2ZX6A

Alpha-l-fucosidase complexed with inhibitor, f10-1c
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx6A01
3BVTA 1BGGA 3VD9A 4P7QA 3EBVA 5FKYA 1UH3A 2DSZA 6A3HA 1KXQA 4W5ZA 1UD3A 3AS0A 4GZIA 3FNDA 2W91A 1CZ1A 3LX9A 5DF0A 4X9YA 4OBSA 3MUY1 1H1NA 1GJWA 2J47A 3S5ZA 2J8GA 2XVKA 4JKMA 3WDPP 1C7SA 4W87A 3VM7A 5M3WA 3ALFA 2FH6A 4ZXOA 4UOJA 3VIKA 3N18A 1E6SM 4PRWA 3AS3A 1TZ7A 1ISXA 1HF6A 2VI0A 5EFDA 3T0AA 1J0ZA 2GDVA 2XSBA 3D4YA 1ZJAA 1CWYA 4JL2A 1DWJM 1G5AA 3S6TA 1B3WA 3DECA 3OGRA 5A6BD 2ZUUA 1IZJA 2WKGA 5CGTA 4BQ4A 4GZEA 2ZIDA 3HG4A 1SFSA 1JYWA 4NZJA 4M81A 3AIUA 2WMJA 3MMWA 1E4MM 4W8LA 2OLHA 3OLEA 3IJ8A 5BXPA 4U2YA 1B31A 3A3HA 2ZICA 3BC9A 1WP6A 4XV0A 1EIBA 3ZJ8A 1QI5A 4LQ1A 2V3DA 1KBBA 4PMNA 3AQUA 3ZJ6A 2J4GA 3OBAA 2QMJA 2EQDA 1NP2A 3WY3A 3WBEA 5IFPA 1OT2A 3GXPA 1WCGA 3ARRA 4XZWA 3W4RA 2G3NA 4Y7EA 1EQPA 1OGSA 2V5DA 2B31A 4GKLA 3HMCA 3TTOA 1R47A 2WYSA 1LG2A 1UHVA 5JIWA 4Z2LA 2WC4A 4U31A 2VX5A 1FHLA 2X05A 2VZOA 4MJ2A 5D8ZA 4AISA 2D0HA 2X2JA 3B9AA 1I1XA 2GJXB 2WLZA 2YLLA 4JFUA 2PWFA 5F7UA 1HJUA 1TQTA 2J77A 4CU7A 3B9EA 4JAWA 4RE4A 2VVNA 1DP0A 4ATDA 4F66A 1EDQA 2J7CA 3VUPA 3ZT7A 1D3CA 1CENA 3JUGA 4NXSA 3W53A 3BAIA 1GQKA 2JIWA 1UH4A 1JYVA 1QHZA 4NF7A 3U57A 4LYRA 3CHCA 4ZE5A 1EQCA 1EXPA 4BF7A 1MQPA 1V3HA 2WNWA 1UD6A 1M03A 5GNXA 5ABFA 1JZ7A 3KE0A 4PMRA 3BCDA 4P8XA 1M04A 1MFUA 1OD8A 4MTVA 4B3LA 1Q4NX 3NSNA 4W7UA 1Z32X 1HJSA 4F9JA 1JAKA 4WKHA 4URIA 4CVWA 3SEPA 1ISVA 4GQQA 1QPKA 3RIKA 1W9UA 2J78A 1FA2A 3CZLA 3DX0A 2BVDA 2IXUA 1HL9A 1QI2A 3CMJA 4JKKA 1XSIA 1C8QA 1UD2A 3VD4A 1BYBA 1WZLA 4P8VA 4EANA 3W38A 3T08A 1PBGA 1UD8A 3L4UA 2WM0A 2OSXA 3T2OA 4TVDA 1KXHA 4GXPA 4GPNA 1LWHA 1WNOA 1UWRA 1V3IA 3ARUA 2XVNA 2G3IA 4UFKA 1JZ6A 2Y8KA 4MNMA 1KR1A 3AFBA 3KL5A 1MVYA 4MAZA 2PC8A 3VDCA 3DC0A 5A6MA 2ZUNA 5I2UA 3VGDA 2E9LA 2BXZA 1VJSA 2CIPA 1ISWA 3WD0A 1MWOA 4RE2A 4CGTA 1M53A 3O9NA 1OIFA 2YDRA 2YFOA 4EAMA 1J01A 4HZ8A 2WSPA 3GM8A 3GXIA 4UCFA 3W27A 1CGUA 2GDUA 2ZXDA 1V0LA 1J9YA 1JDAA 1GOWA 2WBGA 2C0HA 3M7SA 1GHRA 3WF3A 2DT1A 4ZENA 4JFWA 2WC3A 3WNPA 1VEPA 1OWQA 1UR0A 5DMYA 1JFXA 2Y4SA 4OOZA 3AIQA 5I6SA 1XGZA 3UERA 2XIBA 2WXDM 3HG3A 4IISA 5JUVA 1MYRA 3VGFA 4D6JA 4PEEA 3FAWA 2D24A 5FIPA 3WMBA 1C91A 3WDHA 2ZX5A 2HVMA 2XSAA 3ZR5A 2D0FA 3UESA 4AZ6A 3VD7A 4GO8A 2W66A 1GUVA 1M01A 1CGYA 2WCAA 1UKSA 1AQ0A 2QMKA 4PTMA 3K4AA 1QBAA 2WMGA 1BPLB 1V3MA 1AQMA 1OCQA 5LA2A 1DEDA 4AIEA 4DUWA 4N0RA 2DSVA 5GNZA 3T09A 4MB1A 3AXIA 3MUAA 4DWSD 3TONA 4ATLA 1HXJA 3QR3A 1ECEA 3NCOA 1XCXA 3NIYA 2VX7A 4QFUA 4JZ5A 3NDYA 1V08A 5A69A 1LJYA 4UQDA 1XH0A 1OINA 1CXIA 4GINA 4P8WA 3LXAA 2EACA 1RH9A 3O6AA 5E9AA 4UZUA 1E55A 2YL9A 4XB3A 3I3DA 1UKTA 1JZ2A 3W25A 4D1JA 3A5VA 3KL3A 3MU7A 2EEXA 2XWDA 1ZBCA 2XN2A 5DFAA 2JF7A 1UWTA 2OW7A 4CD6A 3WNMA 3D50A 4YHGA 4P7OA 4ACZA 3SCWA 1DWHM 3AMDA 1TQUA 5CPSA 1C8XA 3WF2A 4KRUA 2X2IA 1KQYA 3O2LA 1WB0A 1CXKA 1BFNA 1G0CA 4WJXA 3PN8A 4ATWA 4PCSA 1U2YA 4FNUA 3N17A 4P8UA 2CHNA 2YBTA 2CBIA 3WDJA 4TXEA 2ZUWA 1C90A 3BAJA 1PX8A 4M82A 2O92A 4FLRA 4AMCA 5IHSA 4TTGA 4H41A 2EAEA 1E4IA 2DEPA 4D6FA 3LMYA 3WIJA 1ZBKA 4B9YA 4WLCA 3B9DA 3ARWA 4M24A 5M17A 1OD0A 3WF0A 1CGWA 3MI6A 2QLYA 3BUIA 3WNOA 3CUFA 3N9KA 2PBGA 3DDFA 1H49A 1PIGA 2V3EA 3VM5A 1NH6A 2VT0A 4HTYA 3WD1A 3QOMA 2Q8XA 4U3AA 1KFWA 3WH8A 4CN6A 2FGLA 4Q22A 1QNPA 1QOXA 3VIPA 4HU8A 1JZ4A 3AIEA 5CPTA 3WENA 4PTVA 1DTUA 1PEZA 3TTYA 3A24A 4FNQA 2VURA 9CGTA 1WDPA 2W62A 2QV4A 3ZT5A 2WVSA 4PUDA 1FH7A 1VBUA 5A8QA 1NQ6A 4W93A 4TVCA 4CD5A 1ZU8A 3L4YA 5TD4A 2X2YA 4AZBA 2BFGA 5I23A 1HVQA 4LXFA 3ZSTA 3SUSA 3ZJKA 1U33A 4KWUA 4C7FA 4CCCA 3WNLA 1E0VA 2W67A 4D1IA 2AAAA 1F4HA 3WQ6A 3BMVA 3SCQA 1HKJA 2WB5A 2D3LA 2O9PA 4AY1A 1VAHA 3WEMA 3ZOAA 7CGTA 3AIWA 1JNEA 3N1AA 2CBUA 