1CB 1F7UA 1AO0A 4LRFA 3ZHYA 2J59A 4B71A 3TI9A 2C2MA 3MM7A 2AK2A 4BTEA 5M2QA 3HN7A 2CLDX 4CR6A 1SQGA 2NYUA 2BR0A 4H0NA 3CD6S 1PO7A 3QZ8A 2D8MA 3OZWA 3K1JA 4ELTA 4IJUA 4IFIA 1T34A 4LC0A 3PCTA 4TYMA 1VJDA 5DRYA 3K0SA 1HPLA 3ZKWB 4FNOA 4UNPA 4YX9A 3HDHA 1HZZC 1D09B 5EZYB 2FPRA 3A3NA 2BR4A 2Z6VA 2ICAA 2ZBUA 3GD7A 2H59A 4BAGA 1WAMA 4Q9DA 5EIEA 2IE0A 2V55B 5BUQA 5IXYA 2ORVA 1T5BA 4U6SA 5D8HB 1TFRA 3BBFA 1RHKB 2AIRB 1J1ZA 3ZWBA 2PBRA 4L73A 2WF7A 1HR0F 3IRXB 3DB1A 4TUYB 2TMDA 2PMEA 1JIKA 3GIKA 3ZWYA 3D2BA 4DDTA 4BB0A 3H18A 2W37A 5H9EJ 1I6KA 4LE1A 2V3WA 5EN4A 3ZZNA 3UWTA 1N6LA 1WVMA 4GR4A 4OHMA 5DM60 1R31A 2PV0A 4GXQA 4UVGA 2F1HA 1T43A 3D0IE 3HBJA 3SZMA 2DPYA 1GCAA 4X1YA 1RZRA 1FHTA 4EUVA 3OE7A 2QGFB 1YE5A 2H63A 3P9XA 5HP1B 2QLLA 2A86A 2O3DA 1NJZA 1KLNA 4EYGA 4LY6A 1TCCA 1O97C 4DMGA 3TJMA 1ZPVA 3MF4A 1E4EB 4ZT6A 2YN0A 3Q1KA 2XRMA 3KU4A 3RK4A 4Y30A 4OUDA 2MSDB 3UAVA 1Q86T 1QLJA 2DXEA 3R5GA 2V7TA 4L5AA 4L8YA 4DIMA 4ECEA 1PX2A 4OU5A 5KQLA 1Q1BA 1E6LA 4H4EA 1W5FA 1CJKC 5FR1A 5KFUA 1I2AA 4JI7J 2O7SA 3GBPA 1S2NA 4NCJA 1TR0A 3A7DA 1C8VB 2YQ1A 4MUNA 1OJ7A 3VAZA 1YZYA 4P3KA 2FTKE 4F1KA 2X2OA 2OCPA 2VYQA 1ZSVA 4UM9D 5J2MA 4M89A 3HSZA 1ZTTA 3NAZA 5GONB 1A4UA 3ABRB 4BLRA 2QP4A 1COZA 4K2HA 4D9BA 1R18A 3D8NA 3S99A 1R0BA 3RRGA 4EWTA 3TAXA 1NJIT 4GX0A 4M0CA 4OQPA 1T24A 3ZEAA 4WMLA 4MLPA 1H0SA 4DOZA 1SOVA 721PA 1K44A 3G9UA 4XB6B 4PCAA 1BD3A 3LW7A 4M3NA 1CJUA 2HRRA 2HF2A 3UMYA 1PJBA 4JC5A 5LMUJ 3VO8A 2FF7A 2IU0A 5CQGA 2QN8A 3M1VA 3ESZA 5JWOA 2CLEB 3F3MA 3RU2A 2H06A 1EXVA 2R6R1 3N39C 4ZN6A 3M4NA 1EJ6A 4DJFC 4ZVFA 5ALGA 4CDIA 2EDAA 3DRRA 3TVKA 1ZITA 2HSZA 4FI3F 3R9XA 2Y99A 1JI3A 5DGBA 1JJHA 1BVRA 1YHQS 3QPDA 4C14A 4HXGA 1X4CA 3FZNA 1E4VA 3AZQA 3A3OB 1KBOA 1VJ5A 4G2NA 1H6CA 5DZ6A 1MXHA 1YR9A 1BFKA 1IL0A 3KE8A 3NFRA 3CD7A 4IH6A 3PIDA 1ZD8A 2I62A 4QYWA 4A8JA 5CDHA 2C2MB 1OPRA 2ZJZA 4RYDA 4WNAA 1B3RA 1PVDA 5ED4A 3IE2A 3C16B 5F1YA 2VAXA 2Q41A 1PLJA 4GX1A 2DXDA 1CNFA 3DM2B 1UZMA 