1E15A 3CHEA 4OIFA 3ECQA 2VOTA 1ODUA 1EO5A 3BUQA 1ITCA 2VC9A 1RD6A 3DX3A 4H8HA 3CZSA 2EO7A 2EPKX 4P7RA 2VVSA 2XVPA 4MDPA 2EBNA 3VMOA 3NSXA 1UKQA 4CCEA 4JHOA 3ZIZA 5D9PA 5HDRA 3AIVA 5HXMA 3EYPA 2XFYA 2VZVA 3CUGA 2EPOA 4DO4A 2OYLA 3MUIA 4MNKA 3TA9A 3WUFA 3ALGA 4E8DA 5BWFA 4UQCA 3EJQA 4CKQA 1UR1A 2O9RA 2J7EA 2W61A 5E70A 2FHCA 3PZQA 3AZTA 1VJZA 3SUWA 4C7GA 4IM4A 4BQ2A 3WH6A 1BTCA 3QHOA 3OA5A 1W9XA 2WK2A 1NOUA 1G94A 4KH2A 1H09A 3MANA 2WLYA 1EO7A 4PMQA 4PTWA 3N13A 1JFHA 5CJ5A 2X09A 1WPCA 3GXNA 1F4AA 5BCAA 1EHNA 1J12A 4AMXA 1JIBA 1G9HA 1HX0A 1BYCA 1KQZA 5AC4A 2OW6A 2WKLA 3KLLA 4AZGA 5I79A 1XYFA 4CCDA 3WFLA 5EMYA 1OBAA 1IT0A 1W3HA 2VZTA 3VIGA 1XD0A 5CQ1A 3TTSA 3W29A 3BLKA 3WQ4A 6CGTA 2ZXAA 1WDSA 4U33A 2YL5A 5ABEA 1JF6A 2VJXA 1E6PA 1NOWA 1R87A 2CITA 3KL0A 3WQ8A 1DWFM 1OM0A 3FY1A 2XGIA 3WD4A 1E70M 3U7BA 3SCRA 3GXFA 1R75A 1BGAA 2Y8VA 4BZYA 4M8UA 3KWXA 4ZFMA 4AEFA 2XM1A 1CDGA 4LPCA 1QW8A 5EFFA 1W9DM 3CMGA 3RCNA 7A3HA 3AIRA 1IZKA 4FMVA 2ZOXA 1SMAA 1PZ2A 3SIMA 8CGTA 4WSKA 4MB3A 2DH2A 2FDMA 2ZUTA 1PJ9A 4UR9A 1VIWA 4A3YA 4E2OA 1R33A 3WDQA 4H8VA 3OG2A 1CLVA 1ISZA 4D6CA 3GH4A 4BQ5A 4ACYA 4WF7A 1V6YA 1FHDA 3VVGA 1Q6FA 2ZX7A 3DX1A 4GZJA 3VX0A 4J3XA 2UY2A 3AHYA 5JBFA 1CTNA 1QI3A 4NX0A 4GIAA 3MSGA 2JEQA 1Q6EA 4MB5A 2FYVA 2YL6A 1R8LA 1CBGA 1HKKA 5FOOA 1J11A 1UZ4A 4JCMA 1XRVA 2J7DA 2WC7A 3AOFA 3B8SA 1WZMA 3AROA 5I0DA 1H41A 3A23A 1RP9A 4HMDA 4MB4A 1BQCA 4UNIA 1C7TA 3CZEA 2J8FA 4U5KA 3VDHA 3OLGA 2YA1A 2CBVA 3AHZA 3RDKA 1WZAA 3SCUA 3OZPA 5A6KA 3RILA 4AZIA 1JDDA 5KEZA 3AIBA 3LPFA 1VFFA 3CZJA 3WDIA 5IHRA 2WVVA 3KZSA 4M56A 3ARQA 3I3BA 1HTYA 3EDDA 3WN6A 1QNQA 3N12A 1ZBWA 5HOSA 1HXKA 1HVXA 2WZEA 1UR2A 1X6LA 2E0PA 3L2LA 3VIIA 3UG4A 1W1PA 5ABGA 1PIFA 3CTTA 1KXTA 3THDA 3ZJ7A 5ECUA 2OSWA 3W28A 4PUEA 5CXPA 1RPKA 3H53A 1N82A 2YA2A 3PZNA 3HU7A 4CD7A 1PAMA 4C7DA 4D71A 3TTQA 5LA0A 4U3CA 4JCLA 4D6IA 5EBAA 2Z1KA 3VD5A 1US3A 2YLAA 3T0DA 2X2HA 2GJPA 1JXKA 3EMZA 1E6ZA 5GNYA 3CZNA 3WQWA 2O9TA 3AISA 4M80A 1MQRA 4S3KA 3W0KA 1H0IA 1E6NA 3U5UA 1B0IA 1FFRA 3WL1A 1KTBA 3BLPX 3OZOA 1ODZA 1W9PA 4UFIA 3EJTA 2YJQA 4J3WA 1OGGA 1EHAA 1CLXA 5CGMA 4CN1A 2OWCA 2D22A 2F7OA 2PWHA 3PZOA 4KGLA 3MSDA 4W88A 2VO5A 2VRJA 4OZOA 3WDRA 1GQLA 4DWSC 2W92A 1HT6A 3SUUA 4HA1A 3PZTA 1B3ZA 1VEMA 1XHGA 4UFLA 2VRQA 3WH7A 4DUVA 4W5UA 1A3HA 3EDKA 2JFEX 3BUDA 5E09A 3GXDA 4HPHA 2FHFA 2E40A 1HN1A 2DIJA 2VR4A 3L4ZA 4W8BA 1GQJA 8A3HA 1J0HA 1PPIA 1MXGA 1WAWA 4PMUA 2G3MA 5HPCA 2X8RA 4NSBA 4B9ZA 2RGMA 1E43A 4A4AA 3ARYA 4R27A 1UR9A 2V5CA 1A47A 3OGSA 3D4ZA 2CCRA 2D23A 4XUYA 4P7LA 1W3KA 4E8CA 4FNTA 1HP4A 3TOPA 3OLIA 1JYNA 1P6WA 1TFVA 3OB8A 1SYTA 4W7WA 1UD4A 1OSEA 1DWIM 1W1VA 3AXXA 2J25A 2PWDA 2BHYA 3EDFA 4ZXLA 3BVVA 4OKDA 3VD3A 1UA3A 1XSKA 4PMDA 3SURA 3CO4A 1UWUA 2PB1A 7TAAA 4ACZB 3BGAA 4F9DA 4KGJA 4P7NA 3ZO9A 2XGBA 1HKIA 1BLIA 1VENA 1QWUA 1T0OA 2RGLA 3UCQA 1V3JA 4PN2A 1HP5A 4UOZA 3GBEA 3G6MA 5HNNA 1JZ8A 1K9FA 1AQHA 3W37A 3VGEA 3VIOA 1ZB5A 2XVGA 3AXHA 2ZE0A 1GHSA 3RJXA 1R86A 3AYSA 4EKJA 3A4AA 5C71A 1HJWA 4H2CA 5M5DA 4UZSA 1E6RA 3DHUA 3CUHA 4YPJA 5DEZA 4AD0A 4D72A 1V0KA 3IJ7A 1Q6CA 2GFTA 3J7HA 3PTKA 5D9OA 3WUEA 1UKOA 5A8NA 3APGA 2VZUA 3M07A 2XM2A 3UEQA 2EPMX 3SCOA 1BF2A 1FP9A 4AC1X 2GJRA 4GQRA 3HJEA 1DWAM 4HMCA 4B16A 4OGZA 4D6HA 2VCAA 4AZCA 3AI0A 3IAQA 3BSHA 3BCFA 4AZ7A 1GOQA 2BVTA 3VKKA 3BAWA 2XPKA 1E1FA 3GXTA 4UQ9A 2YA0A 3CHFA 3WMCA 3IK2A 4PMVA 1JXJA 5E0FA 1O7AA 1BYAA 4AZCB 1KCLA 3VPLA 2VCCA 3WD2A 1ISYA 1VF8A 2YBUA 2DIEA 5CG0A 4RE3A 4X0VA 3F5JA 5E6YA 2YL8A 4MDOA 1W3LA 1XCWA 5ABHA 3RO8A 1YHTA 2PF0A 1JDCA 2NSXA 5I5RA 1V3LA 1MW0A 3LRKA 2DGAA 4ML4A 2IXVA 4UFHA 4DO6A 3UG5A 1EGZA 4KRTA 2XIIA 1V02E 1W1TA 4FNPA 1QWNA 1MXDA 4AD4A 5BXSA 1H5VA 3SCPA 1CXFA 1UA7A 3CBWA 4UFMA 4ZE4A 4IPNB 3WF4A 5CSYA 1LG1A 1E0WA 2FHBA 3UR8A 1YQ2A 3D5HA 4GI6A 2YKKA 5M03A 2XUCA 1OGBA 3PZGA 2DT0A 1WO2A 1UR8A 3CHDA 3VIFA 2D2OA 1DWGM 3CGTA 3IANA 4V27A 2WZIA 1BAGA 1CXEA 4J3TA 3BXWA 3UETA 5I78A 5BYWA 4MNJA 3VILA 1OIMA 4TTUA 2FH8A 4W84A 4CVUA 3WF1A 1GOMA 4V28A 4FNRA 1KWGA 3VX1A 4UOQA 5IXEA 3PZ9A 1AMYA 3HG2A 2XFRA 1TQSA 1E6XM 3TP4A 3ARVA 2WBKA 2XHYA 4YHEA 1XH1A 3CUJA 1R85A 1UQYA 2F8QA 1H3GA 5CLTA 1KTCA 4DWSB 3EDEA 1UR4A 4W8AA 4KMQA 1PS3A 4JFTA 2BXYA 1WDQA 5A95A 1G1YA 1EOKA 1C92A 1ESWA 3AHXA 3NYDA 1W9BM 1H2JA 2ALWA 1V03A 2D0GA 5A8OA 4CN4A 2PWGA 3A47A 5A94A 2WCGA 6TAAA 3L4TA 3GZAA 3A4WA 5C70A 4CUCA 3BSGA 1GPFA 1V6XA 1QNRA 4QP0A 1FH8A 1CGTA 3H54A 4WSJA 4AD5A 1E5JA 4HOZA 1KGUA 1QI0A 3A21A 1FH9A 3GBDA 3THCA 1B30A 1AVAA 3MV11 3SCNA 3RPMA 5A6BA 3E1F1 1VFOA 4Z2HA 3BVXA 2IGTA 4AEEA 1JL8A 3I3EA 1UWQA 5D9MA 3BAYA 2PBOA 4TUFA 3PBGA 1TUXA 3ARZA 2VR5A 5D9NA 4PMYA 3DDGA 3ARXA 2JEPA 3VO0A 1J18A 3GNPA 4W89A 1QHPA 1GQIA 5FCZA 2XFFA 2J7BA 4FLQA 1BG4A 3CUIA 1TQVA 2OWXA 3SUVA 3WNNA 1CGVA 2V3GA 3K8KA 1TQWA 1VFMA 4DO5A 2WVTA 1E56A 4AZHA 1LL7A 2X1IA 2VTFA 2J74A 1PX3A 1E0XA 5JBEA 5CPQA 1LQ0A 4LGXA 3WQVA 4JL1A 3T2PA 3GXMA 5CLWA 4UTFA 1FP8A 4QCEA 2DPEA 4D6EA 3AZSA 2CBJA 2PI6A 2UWFA 1BG9A 3EJUA 4WK9A 4AIOA 1BSIA 3AS1A 3VIMA 3VOCA 5I3DA 4WIWA 2EPNA 1NM9A 1GCYA 2GK1B 2CHOA 2QF8A 4M1RA 3ARTA 1XV8A 2VNCA 3MMUA 3SCSA 4F8XA 4MPKA 3GTNA 2BY1A 5CZKA 2WCSA 2G41A 3WUBA 3BVUA 1C93A 3WY2A 2DQXA 2WWDA 3VDAA 2Z1SA 1WZKA 1LWJA 2VX4A 3DYPA 3BVWA 2F2HA 1HJVA 5KZ6A 2GVYA 3VU2A 2CKSA 4PMOA 1U30A 3WL0A 4YN5A 2G4FA 4GI9A 2XN0A 4UQBA 1UYQA 3A22A 3VMNA 1HJQA 1LLOA 1NWTA 4CU6A 2X0HA 1H4PA 2J7HA 1OT1A 3N04A 4K68A 4W86A 2WMFA 1NWSA 5IDIA 3CZGA 2WHKA 2DSKA 3ARSA 3FXYA 1JZ5A 2W63A 5BROA 5JIPA 1JD9A 3T0BA 2JF6A 2W5FA 4Z2IA 3AMLA 3TV8A 3EJRA 3VGHA 3DX2A 1BYDA 1G01A 2CKRA 4TX8A 2A3CA 1EA9C 1W91A 1B3YA 3T2QA 4F79A 1R34A 4HPGA 1I1WA 4H04A 2YFNA 3ZMRA 1E72M 3PZUA 4EE9A 1TE1A 2E9BA 3QHMA 2F18A 1CEOA 5GPRA 4AD3A 1BVZA 1QBBA 2WHJA 1XSJA 3QGVA 2GSJA 3WH5A 4XZBA 3HZ3A 3AHTA 2BY2A 3CIVA 1JGIA 1EOMA 5AYIA 2E9MA 2F1BA 2XWEA 2WPGA 1US2A 1TCMA 1TG7A 3CV5A 4JFSA 2YIHA 3W26A 3D3AA 3EJSA 4Q7NA 3FHQA 3S2CA 1E9LA 2VCBA 3CZKA 2WMIA 1TA3A 5A6SA 4HA3A 3BMWA 2ZXBA 3VNYA 2A3EA 3AICA 2J7GA 4W7VA 1KGXA 1E71M 3LPPA 3LXCA 5EB8A 1R46A 1QI4A 3H55A 4PMXA 1GJUA 2UY4A 1GORA 1TA3B 1BVNP 1FOBA 1MW3A 2J62A 2WHMA 3EMCA 2BY3A 4PCTA 1LL4A 2D1ZA 1MFVA 3DYMA 5FL0A 2F7QA 3L4XA 3WQ5A 4M29A 1HIZA 1SZNA 5A8MA 5C8BB 3RM4A 2ZX8A 1R7OA 1ITXA 1QNSA 4AD2A 2ZX6A 4NXKA 1JAEA 1C8YA 1J0IA 2V38A 4MJ4A 3VIJA 4MNLA 1UKPA 1JI2A 2E8YA 4NZCA 2G3JA 1L0PA 1CYGA 3S5YA 1W1YA 4B15A 4PBGA 1CECA 2AOSA 4J27A 2WSKA 3PZIA 4JKLA 1H11A 1RP8A 3DHPA 4FLOA 2DSWA 2CEQA 1UUQA 2EXOA 2VRKA 4J28A 3N11A 3G6LA 1B90A 5DT7A 3GYCA 2EABA 3AMKA 4E4PA 2E4TA 1HL8A 2HISA 3IGUA 2X0YA 5DO8A 1ZBVA 3A6OA 4JIEA 3AZRA 2QHAA 2XG9A 3ARPA 3A4XA 5FL1A 3PTQA 1O6IA 3WEOA 2VUYA 1I75A 1QHOA 2BHUA 3NUKA 3F5KA 2A3BA 1GOIA 1QNOA 1SR0A 2VL4A 1C3FA 3WUGA 2F61A 4DWSA 1Q6GA 2CERA 3W82A 4HZ7A 1L8NA 2D20A 4XX6A 1V0MA 1W2VA 3IJ9A 2DSUA 4BQ3A 1PX4A 4PYSA 5CSUA 3W81A 4DUXA 1MW1A 1KBKA 5A3HA 2VQUA 3QHNA 2WANA 5D8WA 1B3VA 2ZUVA 4OOUA 4J3UA 1E4NA 4JHZA 1W32A 1HJXA 4AMWA 4PMZA 5DT5A 2EJ1A 4UQAA 4AIUA 4LYPA 4NRRA 3AMGA 1CXLA 4V2XA 2ZXQA 1W9VA 3RMEA 3VNZA 1E3ZA 2CESA 4DM2A 4W85A 3PHAA 1HWWA 1BHGA 1JYXA 3SCTA 4PTXA 4QLJA 3M46A 2XJ7A 2ZWYA 1O7DC 1SMDA 1NARA 1MQQA 4J3VA 1KR0A 3AHVA 2A3HA 1CGXA 1H0GA 1V6UA 3BLBA 5A2AA 1B9ZA 3BAXA 1CXHA 3ZM8A 3L4VA 1VB9A 4AXNA 1IV8A 3VSTA 1E3XA 3MO4A 1UG6A 5HBFA 3POCA 4PSPA 4AW7A 4HMEA 1GZJA 1QVBA 2WVUA 3D52A 4BS0A 3K8LA 2VZSA 1UWIA 2E8ZA 1E4LA 4NRSA 3WMSA 1NOFA 5ABFB 1UOKA 3VSVA 2BY0A 3BAKA 3WD3A 