5K20B 3MPDA 3HE3A 5T6MA 1IJKA 1DTEA 3LT5A 3VSDA 5IVKA 4JP3A 2I0XA 3VHXA 3K6RA 4KV9A 4IDKB 1J5OB 4ETXA 4Q9AA 3TW4A 4N54A 3AVVA 1LRJA 5DX0A 3TB4A 2CPFA 3QVVA 1GXUA 4DR5F 4XLTA 4IQFA 5E6UB 3UQYS 4URHA 1G8YA 3SX2A 1J8YF 1BGXT 3QQCD 2VHQA 2QNIA 1DP4A 1IPHA 1BQNA 3OPVA 1Y1QA 4MKGA 1IONA 5F7OA 2BABA 3A1UA 3GJQB 1PLKA 3PW2A 2CUKA 2OXEA 3CISA 4O1HA 1NI4A 1QVVA 1G8GA 2IV3A 2EX1A 3TTTA 1SGWA 1UZDA 2HFJA 1DEXA 1SQSA 4CMJA 6Q21A 3SR0A 3N79A 2FUG9 1IUKA 4MRMA 2X7IA 1NUQA 4YQYA 1VL6A 2C07A 2IEBA 3KVVA 2PHZA 5J23A 1WW2A 4M87A 4ZAYA 1U2RA 1IZ0A 4TTIA 2J5KA 4IFYA 3EWAA 2VL1A 3TQ1A 5AKLA 2CVFA 4L02A 2Q6IA 1DJOA 3ZS9A 5AE3A 3MHPA 3PJFA 1GQEA 4IIXA 2YZKA 4DUYJ 4CH0S 2FLVA 3TQEA 1W5AA 3PFNA 1GTMA 3K7RA 4R2WA 4IUFA 1F2HA 2R11A 4G1VA 2DPGA 2HA5A 4UASA 5K4AA 1R0CB 4JBYA 3BMNA 4Q5VA 4F4FA 3OZIA 4ZLPA 2HT1A 4Y2AA 3WQSB 3OEHD 3ZTOA 5KC9A 4I9UA 1Q7RA 4UCWA 1NBEB 1WEHA 1G3MA 3JQGB 1R8YA 5KAPA 5SYMA 4IW3B 4IFVB 2KJQA 4PIVA 3UDVA 2PT7A 1XTIA 3MQ4A 3NCHA 1D07A 3K8YA 5KTRA 2QLTA 2DHHA 3RBEA 3WAJA 3IWXA 3AR6A 4HYYA 4GP6A 3BZQA 4WE1B 3QF7A 4RSGA 3TFQA 3T9NA 3QIDA 3AVOA 3FPKA 3WFIA 4HI0E 2CVZA 2JBHA 4Q7LA 4F3QA 5L3SB 1R89A 3NVDA 1UCNA 1S57A 1F2GA 1YSJA 4JITA 3IG1A 2VYCA 2VPZB 1KQSR 3PXCX 3MGAA 4U8VA 1YC2A 3OIWA 3W7BA 5AVJA 2IYQA 1RAHB 2IA5A 3AM5A 2FHJA 3HS3A 2NU7B 4F56A 1ULHA 2E5IA 2DITA 5E3PA 4X1IA 4QJBA 1QQBA 2GAHC 2CAJA 3JATB 5L39A 4EHBA 4AQYB 1DAOA 2Q5HA 2IITA 2ZSAA 2EKYA 4YB6A 3OQBA 4LQLA 4JSYA 3Q11A 4PM4A 4EKIA 1RMQA 5KCZA 1R66A 1TMJA 1OI7A 2IOHA 3GIJA 1ZZGA 3R6DA 5AM2A 3I5MA 2PSJA 1OOEA 1RTKA 1XQ1A 1BO6A 3S2EA 2D1CA 2XULA 4HNRA 2Z56B 2JNJA 2VH1A 4FSDA 2IV7A 2R7QA 2XTAA 3MOZA 1P2VA 3ZXSA 4X6YA 5A71A 2OL4A 3LJKA 5MDHA 4AKEA 1O6GA 3NG8A 3OJWA 4OFBA 4PFSA 3AW9A 3FCYA 4AIRA 4IDHA 4KH0B 3SDEB 2ZYTX 3QF4A 3N58A 1R9NA 3MRSA 2XNJA 4LZNA 5KFFA 3SC3A 3FQKA 2V7PA 3LXUX 2G83A 1NN3A 1YZHA 3GJRA 4ZVTB 2AFHE 3TW0A 4FD2A 4C43A 4G9EA 2XCQA 4ZHSA 2I38A 1LBSA 4OJHA 5IEJA 5D6NA 1FUKA 2J9EA 4R9RA 1EZ4A 2FC8A 3DMFA 3URMA 4KO0A 2VHYA 3HCBA 3LLVA 4M9XA 2XVMA 3C2PA 1G6HA 4RUHA 3P9SA 4GGPA 4H27A 3L6RA 2VTEA 2WSFC 4A16A 2W2PP 2EKQA 3ANMA 3D1LA 4DG5A 4WJLA 1ZZNA 2G7MC 1L8AA 2OV6A 3SXUA 3HV2A 4IH5A 3AF2A 1QAIA 3I23A 1JHMA 2Q5CA 1HI8A 1POXA 4UCXA 5DU2A 3TL2A 1KQGA 2AC4A 1DTTA 1GK8A 4MW9A 1Y33E 2EAUA 4RD6A 3G79A 5B6PA 1RYEA 5IVPA 1E8NA 2AJ4A 5B64A 2ZOMA 1WZ2A 4Y2TA 2J9FB 2I2WA 4KN5A 4MVJP 2Q3EA 5GADI 3ECAA 1YJ7A 1A5TA 5F4BA 1BLUA 4IKOA 2HB6A 1K08A 3VRHA 1XLTC 5BRJA 2GZ1A 5CZXA 3HJBA 1PCAA 4RFLA 2UUOA 3Q1LA 5FPHA 2RHJA 1JW9B 2V98A 4ZREA 1H4TA 1W49A 5K7SA 5E1DA 3M2UB 4DHVA 4GX2A 1VI7A 1Z2DA 2XUIA 2I99A 1XJ0A 3SZOA 3CTPA 1VI2A 1W36B 1ZS6A 1B1AA 1TF5A 5LD2B 4US2R 3ONVA 3PGVA 3R5FA 4Y65A 2WF5A 2XNKA 3P94A 4URZR 4HGOA 3A4NA 4MS4A 3I55S 2AOUA 4DA4A 2QMQA 2SXLA 4ZI3A 2OPRB 1KVTA 4A26A 5IANA 1W1UA 1APSA 3L6CA 2IZ6A 3SMZA 5KC8A 3LC2O 3FNHA 2QRRA 1X4FA 5I9NA 5HF8A 2VKZG 1EAYC 3AOEC 5CRIA 2HYIB 3NHKA 1J8QA 6REQA 2IBTA 4XWGA 1A76A 2GK4A 2X5OA 2PRYA 2B56A 2JGIA 2O4CA 4MJLA 2QZ8A 3VVUA 3PDIA 3VR5H 5B37A 4GC7A 2OFFA 5A7FA 2A9VA 1WUJS 3K2IA 1NPRA 2ODNA 2ONKA 4TLMB 1TVMA 4I0WB 1OAKA 5DHUA 3E8SA 2XWXA 4DC9A 1G17A 1LRLA 1IVSA 4I4TA 2UUAJ 2G1HA 3HRIA 3NBKA 3GGOA 4DLAA 2V7GA 5BN3A 3GMSA 7AT1B 2K7KA 4MP8A 3EAQA 2NP7A 1FK9B 4C9DA 2HJGA 4ZPXA 2M4MA 3AB2B 2WFZA 2Z8QA 5GP1A 4OOFA 3TEJA 1MAWA 3HDQA 2WD7A 1B8VA 3FHCB 4NBSA 3V55A 1F9AA 4PO3X 3OQNA 1HQEB 3F9RA 4X64B 4A23A 1SAYA 3JS5A 1XRJA 1OTHA 2JEGA 2ZETA 5GV7A 4AYTA 4UM8B 4OHVA 3H1GA 2BFBB 1KI6B 4BYMA 3G59A 4FW9A 5LVAA 2DFKB 5JIBA 3TM5A 4DL6A 4KTVE 5DVZA 2HLUA 1JFFB 5FOXA 1CUVA 1KE2A 1XZNA 2YRWA 1E3DA 1KSHA 2CXXA 1Q8BA 2PVCA 4DQPA 4Q7AA 3QMWA 1SUQA 2CK3D 2LECA 1MB2A 1X7ZB 4DX8H 4F85A 2WYIA 2O8BA 4DLSA 3SHQA 5SZTA 2BD0A 3SEAA 2ZZNA 4L3KA 1V8OA 5K8MA 2ZE5A 4GC5A 2X2FA 5C4MA 1TW3A 2CVEA 1BXRB 4WZAB 1KA9H 4B7UA 2UZ1B 4YY3F 4LNHA 5B58T 1M1NA 3LIPA 3MTDA 3H0PA 3TN7A 1C7ZA 1EFVB 4OFXA 4V39A 3L6EA 1GXLA 2R6GA 2GHPA 3JARB 4JI7B 3PHCA 