1VEOA 4OBRA 2MANA 3VSUA 1D7FA 4IUGA 2NT1A 3L4WA 4H7VA 1XD1A 1VFUA 2GUYA 3WFZA 3WNKA 4ZEPA 2G8ZA 3MUZ1 1CNVA 3MMDA 2OWWA 3BUBA 1J0JA 1E1EA 2O9OA 3WH9A 1ZS2A 5A6AA 2WVVB 4N42A 2ZWZA 1B1YA 4L4OA 1E5NA 1TMQA 1LF1A 1Y7VA 2WWCA 1UASA 3AYRA 2WZHA 1TVPA 2JALA 3GNOA 3II1A 1R7AA 1E40A 3LRMA 2VQTA 3W24A 3CLWA 3CZ8A 4Z2GA 4BCEA 1XH2A 3U7VA 3WY1A 4H8UA 3VMPA 3AMCA 5JBDA 2Y24A 1J10A 4Z2JA 5I24A 1NWUA 4S3JA 2BHZA 5IFTA 3CC1A 2NW0A 4AZ5A 1GONA 3LPOA 3VIHA 3MV01 2UY5A 4TVUA 2VX6A 5A6LA 3AS2A 4MADA 5I77A 3L2MA 1XYZA 1XC6A 4IPLA 1X1NA 3GH5A 3VDBA 4QDMA 1V6WA 3U5YA 3N15A 3BUPA 4JFVA 4CU8A 3OLDA 4FF5A 4RL3A 1JNDA 2AMGA 2CPUA 5E1QA 2CNCA 1WKYA 5D4YA 2BS9A 3SCVA 1TVNA 1W2PA 1J0YA 5E6ZA 2XTKA 3WEZA 2DT3A 4WKAA 3W6LA 1UZ1A 4UFJA 1CIUA 2C7FA 1K9DA 1D2KA 3VINA 4EK7A 2QPSA 3WSUA 3K8MA 3VTRA 2ZX9A 2E3ZA 4LYQA 1JZ3A 3LXBA 2C8NA 1X6NA 1EH9A 2EADA 2WW5A 2J79A 3CH9A 4FK9A 3WBAA 3IAPA 3UG3A 3GDBA 5AYBA 2WAGA 5HPOA 5E0CA 2VMFA 2CYGA 4HOXA 4B3KA 1ZJBA 4MAVA 1JF5A 1TR1A 2A3AA 3EDJA 1K9TA 1EDTA 5A1AA 1GVIA 3BH4A 4D6DA 3ZT6A 4OJYA 4NI3A 3ZR6A 3WKZA 3NSMA 2GK1A 3HG5A 1GW1A 2WHLA 2JE8A 4GO9A 2XN1A 3POHA 2FGZA 1UWSA 4CD8A 2WMIB 1CPUA 2ESCA 4OUEA 5AY7A 2XYLA 4A3HA 3QOKA 4X0NA 4FNSA 3NJ3A 1PZ3A 3FW6A 2FE0A 3SUTA 1JI1A 1FFQA 1MW2A 5A6JA 3MS8A 1KWKA 4J7RA 1E6QM 4L4PA 2YDQA 1V0NA 4QAWA 4Z2KA 2GJXA 2PWEA 2F7RA 3AJ7A 3FN9A 1VRXA 1HKMA 4HA4A 1V6VA 4TOQA 4UQEA 4HP5A 1B3XA 3VGGA 5LA1A 5FD0A 5A2BA 3PZVA 5BXTA 1V3KA 2UY3A 4AD1A 3PTMA 1K6AA 3M6DA 4QLKA 3D51A 3PZMA 3EMQA 4AYSA 4D6GA 4FLSA 2YOCA 3GNRA 4PSRA 2WMHA 1QX1A 3RM9A 5A8PA 5A2CA 5BRQA 3UR7A 4HZ6A 3DX4A 1UQZA 2BNJA 2Y2WA 1HNYA 2YDSA 3KLKA 4NZFA 3DYOA 1NP0A 3W6MA 1GNXA 1WE5A 2NT0A 3HN3A 4QCFA 3F4VA 3OIHA 2DDXA 1KCKA 4TX6A 3RM8A 2TAAA 2BVYA 3EJPA 2XVLA 3WELA 3RJYA 2CXGA 2OSYA 2J7FA 5AC5A 1OB0A 3FHAA 1Q6DA 4DM1A 3K4DA 3ZQ9A 4U2ZA 2D73A 3LPGA 1KGWA 2CETA 2V3FA 1KXVA 1J0KA 1JG9A 5BXRA 1ZL1A 5BRPA 1JD7A 1NWRA 2BV9A 2OYMA 1B2YA 2OYKA 1VBRA 4LX4A 2W4XA 1WDRA 5GQBA 4R5EA 1W3JA 2J75A 1GOKA 2ZUMA 1DHKA 3KEHA 4BA0A 3FAXA 1KB3A 3F5LA 4U5IA 3K46A 4QLLA 2Y5EA 5LYRA 3WY4A 2DH3A 4HOWA 3GH7A 2QPUA 3VGBA 2DT2A 1K9EA 2F1AA 1GVYA 1M7XA 1GOOA 1LL6A 1UD5A 2F7PA 3K1DA 4WKFA 4AWEA 1E73M 2JIEA 3MKKA 4CD4A 4GI8A 2IUZA 2ZUSA 2D3NA 2EPLX 4HU0A 1S46A 1UH2A 2WMKA 1EDGA 4J3SA 4AYGA 1QW9A 3NDZA 3OGVA 1V02A 3LRLA 3ZSSA 3CPUA
chains in the Genus database with same CATH superfamily
4TMBA 1BGGA 4WFFD 2H6OA 3LI1A 2F6UA 3NFPB 2AV1B 2F54E 4OGYH 5GRXG 1ANUA 3T8XB 5FKYA 4NFBA 5G2WA 2DSZA 2HMCA 6A3HA 2W59A 4R4FH 3DX7B 1CT8A 3LX9A 3SDDD 5DF0A 3HG1B 4XK2A 3QUXB 1FO0L 4PJ7E 5F89B 1KCBA 4OBSA 5BRZD 3SZ6A 1E0UA 2VEIA 4IMLA 1H1NA 1WV2A 4IJRA 3TYUA 2J47A 4KQ4H 2Y5TA 4GSDH 3VXOB 5KSAB 5M94B 2PGEA 2GC4C 4HAKA 5IMMB 4RA0C 3KHQA 1UZ6F 1IR1A 4K5OA 4QHPA 5CMAB 3IK4A 4K94H 4X9IA 3W2UA 3VNIA 1IR2A 3VM7A 5CZVL 3QQ3A 1SJAA 2B7PA 3FC8A 4U1IA 4UTBL 5M3WA 3ALFA 2FH6A 5ICUA 1FH2A 1NFDF 1H7WA 3EFOB 3KBFA 1D3GA 3MZNA 1HSBB 2WO3B 1OAJA 4BYHA 3U2EA 4LLDB 1NGQH 3H2OA 4NQCE 1U8MA 1RIHH 3QJQB 4PAZA 4JZOB 2VI0A 2OULB 2EG7A 3NG5A 1J5IA 2XSBA 1ZJAA 1CWYA 1QNVA 1HL5A 5DUBA 3B9KB 3BN3B 4FTVA 1NOAA 5DWUL 1KO0A 3OGCA 3DECA 1EB3A 1FE8L 2XFXA 4ZFZB 3M64A 2VELA 2ZUUA 5AVSB 3BX7C 3FDGA 4GZEA 3X1NA 1AZCA 4ZDHB 4QQ3A 3EOUA 1URLA 1P1ZA 3FOMB 3GMLA 4NZJA 3ZHLA 1M3UA 3EB4A 3KWWB 1NEZG 3UYOD 2OLHA 1RJZB 3IJ8A 2NY3D 1BKHA 3EH2A 5HD8D 3RVVD 5CBAB 4Z95H 2Z1WA 5J8LA 3G5YA 5HYJA 3FA3A 3TBTA 4IDLA 4FQJH 2A9NL 2J88L 5RUBA 2MJWA 3QB7C 4CQAA 3QS2A 4LMQI 1D9KC 2W07B 4HK5A 1SXCA 4W9JC 4XV0A 1EIBA 1HKFA 5T5FA 3ZJ8A 1ITBB 1QI5A 5ECJE 2A73A 3KPMA 1X5LA 5HHNA 3TDFA 4XAFA 1W0VB 4PMNA 4JFFA 2NY4B 1JPMA 4K5LA 3U8GA 1UVQA 1AS7A 3DWTA 4YHYB 1CDJA 4HWNA 2EQDA 1OCWH 