3O8BA 4MW6A 1U4SA 5IVIA 2FWIA 2ZE6A 3K8WA 1FESA 3W64A 4HACA 3OXFA 1AB8A 1X13A 4J9KA 4QW8A 3TLGB 4B74A 2O07A 3DAGA 3LWLA 3A3NB 2E89A 1S1XA 4GW3A 3C3MA 3BYPA 2R7RA 4EEKA 5HEKA 3OIYA 3S2SA 2IYVA 2XNCA 3KPVA 4DS5A 3RG6A 1E9VA 3SXLA 3A3PA 5DW3A 1UQRA 1MP0A 1SB9A 2MEWA 1C30A 5FLKA 4S35A 2J0WA 1QZZA 5PNTA 2R47A 2QLFA 4PYAA 2IEIA 9ATCA 4JLMA 2NUHA 7REQB 2FOIA 2F3PA 1YOVA 1OGIA 5HF9A 5SZKB 3AR9A 1P0FA 3Q15C 2XQIA 3IAUA 2Q9UA 1OFUX 3WLQA 4UTPA 3AESA 2V97A 2CLKB 2GFHA 2BFCA 4DIKA 3HFRA 4DY6A 4D3XA 1KDOA 4Y3CA 5J1SB 4R2HA 4TQRA 4RA9B 4QM6A 1RT6A 1VBKA 3N2YA 4X20A 2Q0SA 5TGTA 3LKDA 5LMZA 3N28A 2Y4NA 4BX9A 1LLCA 1O96A 1H8HD 4OIFA 5C1DA 5CD4H 2PS0A 3N86A 2QTAA 3CC7S 1YQQA 1PDWA 4LF9J 1MOSA 3U3DA 4H7IA 4R8LA 3E3XA 1GZ7A 4UVIA 2B43A 4W8OA 2RGCA 3KD3A 3U81A 4J5OA 2XT6A 2ENWA 4YJFB 3PCRB 3FR8A 5CT9A 2O59A 4HH4A 4BZXA 1PS0A 3SIWA 2VFRA 1QQ5A 2CXHA 5ELXA 3UIEA 5I7VA 2VG5B 2X0IA 5M29A 5JMNA 5DLEA 2R48A 3G85A 1QH9A 3KKQA 4P2SA 1L2TA 4CL8A 5BSUA 2XT0A 3ZWKA 3EVWA 1CF2O 4PKDB 3GFPA 3RKRA 2RHWA 4GRSA 1RRFA 1QKIA 2N47A 4F8YA 5MHTA 4KFBA 2GJ8A 2Q43A 3DMNA 5K05A 2YJNA 1H23A 4B44A 4EL0A 2OBFA 3H9GA 4UQGA 3RANA 4QYXA 4JUIA 4ZLLA 1JJBA 4ZC8A 8AT1B 2CNNA 1I3MA 4Q44A 4AKSA 4BE7B 2CBGA 4PLCA 4EG5A 2C9MA 3LGHA 5JAPA 2F3RA 1P18A 1WMFA 3MR2A 5EHHA 2IYRA 3HM9A 4GI7A 4JP1A 4HYTA 3PHHA 2O54A 4JDPA 4FYYA 3PX4A 1U63A 2NTJA 2RH8A 1PGQA 1FDRA 4P4SB 4WBFA 4WK1A 3ZDRA 4HDNA 3TZYA 5CEEA 3RHTA 2XI2A 1CD5A 3ZN2A 4G0XA 4P7BA 1T5TA 3M4JA 3JRWA 1KZ4A 1GSIA 5CB4F 1IN4A 4OYWA 2ZS9A 3GUHA 4UM9B 4CLRB 5FADA 3CO9A 3HXTA 1BFDA 3BKTA 1RISA 3W9HA 1B8OA 4EX6A 3FTCA 1KMNA 1ZPWX 3PF9A 3WRVA 4EGLA 2IBKA 2JGLA 1CUFA 5E7QA 3IERA 4XLLA 1XCOA 3DG9A 1ILWA 2OZEA 1FPMA 1P8JA 1V7CA 4R7TA 2GXAA 1RKJA 1LNQA 3G9CA 5HMLA 3SYZA 5EUCA 3UMSA 2E6UX 4M5NA 1AHNA 4ZEWA 3KG0A 2OMOA 2F4VF 2MSKA 4KK3A 1C8KA 2JLVA 3ZBPA 2EL7A 1OH7A 2GA9A 3KLPX 4WFJA 3DPSA 2Q5EA 1UWLA 4IYRA 1WOYA 4C06A 5IUKC 2RG7A 5HE9A 4BLSA 4YCBA 2YKMA 2G36A 3LOQA 