2QMJA 3HKZA 3QJVB 2J4GA 5C6MA 1VACB 5E2WL 3RTQB 2CJUL 1XHHA 3ILPB 3WY3A 4BUGA 1DXIA 2FX9H 1MSPA 5LBGA 1LDCA 5IFPA 2JELL 3QUZA 4GUFA 5T9CE 8XIMA 3N55A 3PXLA 1YUHB 3UZJA 3T4WA 1AS6A 1XL6A 1ZOXA 3R2GA 3KWTA 3SYCA 3HZMA 1WEJH 2HJLA 1WCGA 4JVWA 4N2YA 5C2GA 2C0AA 4QGTA 1XMWA 3N19B 4BFAA 4M1DL 5CD3A 2H3NB 5J04A 2B31A 1PTDA 4KKNA 1CR9L 2R6OA 5D04C 1EYWA 1VACA 5FX3A 4DWDA 2BSBA 2GCYA 2OJEA 4XWUA 2Y1ZA 1E4JA 3U0HA 4MNGB 2PLKA 1HDMA 1A6TA 4PJFA 2PLMA 3HI1A 3VFUA 4ZMQA 3KH3A 4Z2LA 3CCHA 4RDQF 5E4AA 2NCEA 2PAJA 2ZSVA 4M5ZH 2XTJC 2WZ5A 3MBEA 4Y9GA 1BVWA 1JPGB 4QRUB 1BBDL 3FUEA 3O81A 3P4NA 4PHXA 2X05A 2CO3A 5IHUH 3T4AB 3VXNA 2ETWA 2PDBA 1FNGB 3UWUA 4GY7A 1XTMA 1NPNA 1SJEB 2H9GB 4OGXH 1CE1L 1CZ8L 3HHSA 2Y69B 3LLFA 1G7QB 4JFUA 4M6ML 4MA1B 43C9A 5I2IA 1EXBA 1HJUA 2NQLA 4RV3A 4L56A 3SFWA 1RIVH 3AWNA 1CDIA 1DDTA 2G0WA 4I6VA 2VVNA 4FMKA 4LCYA 4ATDA 4F66A 3O6KH 2J7CA 4MD5B 3HB3B 1Z8AA 3ZT7A 1JPGA 4QRUA 4ABWA 3RWFB 4LVOB 3D3VE 4NM8L 2XHNA 1CENA 2IKJA 1A6VL 1GKEA 3JUGA 4HK0B 2QDGA 3YPIA 2JIWA 3GZKA 4NYLA 2EEBA 3MFGB 1JVLA 3VUAA 4JIIX 3QN3A 5EU7C 3HE6D 2QT3A 1WOBA 1JGUH 2JB6B 1JMZA 2DMHA 5ALCH 3ZDYF 4QRRB 3HAEG 4LYRA 2HLEB 2NNXA 2BO0A 5HGBA 2JTYA 1W6TA 3FK3A 1E2ZA 1PD0A 1UD6A 3I9GH 4NKIL 2DPKA 2FBRA 2VCAA 3OWRA 1Z89A 3N4FA 3QIBD 1HZHH 3VRLE 1D2PA 3BCDA 4Y4HC 1JHKL 3P5ZA 3BSZH 4UUJB 1EZUA 1WYJA 4P2CG 2DQ6A 3UPRA 4TPRH 4UT9H 4P8XA 1SVDA 3T0WA 4EVZA 2IQAA 4OSUH 4DIXA 3FGCB 5I1JH 2PNDA 3W1ZA 4B2DD 1FVEA 3CFUA 4URTB 3SZ8A 3ZL2A 1JRHI 2CXKA 2X4QB 3CMOH 5I1IL 1K5WA 3NSNA 4G7YH 3MV9B 4IBTA 3V4PH 4KFNA 2IAMC 3UTSD 3QZBA 1GZQB 1TR7A 3V5CA 3H4FA 1W54A 5EGRA 4EX4A 1YDNA 2E75C 4JDYA 4URIA 4IL0A 3DENA 1AD0B 4RMUA 1KYDA 4CVWA 4ZVJA 2IMMA 3LEXB 5HHPA 3SEPA 1W1A1 3R5EA 1ADWA 2DLEA 3LRGA 4RE0A 3GI9L 3UAJD 3RLHA 1CBJA 1UYWH 5HQMA 1MWAL 1A1NA 2P5WD 3CZLA 4K3GA 2DIKA 3LCXA 4Z77B 1S5NA 1F73A 3GBNH 1XSIA 2DY2A 2LU4A 3VD4A 1JWMB 1IAIL 1WZLA 4UDUA 1M1SA 1QA9A 5K9XA 1A0QH 3WIFA 4ZA0A 5E5MB 5INDB 1J8VA 3IVTA 1Z7JA 4JM2F 1ET5A 4C6FA 4U1HB 4ZQTA 5MP6H 4NAEA 2WV8A 4QGYA 4FI4A 2YAFA 2X70B 1M68A 2FGWL 5EFIA 5AVVB 3EFFB 2RIKA 1TPC1 2VDOH 1SSGA 1LWHA 4U6TA 4QRPA 8TIMA 4TNWF 1I85A 5HDBF 1YVLA 4P57B 4KKPA 5SWZD 1KCRH 1U3ZA 2WB7A 4N8VB 1BXNA 2AAVA 1SM3L 1UWRA 4N24A 1V3IA 3QFWA 3ARUA 2TYSA 3NRQA 1XIHA 1S2VA 5LIUX 5AW3B 1GPOH 4DZ8A 4KIRA 3OPSA 3QQ3B 3PFQA 3QV7A 4IGMA 2ZWNA 5I8EA 1AXSB 4XOBA 2G3IA 4N2BA 3W1NA 4PD4K 5E00A 4G6AC 1P7QA 4MMYB 2WXJA 1X7SA 4WNQA 3UJFA 2IBZY 4Z7VB 1R19A 1A4JB 1OP9A 1UFGA 5ENWA 3HUJF 2VLMD 2X10A 4JRYA 3CVHA 4NQCA 3T2NL 4X4ZA 3GK8L 3NA9L 4MXQC 4DTGH 3P81A 3XINA 4E4FA 3UJJH 4IDJH 3FRPG 1LT7A 3MV9E 3MGOB 1KZQA 2V2WB 3WD0A 1MWOA 5B38B 5BQ7A 4X60A 2I7SA 3HE7C 3H8NA 3OKYA 1M53A 2KUTA 1P9MC 1QWHA 5C3IA 4CGTA 1RJRA 3HV9A 3O9NA 4XAZA 1HEHC 4A6YH 5C0IA 3OXRB 4RW5A 1QFWL 1XZ0B 4KH9A 2AQNA 2BNQA 4J4PC 3KWWA 4W9GC 4UCFA 3QEGH 1P5VA 3W27A 1V27A 1A5CA 3QVQA 1A9BA 1AKJA 4G9FE 4LZKA 4YDJA 1MEIA 2GDUA 4GY0A 1FYTA 4ZUTA 2JGYA 1YY8B 4UR8A 1YEEH 4RSVA 1P1XA 3NOYA 1V0LA 1J8HE 1JDAA 5F9AC 1J9YA 3W71A 2JJWA 1GHRA 1NSJA 3GU9A 3W9ZA 3DXAA 3M0ZA 4XO5A 4AYBA 2A5UA 2W07A 3QG6A 4JFWA 1ZTVA 4GJJA 4X80H 5DUMH 1QYGL 4M7JL 1JDFA 1JHLL 4Z78A 2UXGA 2K9UA 1F07A 4JN2A 3T65B 2R0KH 5DMYA 4AE1A 3GZ3A 4MMZB 5GS0D 4KK5D 2F8VA 5EUOF 3P0VH 1ICPA 2WQXA 1GVEA 1VD6A 2R1LA 4ZI8A 1SPQA 4AQ1C 5JHBA 4L6HA 1RUAL 2ZXWB 5L2JA 3CT7A 3NACH 1ZCOA 3TSMA 2E4FA 3O3DB 4GQPH 1YTKA 2IH8A 4PRHD 5DHMC 5HJXA 2XIBA 4I3RH 3R8BB 1V54B 3FUKA 3U4EA 1Z9AA 4M93C 1RZ7H 1P9MA 4Z7VF 4OZGB 2H9AA 3N34A 3AXLB 3CFQA 5HY9A 2YLHA 5D02A 3QYQA 2BNUB 3GSOB 4MTMA 1MIEH 4OD2B 4YOKA 5GS2H 2A77L 2R4RH 4NO0B 1EXHA 3WMBA 5PTDA 4YJZL 5C2CA 2ISDA 3PTDA 3WDHA 2XWXA 4GQ9H 4DAGH 4UTAL 3WLJA 1GYVA 3ZUCA 1JDEA 1R9YA 2OZ0A 4MAYB 5I1CH 3GI8H 5LGHH 2XSAA 4I2XB 4Q4EA 4XN9A 1LBLA 3TVMC 4W81A 3UESA 4AZ6A 3C5ZD 4U7MA 3VD7A 4RZKA 2OZTA 4PLKD 3LEVL 3W73A 1XX1A 4U1JB 5D2XA 2Q8AH 1S3HA 1F6AB 1W8NA 2BWIA 5B39B 2YB1A 3CXDL 4WY0A 4ZQRA 1GUVA 1AZRA 1IEHA 3GB7A 1U3HB 1PQZA 2H6PA 4Y16A 2QL1A 1QBAA 1WBZB 4JFED 3VFGL 3L5XH 4NQSB 4PJEF 4DGIL 2WMGA 5EL1A 3ZLGA 2YKLL 2XRAH 3GMRA 4OLZL 2ESVA 3OZ9L 3D85B 4PGDA 3RR1A 5IKCA 1OCQA 3HUJA 4XPBL 4QEHA 3M44A 2A6JB 1KYOJ 3P73B 4XTDA 3S3BB 4ZL1A 3GBNL 3WNJA 1I2QA 1OADA 4AIEA 4OVXA 3UGUA 4NKOA 1RVGA 4O14A 4MMZC 3ZE1F 1FJ1B 3BIAX 4KK6C 5F2GA 2DJ4A 1U3HD 1WBXA 3LZOA 2YR3A 2R29A 3N1QC 5CU5A 4FOJA 1U4FA 1YNKL 3QIWB 3KRZA 3TONA 1INDL 5ES4B 5E9DE 4Y16B 3C5JB 4TLTA 4ADJA 4BE5A 2XU2A 3CQ0A 1JPSL 1F56A 3T1FA 4BM7A 4C56B 1W17A 4GJIA 1ECEA 3NCOA 1XCXA 4KI5F 1ECYA 1TTGA 5CPOA 3NIYA 2R0WL 4TUJA 3NL5A 1B0RA 2DTML 3EGDA 4M1GL 4QFUA 4EQ3A 3I2CL 4IXHA 3KW8A 1DQDL 5E94B 1I31A 1IEBB 2OL3A 2O6FA 1IIIA 4JAMA 3UACA 3LCFA 2XH7A 1HHJA 3JQOB 4EUPB 3ZXWA 1MJ7L 5IJVB 4KEVA 4PFHA 4GINA 4ODVH 4JQ3A 3LXAA 4BK4A 3U2CA 4KKXA 4JQVA 3WQCA 1H8SA 2JKTM 4KI5D 3DO4A 3MCLH 5CPLA 1R3VA 4Q8PA 3ROLA 1YEFL 1YN6B 4QHMA 3BL3A 3QUYC 2HT2D 3NPSC 4FP8H 1WIPA 2PR4L 3LKSB 4ZOCA 5E94A 5EU6A 4D1JA 3UWQA 3FO1A 1USQA 3KL3A 4E3VA 3V36A 1EFQA 1SBBA 2DMKA 2EEXA 1X5IA 1LEKA 4ZMWA 2ERJC 3NN8A 5DFAA 2VGIA 1BZ9B 1UWEL 5DJ2A 1LEGA 2VISB 3TWCH 1FWIC 3MMEB 5FOJA 1M6OB 1UACL 2XINA 2Z28A 1KRCC 4LT9A 1HH6B 2ZOLA 4BFFA 4KI5C 5FEWA 1RZJC 3D0CA 4ABVA 3D50A 4L8SB 4LAQL 4KRPB 2C5DC 4NFDA 1QSFB 2FYYB 3NJGA 4NUGH 2GJZB 5E6IA 5I76A 1OY0A 1I9RL 4N5EC 4RXGA 3R89A 5IVZA 3AMDA 1M6UA 4J5NA 1MCEA 1Q38A 1O6VA 5JORB 2YD5A 1C8XA 2AJVH 2FD6L 2MTAA 3TNNA 1PD1A 3FTVA 2DEXX 4XNDA 3O2LA 5DC0A 4EXPX 4K71C 4WJXA 4PGZA 5DRNB 3SN4A 2XWTA 1NBYA 1TWSA 3BUTA 3V55A 4G8FA 3V0GA 2N7BA 3F7VA 1UWSA 4JW3A 1U2YA 4X7TA 1NGZB 3MLTB 1YDPB 3SOTA 4KCVA 4P8UA 1KGCD 4IEFB 4XNAA 3EFFA 2ZTJA 3STCA 1L9OA 4D8OA 1U8IB 5LBSH 2W65B 2XFXB 4F2MA 1OP3H 1C90A 4XT1C 3TJHD 3CDZA 2NR6D 2IH9A 1TF4A 3MAWA 4ANWA 4FXLA 3ZQWA 1FAKT 2AV7A 1PCXA 2O92A 3F62A 1A7PL 4FLRA 3OKNB 4Y4KC 3UVIA 3OZYA 4PVLA 5CEYA 4IOFC 5EV7A 5KANG 1E4IA 2PCQA 1NBYB 2O26U 3LMYA 3QEHB 4D6FA 2ICEA 4Q9RH 4LRTA 1GGBL 1MDTA 1NGZA 1A0EA 3JSSA 1QZ1A 4ICMA 4C6DA 3IFNL 2WNGA 3B9DA 2E59A 4MYPA 4N0UA 3G1DA 4M24A 4F8PA 1NDTA 1MDAA 2FKPA 3SGKC 3TJHC 1OD0A 4C6KA 4GQZA 4NRYA 1TCRB 1DZBA 5A6IA 1JZGA 1T0MA 3MI6A 1WX0A 2QLYA 3MCKA 3BUIA 3PGDB 2R69A 2OX5B 1QJWA 1EPFA 3B1TA 5KZEA 4IBSA 3S2JA 1K7FA 2G3FA 2ZRWA 2OP4L 4KWWA 1VHCA 2A6DB 3FSAA 4HTYA 4WCYH 2QEZA 1PTZA 2OPCA 2W5PA 4HWBA 2OZ8A 1EO8H 4Z7QE 4YL4A 5K1NA 4N1HB 4LEOB 1KM4A 3MLWH 2Y36L 4NRYB 1QOXA 4DNLA 4Z3FA 2DYPD 2VJ0A 4NGHL 4BKSC 3FU6A 3WFHA 4MXWH 4RWYL 1ZE3H 2IBBA 1SN2A 1W2KT 3CVBA 5AVQB 3PP3K 5AKQA 3MRRA 5DN1A 3QXBA 1C08A 3FIGA 2OCZA 1OQFA 1OAZL 4FF9A 2DVXA 2BJMH 1ID5I 2BW4A 3ZT5A 3UYCA 2WVSA 4L1SA 5AG8A 2Z7GA 1K4CB 5C08A 4JDEA 4ZJ9A 5ICZA 3JWDC 1U5HA 5ELIA 4PUDA 2XZAL 2A85A 1FSKB 4E5XB 1NL0L 3Q13A 4GEJA 4JHUA 4W93A 1H61A 1AD1A 1EHLH 4PIBA 4AVIA 2Z8WC 3D9AL 3GTVA 3S1VA 1RY0A 2FT8A 3TQ0A 4CD5A 2QSVA 4TULL 3US0A 2VEKA 2J8OA 1E6JL 2X2YA 2W38A 4EXKA 3EOSA 3ERXA 4O2CA 1FCQA 3RZCD 2XZ7A 3AUJA 5JHAA 5I23A 4Y9FA 4BK9A 4UDTA 1LO0L 1I7TA 3AREB 4PH8A 4TIMA 2BNUA 5DA0B 5LIWX 1U33A 2WLMA 3CN3A 4KRZA 2B1AL 3ABKB 4TS6A 1DORA 2K7PA 5F4XA 4KKBC 3K6IA 4K94L 4L7ZA 5I73B 4YR6A 4L4VA 4I2XA 1ZT1A 4RGOH 1H7PA 3PBYA 4IGNA 2TRYA 4N68A 3UD6A 4W7VA 4G8GA 2D3LA 1EGJA 3ZTJH 3CVDA 1XLIA 3U0WH 2ZKXA 4PS3A 3MLPA 3MROB 4ADGA 2WJ5A 1EMTH 1P2CB 3GLEA 3Q6FA 2V5SA 3QAZC 3TASA 2EUWA 1QW7A 3AIWA 4HZAA 4GSXA 3M7FB 4ORZC 4XP4H 4Y4HD 2PXYC 3B8YA 4Z23A 4G8GD 2VOTA 1E15A 1WFUA 5CWSB 1R3SA 2J13A 