1U7HA 3PZPA 1Y8QA 3EXAA 4RMJA 1N1MA 3R8XA 3E81A 1BS2A 3A6JA 1FEEA 3MM8B 2OBXA 2RGDA 5DI3B 4OMDA 1T29A 4DAEA 4ZJZA 3J7ZT 1Z0FA 4M1ZA 2HT6A 1A1VA 2D4HA 1DFDA 3X0DA 5ETNA 3BD9A 4ECUA 3HNOA 3MTJA 1X9SA 1NR7A 3LU1A 3SXPA 4M95A 3FWNA 2QIOA 4N3BA 1R27A 2LE0A 5FBVB 2IPOB 4URQU 4KRYA 1H6BA 4IKAA 3I32A 4P4NA 1BHJA 5CA5A 1PZNA 1EYZA 4ISCA 3GB9A 4OXYA 2HQBA 5G0RA 2V1XA 5J2TB 2C7VA 2OAQ1 4EJFA 4A8KA 4Z7NB 2I6GA 2JH8A 1S1WB 4YTEA 1RWOB 3L0BA 4N0DA 1FFSA 3U9LA 3OG9A 3SZUA 3RRNA 2ZWIA 4MRVA 4NZPA 3G5UA 3HYLA 4BPBA 1NDLA 4LF5F 5EHZA 4N7BA 1C9NA 1TJNA 1LOUA 2HHAA 5BR8F 2DBZA 4C89A 4HDHA 1CDZA 1TRHA 2EFHB 2PU7A 3D6AA 3U48A 2HU5A 4WHMA 1FNCA 4O3QA 3S29A 4MOWA 1EX8A 5DYWA 3IAXA 4KJIA 4B2YA 1DRWA 4H08A 2RHSB 2VA9A 3V8VA 4WX2B 3ILSA 9RUBA 1GUDA 1J8DA 1CZUA 5D78A 4NZZA 2RGGA 3FC9A 4MPDA 2CGEA 4D44A 2FJXA 4AY3A 2Y1GA 1YMQA 4X7RA 2AOXA 5F5LA 2RMLA 2ASEA 4Z8YA 1K7EB 1O6BA 3P3DA 4EY8A 3VQTA 2GZDA 1G3UA 1RI7A 5GONF 3O82A 4UJ3A 4PYLA 4QIHA 5EJ7A 3UBTA 1I94J 4F3MA 5KG6A 2DQKA 3ZH2A 3D6HA 4DCCA 3THTA 3Q8XB 3ORFA 4N3NA 5I9TA 4BLTA 2GM4A 4WWSA 3KZKA 4WP3A 2HWTA 4MQFB 1RU2A 1WJ9A 3ONFA 3FUXA 4E14A 4PAMA 2M9KA 4RS3A 4WZ6A 2AX0A 5AW8A 2FAXA 1RBOB 4QBFA 3WLIA 4OKNA 2ZRPA 4ZOSA 3SXJA 4ENVA 3F47A 4KLZA 1ZMBA 1FXSA 3ENAA 5CNIA 4NYMR 4BJ5A 3IO5A 1DKNA 2PNJA 5K8PA 4P4SA 3PXEA 5KNLA 3SZLA 1UBCA 3L4EA 3W9IA 1IWBB 2JHPA 1B0AA 1ZX1A 3PZRA 2L2QA 3JD2A 3KSUA 4YR3A 3Q85A 3ZTPA 2DHCA 2X0RA 5ECWA 1R6DA 1Z16A 4X0EA 4L5YA 3JVUA 4E5YA 4S2EA 1SXJC 2R68A 4L22A 3DJFA 1CUHA 1AKQA 3G7NA 3NHUA 4Z3DA 4RHUA 4Y9DA 2JEZA 1FJHA 1FS4A 1MUUA 2WJIA 1HWLA 1X8DA 1JG2A 2XTJA 3KT6A 2RKOA 1JEJA 4P8RA 5C2JB 3I9NA 1RTHB 2XYGA 4JC0A 1UPPA 3IL2A 4YRSA 2Q79A 1UBRS 1VQMS 4UFNA 4OMCA 2AG6A 4GMDA 2IY7A 3RS2A 5EZYF 1L4MA 4ECWA 1CG6A 1C3OA 3D1QA 3IELA 1SVUA 2YASA 3N8DA 4LS3A 3DQQA 1L6RA 2YNMD 4ED3A 4DSZA 3OR2B 3USCS 1L9KA 2FVQA 3OZAA 2CFCA 3CBQA 3WLTA 4DLRA 2PFSA 4U9RA 4LOLA 3BTSA 2PUCA 4EK2A 2IRUA 4DS4A 1U3CA 3EB9A 1FKOA 5JSUA 3DE7X 3AR7A 3K0AA 1FXRA 1IH8A 4E2ZA 1T3SA 1FFGA 5E1OA 3T7CA 2WYWA 1FFXA 2AX3A 2IDLA 1OGJA 3HUTA 3GC6A 3OZRA 3PLNA 4CI0B 1NKEA 2J7WA 4HV4A 3DLIA 1KEUA 4PYKA 2J3JA 1U1CA 3FVRA 3LQ2A 1KJQA 1WDDA 2VJCA 5I3CA 2H1OA 1QHHB 4R1SA 4Y2GA 3T5TA 1NUAA 2V63A 1ZYQA 2HMUA 1EWRA 4CLEA 1T2VA 4ENOA 4FBTA 3HA2A 2WVBA 5LQNA 1TQ2A 1D3WA 1S3FA 3H5XA 1EWYA 4EYHB 3U7GA 4C3UA 2Q21A 5EHGA 4D02A 5JDCC 1RZRD 3RSOA 1T8UA 1DBIA 3NT2A 2A92A 3HVKA 3LWZA 1DIHA 4QTZA 2VUSA 1V4NA 1U8CB 3ZZTA 5JT1A 3B3GA 1JLQA 4ZHQF 1L1RA 3PFCA 2IA0A 4HK4A 1KGDA 3DVLA 2O8DA 1VJTA 4FMCB 4S1TA 4M22A 1P6QA 2OP1A 1NN0A 1E5VA 4BS2A 4ARUA 1IR0A 1L4YA 2KBEA 3PNPA 5FPTA 1I1HA 3PKJA 1YRTA 1VHQA 3MEQA 3PKIA 2PX8A 5DNAA 4NZYA 3W2VB 3G8CA 2B1JA 1DX4A 1XEFA 4RHXA 2IOFA 3JQMA 4MQFA 4R68A 4PRLA 5EJIA 4TKMA 1N4AA 1DKQA 1Z33A 3SVTA 3S01A 3QLTA 1JSRA 1X7WA 3HB7A 1RMYA 2DTEA 2Z43A 2OLEA 2R9VA 1OFGA 2OKCA 3IRXA 5KAKA 3GPCA 4KQCA 4X1KA 2J7UA 1AO3A 3OD5A 3UZUA 1NV8A 2DGQA 1JI0A 4HVLA 3CDUA 1SXLA 1ID8A 4O4RA 2IAJB 1SJ4P 1D9ZA 1X1RA 3MUTP 4CT9A 3GO4A 1J5EJ 5AXKA 5EIBC 1ULZA 3DE1X 3HVJA 4NMHA 4YALA 3GARA 4QOGA 3WZMA 2XJ9A 2D3TA 1ZM3A 4IEIA 4D9CA 1LLFA 1Y00A 4ER0A 1RZUA 2XGJA 1RSCA 3FTEA 4P52A 1Q7CA 3VVBA 4BVKA 4Q03A 2WBLC 3H8SA 3NCQA 2Q2NA 4A92A 2F4VB 1WNFA 1BXRA 3EODA 1JLBB 1P1IA 1DS6A 2QVBA 3IUPA 1WSWA 3S5JA 1D2RA 2CLHB 3PD0A 3MJEA 3NGUA 3CCMS 2JDID 4HNHA 2I8LA 4ABTA 2C28A 2WQZA 2RJ3A 4I1TA 3QU4A 4IDQA 2J3HA 3ITDA 4Q37A 3M8PB 3NS6A 3CCFA 3O26A 3HN2A 5B1YA 3CVUA 1BE8A 3PLAE 3OCVA 4E15A 3MMAB 3QPVA 3J80A 1BXKA 1ZJ4A 2OEMA 4K5RA 1EXMA 4PQAA 3PXGA 4ZIVA 3I4CA 3IBYA 4BJ1A 3DHVA 1MAVA 4ZPVR 3ESRA 3L7BA 1MN6A 1YZ6A 4KO2S 5DEIA 1EK5A 2CDCA 5EWMB 4ID5B 3R7BB 1NXSA 2AEMA 3H9QA 2QTVA 5M34A 1XNRB 2OXRA 3GG0A 1U6BA 3UHJA 2NP6A 4LZLA 3E1SA 1JWAB 3NAIA 3OPYB 5DV9A 3P2KA 3FD8A 4MHTA 3NXZA 4IIVA 3EISA 1AQNA 3DFUA 5IZCA 4AE5A 4E31A 5IJAA 4E5MA 1UFOA 4CMIB 2RH5A 2XYQA 3I0SA 3RBDA 3BICA 1JLCA 1XMQJ 1NFRA 1G20E 1KK0A 2ET6A 5BXQC 1LBTA 