2R82A 2O6CA 1ITCA 3BUQA 4H20H 1N8FA 2XDFA 5DLCA 3UWWA 1FVDA 1S7RA 2NUTB 5LJYH 3M0VA 1UA6L 2H3XC 2W0PA 2ZCLH 3CZSA 3IDGA 2EO7A 3WJMA 3HJ0A 5J89A 3TQVA 5B80A 1Q72L 1NC2D 4NI6A 1Q72H 3VFVB 1OFAA 2EBNA 4LO9A 3VMOA 4UTBA 3K72B 2PTUA 1UKQA 3GPSA 4JPWH 1B5TA 2HWGA 4N2HA 1WDDA 2OAAA 4JHOA 3ZIZA 3Q1EA 3FT3A 4QRNA 4IOIA 3HHRB 3AW5A 1JE6A 3NSCA 4GBXC 4OI9A 1YEGL 1YX1A 2HBVA 4MLJA 4A2LA 4PBEA 1FWCC 4O54A 2APSA 4HXBL 5EZOL 3CUGA 1JN6A 4C1NA 1GZQA 2EPOA 5CP3H 4O1DA 2APBA 3CSYA 4Y2DD 1OX5A 3MUIA 5BWFA 3ALGA 5D72L 4F2EA 4XG1A 1HE7A 3I2CH 3FCUB 5GGVH 4UQCA 4XXCA 1D5XB 5IVXF 4NX5A 4TX9A 1SEQL 1O12A 4R4BA 2W61A 3F4DA 3IUHA 5A6TC 4G82A 3S34L 1OCJA 5FGCE 3AVEA 3NCFB 4U49A 3PZQA 3AZTA 2HG5A 4JJOA 5C0EA 3L5LA 1BFSA 3C5XA 5I06A 4BQ2A 4NC1E 3WFDH 3WH6A 5DD0H 4A2EA 1BTCA 3V52L 4NQXA 1DJNA 2CGRH 4KHXH 3E2VA 1CI1A 1ACYH 4L4TD 4ZNCD 1MCHA 3OHXB 1G94A 1IRAY 4XO8A 3ZRSA 4TULH 4PRIB 2VSDA 1O9WA 4U6XB 4YSRA 4O13A 3FQUB 4J1OA 4HHWA 5KYUA 1K2DB 5A40E 4NAEB 4PMQA 2B81A 3PL6B 4H25B 3N13A 1JFHA 3FQ4A 5JPMB 3UBXG 1O4UA 5CJ5A 4JYDA 1IC1A 4KK9C 3I6GB 4C47A 1C8PA 3EX2A 2NPLX 1KJ2B 5H91A 4PS4H 4Z3GA 5J13C 1SDDB 4JPVL 2OGJA 2IEPA 1R9FA 5IQNA 4AMXA 1OFRA 2P5WA 3MI2A 5FO9A 4FXJA 2YARA 2OW6A 1H3UA 3GTIA 3WXWH 3RDTB 4IL2A 2P8MB 1YXCA 1XYFA 2J8TA 2QCDB 4CCDA 1P1ZB 3GMLB 4WW2F 1KPVB 2ZUQB 5EZJB 4P23B 1KD0A 5SWZA 4MLRA 4O58L 3L3GA 4B96A 1LBFA 5EF0A 3MJ8B 5DMJB 1OC6A 2PYED 1NCNA 3V0WL 1D5BB 2BZCA 3FF8A 4XBGB 2G4JA 1SHMA 2E7LC 2W0UA 3W29A 2OMTA 2CLEA 5BV7C 3WQ4A 3PAZA 4FG2A 4U33A 3NQEA 3PGCB 1JF6A 1BEXA 3JV0A 4Z7UA 3EB2A 4OM1L 4OZHE 2VJXA 1P7HL 4C90A 5EU5B 2YYUA 4BF5A 5AC7A 1I7RB 3BW9A 4DOHE 2EIMB 3GNDA 5D1XC 1XISA 5G4MA 3EJYD 1SJHA 2PD9A 3IXAA 3FY1A 1RK0B 3QIBA 1NCWH 3WD4A 3E6HA 4HIIB 3OF6D 4L18A 2AK4A 4M7JH 2XXGA 3APCA 2AQ2A 4YNYB 2FPVA 2GQ3A 3C2VA 1R75A 1A7NH 3U7BA 1BGAA 1L6GA 3WBXA 2VFHA 3ILPA 4M8UA 1PJWA 2PABA 3KWXA 1JPIA 3KPSA 3ZKQD 1OEPA 4JNZA 4ZFMA 4NQDD 1SZGA 4AEFA 1NGWA 3DV4B 4Z8FH 4XC1H 3BW9B 2NUXA 2P28B 3ESVF 4L0PB 4JFEE 4P46D 3RCNA 4W9DC 4CD8A 2ADAA 4GAGL 1IBDA 4L4LA 3ZRCC 1F18A 3AIRA 3Q2DA 3AU0A 3CFEB 2H3NA 1E5UI 4NP4H 5EO9B 1EBHA 1NIUA 3CHSA 3FUDA 3D33A 4LPXA 1YEKL 4RDBA 2ZOXA 4J3ZA 4PJAE 4JICA 1CLOH 4JOMA 1DUYB 4OQTH 4YWSA 1T1YB 1OZQA 4LCQA 4GI4A 2YO3A 4GRWF 3BUYB 3LEVH 3FB7A 1L7IL 2IOMA 1DEEA 3BPNC 3WMQA 1PKQE 4E2OA 3GK8H 3NA9H 4B50A 2PCPA 2B77A 3HIZA 3P4NB 3WDQA 1T41A 3V0UA 5I1CL 1MRCH 1NCDH 1XR2A 3RL2A 4S2BA 4NM4H 4E2VA 2H9GA 3FO9B 3I6LE 2HK1A 4PJCE 3G3MA 3LQAH 1FHDA 4GXVL 4U1NA 4Y5YC 4Q9QH 5I2IB 2IALA 1H3XA 3TEUA 4HISA 3REQB 1JHTA 4YDVB 3TO2B 5I71B 3SY5A 1OF0A 1K3UA 1GT8A 1YYLH 2QCLA 3QS3A 2UY2A 3SY1A 2ZYIA 4QXUH 2UX7A 2TODA 4NX0A 1IGCL 3PUOA 3H9SD 5DFWH 2JEQA 4OH2A 1T4WA 2JH2A 4OZ4A 2D4DA 3B5GA 3GTTA 5D6DA 3HE6B 3I6KB 1N6UA 3WCYA 2FYVA 3WFEL 5PCYA 4E8GA 3RL2B 3GB7B 1CFBA 4IJ3B 4PYGA 4HYRA 1NGXA 2C9QA 2FT6A 2O5ZH 4ODHH 4MJMA 1ZPUA 2AJUH 1IQDA 1PG7W 2J7LA 3T6QC 3NL3A 1ZEAH 1R3JB 4JCMA 3BJ91 4EZKA 4O1EA 5I26A 3IJ6A 2WC7A 1HYRC 5HDQL 4NT6B 5C0DB 3AROA 5CD5D 2NQHA 2Y7OA 5I0DA 4HPYH 3THAA 4TTDD 2JJTC 1RP9A 1I3RA 1W0WA 2CKNA 2Y2YA 4JM2C 4MB4A 2YSSB 2BLEA 1F90L 4QSFA 2ZC8A 2ZG3A 1ZK5A 3I74A 4JO4L 4DHLA 5KJRL 2B4CH 3R18A 2YA1A 2L4OA 2JF1A 3AHZA 2LR4A 5AALA 1A21A 3N40F 5LXGH 1RL1A 2FR4A 4PJ8C 4RX4D 4HSOA 4JBRA 4AZIA 1JDDA 3NPZB 3DFYA 5LGXA 3CHOA 3BRDA 3LPFA 1R0MA 1JOIA 5K7JA 1CFTA 2Q0ZX 4J2PA 4XO3A 5K9KB 1ADDA 2F15A 2YD0A 3SCMA 5C1MB 3WTYA 5IHRA 2WVVA 3ZTNH 4Y8DC 2MCPH 5C6PB 3ULUD 3A6BH 1ROWA 3OVPA 1HTYA 1U5VA 3EDDA 4X98A 5A7EA 1H8OA 1MCBA 4CNTA 4YVUA 2XPGA 4XMWA 5KYXA 2J1ZA 3DSFL 4PR5A 3UG4A 2DWSA 3Q8FA 2BMKB 2Z0UA 4HPJA 1FLRL 5DRXB 1PIFA 1Z69A 3CTTA 1JNNL 3GWJA 3UP1A 1NUDA 4A22A 3THDA 3ZJ7A 2IPGA 3FQWB 