2E9RX 1KOJA 2EZTA 2VK4A 2YJGA 1RA7A 1J9GA 1T2UA 3FEYB 5EIOA 1NJ6A 4DDWA 4YGYA 4AX4A 2JAWA 4K4UA 3D9BA 1ZU4A 4RW9B 3R9WA 3M89A 3MMXA 4B80A 3KDAA 1U9IA 4FVTA 2AS0A 5TGDA 4F21A 2NXEA 3CE6A 4WNAB 2W58A 2DBQA 1NJSA 1RWKA 1B74A 2PGJA 1GFWA 4C4OA 1UIMA 3HVHA 1WF1A 2BBSA 4Q47A 4DL7A 5EMHA 3IR5B 4CF3A 4DZDA 3R1IA 4FF1A 1VKRA 4I1RA 3IB6A 1FTWA 4RVDA 4E3ZA 1WTBA 4OJTA 4K9DA 4GLBA 2OD9A 2GCPA 1DTQB 5A2GA 2AX1A 2MQOA 3NEYA 2Z5GA 3HY3A 2G9NA 4GM4A 1VSQA 1Q2UA 2FUG1 4BWGA 2BMJA 1U7PA 3H5VA 3O5AA 2KM8B 1N5RA 2REQA 2P2DA 3SS8A 3UQSA 3R8CA 1T8PA 3KOAA 2J46A 1LWEA 4Q82A 3D6JA 2Q50A 3AF5A 4Z51A 3SYTA 4TMTA 3TIXB 1LK5A 4L4XA 4JKOA 1QHNA 3RARA 4D3ZA 4YB8A 5L3QA 3HACA 3AF0A 3K70B 1V39A 4LJ9A 3L6DA 2FVCA 5F8MA 3VISA 3OR1B 1IDOA 5LDHA 4NAUA 2GCOB 1T8RA 1A9SA 1E1MA 1SCJA 1D4OA 3CLTD 3QWPA 1AA1B 2CNWA 1HETA 4MDFA 1QF6A 1EFPB 3BDPA 4HLCA 4GIBA 5CW1A 4FYWB 5K0EA 5AJ3F 4L76A 2BFEB 2VCHA 1YMUA 1ZOIA 4PV7A 1FMTA 3UPFA 5C3UA 4ZT2A 2NXCA 2AGQA 2I2YA 3KXLA 3FIJA 3DC7A 2H1HA 1T6XA 2RBKA 3SSOA 5KT7A 5A9RA 1ML4A 3B9BA 3GNTA 3HEBA 3IBWA 2CMKA 3UANA 5IT5A 3DV0B 1T15A 4LWQA 5U4QA 4F26A 3R3JA 3U5TA 3DOOA 4Y6SA 5KFMA 2AYMA 3R3HA 4OGFA 3UKOA 2C00A 3T34A 2HIAA 4DV5B 3O9MA 2KXHA 1I7SB 3VZBA 2UUCB 1DC8A 4YDHB 1EE2A 2RGBA 2NYHA 1HLFA 4J90A 3NHRA 2OUIA 1WF6A 5ALOA 5B2ZA 1AHHA 1F4VA 4ZD6A 1XK7A 5A6PA 3PIRA 3N2NA 4L8WB 4J16A 4A9AA 3MMAA 2C99A 4BS9A 3AV3A 1CY7A 2L42A 2JJ2D 2PMFA 4AJHA 4P7JA 3DCJA 1D8ZA 4HSEA 3T9BA 1L4HA 1ZR2A 2V4JB 4ZT7A 4W7HA 1EK2A 3OCCA 3ER9A 2QN6B 3GZNB 1IOLA 3UCZP 2Q45A 5IG2A 3LTOA 1MWQA 4P7GA 5K0LA 3GH3A 1Z7EA 3M8ZA 3MDFA 3VU9A 2CCGA 4I46A 2H4ZA 4RHTA 3PG5A 1QHSA 1RWMA 2YY5A 3SYLA 2BZ2A 1WSVA 3CCZA 3T99A 2XYHB 4YLGA 4GRIA 2MPUA 5AOAA 4HQRA 2OPQA 4EAQA 3P20A 1COWA 2D06A 2GBFA 5CHYA 2O2GA 1VFJA 4EY5A 4ZLNA 5IYZB 3MCNA 1ZA1A 1V9SA 3SZRA 4MR8B 2CV0A 2IYNA 4CO5A 4V0MA 2ECOA 3NG1A 3LHDA 1U1FA 1TL1A 2WAAA 4LR7A 3KSMA 5D3ZA 2PX2A 2EYUA 4PINA 2YKPA 2VSYA 1VXRA 3U7JA 5DIZA 4GEKA 1KEWA 5C52B 2FN3A 1YJWS 2XUHA 3IEVA 3PDNA 3B2EA 2V6JA 3ZCTA 1V8ZA 3AXKA 1P5RA 1YVPA 3DUWA 3AT1B 4LDAA 2JHAA 1KFJB 2VUGA 1WTAA 1SZPA 1XF9A 3BM5A 5ETVA 1YTYA 2I7CA 3EVOA 3F4LA 2ERXA 2JFZA 3FGVA 5BSHA 4LMBA 1UP6A 2Y6VA 3OURA 5G0WA 1XZLA 5AVRA 4ETZA 2CJXA 4WCFA 1ULAA 2YWRA 4D9EA 1BRMA 3ZWCA 2ZULA 5L3QB 4BC1A 3NW9A 5CHEA 1HORA 4G8DA 1ZTWA 3EW9A 5AJXA 3T41A 4WGFA 2QXUA 2W6JD 3RS3A 3MEDA 2D1TA 2V0CA 1ICEA 1JZSA 3VTKA 1SVMA 5IC6A 5EIBD 3FKBA 1TMOA 1ZA2B 1RWWB 4FYKA 1T4GA 4A27A 4BBYA 4CCSA 3KB8A 1MO2A 4RTJA 1KL7A 2IXAA 1AYEA 1NA5A 2O4UX 3J81k 4M4SA 1IZZA 2E4UA 1U47A 2A58A 2Z8YA 3RVJA 2ID7A 3RSLA 3W5DA 1S9FA 2RHLA 1XJQA 1WW8A 4R3WA 4HFJA 3RREA 2FC9A 1ZZFA 3K5NA 4EVRA 3WQRA 3WMGA 4ONEA 2DH8A 4EFNA 4DL3A 5CK4A 4UT4A 2GEKA 5CEFA 1PWHA 4G37A 4BGIA 1FW6A 4U5XA 3H6KA 4U7WA 5EWLA 3G2PA 2IW3A 1HYSA 1JHZA 3DNCA 4KN9S 4XLZA 8LDHA 3E8OA 5I7OA 3CRW1 5EYPB 1PJRA 2CFRA 3CR8A 4D9JA 3KK3A 2JDIA 1Y3DE 1SXGA 4PGFA 4C05A 1X42A 1RLCL 1N0HA 1AMNA 3ZHUA 2N46A 2R5NA 2EP5A 5K0NA 4GD3Q 4GMFA 4O2BF 4C4RA 3B89A 1YB2A 2V2VA 5HJYA 1WZNA 3P9PA 1A8PA 2PZJA 3B1JA 4JT9A 4HOYA 5GQSA 4EI9A 1OY1A 2QYCA 3GX1A 4NU5A 3KJEA 1UOOA 2BJDA 4HC4A 3Q9UA 2ZYIA 3LLCA 4E7OA 5ULLA 3OFGA 3HDVA 4RL1A 1W0KA 1AZSB 3WIUA 1YQDA 1Y3JA 4CQMA 1L5HB 4TRNA 3OM9A 2IXTA 2Y9HA 4M6WA 1RAGB 1EE1A 2NADA 4ZQGA 1G6BA 3R6GB 3FCHA 4ZPDA 3FYSA 4PWUA 4REQB 2EWVA 3W79A 1SPBS 5KX5A 2CDRA 4UAUA 4HAVA 2Q3BA 1KMHA 2BV3A 3F74A 3MSXA 1KJ8A 3Q40A 1OX5A 1G3RA 3RQSA 2LA4A 4XWWA 4AG3A 5K51A 2QLNA 2AYXA 4YR0A 1QUFA 3ZWWA 2U2FA 1R0YA 3LH5A 4ZQIA 1GKUB 1G6OA 3IJPA 1J7KA 4CCWA 1WHVA 3CNQP 1DBQA 2FNAA 2R79A 2B4PA 4AMVA 1AJEA 4G1EB 2Z9CA 2AHOA 1ETHA 3Q7QA 4NP6A 2QVYX 3SQLA 4F6CA 1F5BA 2WYHA 3ZHBA 1VCMA 3AETB 1MO6A 2IM2A 1J70A 1ZGHA 3WYDA 2FGKA 3ZFVA 2NTVA 1H9BA 3OX4A 4A2CA 3DLHA 1V1MB 1GPYA 2YOFA 4K0KF 2ZAIA 3BKWA 4KFUA 4DL5A 2ONZA 2R8GA 2VDMB 3DZDA 2OHVA 4XUDA 2JGMA 4ETMA 4CIVA 4J9PA 5B0FA 2XY5A 3LC1O 1I7DA 3KSRA 2BJHA 3DVSX 2P41A 3TSZA 4B73A 5DNWA