3D3VB 3W28A 2OSWA 3TO4B 1IGSA 1RLWA 4P3WA 4PJGF 2VLRB 4UYPA 3I68A 1ZHNA 3PNRB 4FAAB 4NQEE 3VDGA 3JTSA 5AVHA 4JG0L 3KPQB 1OQOA 3SDYL 2DLGA 2XTJE 4U3CA 1VESA 2EDTA 1THCA 2HB0A 2V5BA 5E5CA 4CDGC 4D6IA 3GSVA 3SE9H 4ZXBD 4Z3JA 3RURA 1H6FA 2YCLA 1EP1A 1QAWA 6TIMA 5AZUA 3Q6GL 3RLSA 4AL8L 5CJXA 5C0EB 1US3A 1NWPA 4NPYA 5AB1A 3CWGA 4PJBF 1LRQA 3MLZL 4LY8A 4Z76A 3WFAA 2UUDK 1M7IB 1IFGA 1ZHNB 2OOFA 1ZA6B 2VAJA 1JXKA 5H8UA 1J96A 4R7VA 1K8DB 3W2MA 1Q4WA 1E6ZA 4DZ8B 3M17A 5AWNH 4BKNA 1KJMB 1C9WA 3CZNA 3WFBH 2R2CA 2FSEA 3ESPA 4S3KA 3IRCA 4JJ5B 2GPTA 4NO2A 2HRLA 3M0IA 1YHPA 3ENLA 4ODTH 5IZ7A 3TCLB 4H6EA 1FFRA 3MA7A 4FX5A 3WL1A 3DMMD 4FULA 4B41A 4F8QA 2EG6A 3AXMA 1XWYA 5ABAA 3S36L 3E96A 3GHRA 1QP1A 1FN4A 4GUPB 4BFGA 1EHAA 4LUIA 4F7PB 3DVIA 5DQJA 4G7RB 2OWCA 3LB6C 3VJ6B 2PEVA 2D22A 1JCKA 3MRKB 2OOGA 1L6YA 3TNOA 5CZXD 1SDYA 4KGLA 3MGAA 4XP5L 4FFTA 4NJAH 3HNSH 4PG2A 1XINA 3V6OA 4OZOA 1HT6A 2X3CA 1HWHB 5LXEA 3N85H 1KZYA 1T1XB 1LD9A 1VEMA 3APFA 3TFKD 1XIGA 1AI1L 3B3IA 4OZIE 2EILB 2PPAA 3LB6D 1Z0NA 1IHIA 4U3SA 1KC5H 3GQYA 5KW9H 3MCKB 3T07A 3ES8A 2AXFA 3VQ1C 3FYOA 4PZVA 1A3HA 5HD8C 1NCHA 2EF9A 3EOAB 2CUHA 4QRPD 1A3RL 4WGHA 3W1AA 4C5ZA 3GF8A 1N0XH 2B20A 4CSTA 3RVUD 3MO1B 1O7SA 4MJHA 4IX0A 4W8BA 4R0LB 2FJFA 3T40A 1TVDA 4M8QB 4HHAB 5GS0C 4ODHL 4XCCH 1GQJA 1MCRA 1J0HA 1OCNA 4OGQC 1MXGA 2Z1PA 4NN6B 2NUPA 2XIMA 3BOFA 4PMUA 1OEZW 4LEOA 5HPCA 2X8RA 2WXKA 3NQMA 1TZ8A 4AI7A 1MZYA 2KKQA 1EP3A 3ARYA 4R96A 3VG0H 1CURA 3NPWA 4PB3A 1IEQA 5FCSH 3VD1A 4R27A 5TF0A 2V5CA 4AL8H 1XGPA 4Z3IA 1MHCB 4HU4A 3DHFA 4NENB 4V11A 4CEXC 1KRBC 1IJNA 3FTUA 1AGFA 4CJ0A 3OGSA 4JTIA 4HVXA 3GDRA 3DO7A 1FUNA 3D4ZA 3LDVA 4GFIA 4X5XA 3WMLA 2YOAA 4AENB 1OTTD 4OV5A 4P7LA 4XUYA 5AHMA 3OX8A 5BZAA 5EN3A 2WBXA 4PG2C 1NEZA 3TOPA 4RISH 1ADSA 5ADOH 5H8PA 1CE1H 1UM6H 1NUGA 3FL7A 2NNAB 5J12C 2O5XH 2NQCA 2X4OB 3T3PE 5DK2A 1SYTA 4W7WA 3NEXA 1JCNA 3QULA 3LH2L 4ONGL 3DVGB 1A9EA 5DI8A 3FVMA 4O2CB 3EDFA 3C52A 1PGRB 2JK5B 4ZXLA 2BSLA 1JZHA 3UFYA 2ZDRA 1HHHB 4XC1L 3E8UL 4XP5H 1UA3A 1SPDA 2AS5M 1XSKA 2X1QA 4MJIA 4GCAA 4MJJA 5FCUL 3ZKXB 1R5VB 2HJFA 3COOA 3PWPB 1YUKB 4OIIL 4PRPB 5FM8A 5FW6A 1KM2A 3SGDI 2V67A 1FWAC 2WZ0A 3LKPB 3ZTNL 5IB2B 4C5YA 2ACRA 3X3GL 2ED6A 2P50A 3B40A 4F9DA 2WBJC 3B8IA 2ZF9A 4LAKA 1C9DA 1BCIA 3H56A 4ANUA 4LFHD 1TSHA 3QEZA 4RIRA 1EK3A 2XGBA 3W85A 2P47B 3PR2A 2XXMB 1JWUB 1PF3A 3PS6A 4NJGA 1U91A 4H7CA 3D39E 1A5NC 5IHZA 3GO1L 2VM8A 4YEFA 1LM8V 4OTXH 5J6GA 4PN2A 3VNJA 2EDHA 1NBZB 1BGXH 1H3WM 4X2PA 3W75A 5ACLA 3W37A 3V0WH 3LIZL 3VGEA 4BFKA 5EEVA 4LVGA 4DBEA 2W81C 2IQ9L 3VIOA 3WBYA 3UTZA 2ZE0A 4LFYA 3NPUA 2ISSA 3NAVA 2HTMA 4HCRA 5D7IA 3A4AA 3TQKA 2VR3A 4NAJA 5C71A 4ZFGL 1HJWA 4H83A 4ETQA 4JAMB 4Q9CA 4JREB 2QIWA 4EIVA 1IC4L 4UZSA 2VUKA 3HI5L 1E6RA 1BIHA 1VYPX 4YPJA 4XXWC 3O0KA 4Y8AA 4M6UA 1ERNA 3FJ4A 4DN3L 2GFTA 3CG8A 3PTKA 4UMGA 2X1XR 1CLZL 3TN4A 3U83A 3M07A 3OKKB 2WXRA 2QJNA 3SCOA 4AEHL 3TE9A 3HJEA 4M7KH 4NWUH 4JGDA 3OZMA 2JKEA 4LVBA 5MKGB 1F58H 4B16A 2BSEA 2WINB 3O6FD 4QF1B 5EN2A 4KZCA 3SGKA 1XZWA 2ZUXA 3FN0L 2YCEA 3IAQA 1HINL 4F37K 2O7SA 3H2FA 5HUPA 3HA1A 4Y19A 3BCFA 3EJJX 5AOIA 2X1OA 2ZKYA 2Z9TA 2NQDA 1WAAA 3VKKA 3BAWA 1E7UA 2XPKA 4CNNA 3P30H 3KPRD 4WU5A 4O1BA 3CHFA 1C9SA 4Y4HB 4YS1A 3BPWA 4PMVA 1Q90A 2CE6A 5HPMA 3N9GH 5I1DB 1JXJA 5DJDA 2JQXA 5E0FA 5FC9A 4DVRH 2BWDA 2WO2B 3HLAB 3UO1L 1B3JA 3ARDD 3TNNB 1FWSA 4YE0A 3C5ZC 5EN2B 4AVJA 3UTSA 1KCLA 3LV6A 5SX5K 3VPLA 5EZLB 1ISYA 2NX3A 4Y1AD 1AQDB 3OKEA 1E1CA 5LBVA 2Y07H 1VBGA 4G8TA 5LG6A 2V5MA 2DIEA 3OEXA 1RK7A 4X0VA 5E6YA 1K8IB 4DW2H 1W3LA 1XCWA 3KR3L 4JO8A 1YEDA 1GIGL 1JRHH 4IBYA 5LAPA 4DGYL 1YHTA 3PAOA 4GUQA 4WFFE 4EE2A 2IDFA 1P0BA 3BRGC 2Y89A 3TLQA 1MW0A 2DGAA 2VUOA 2WLIB 3H6AA 4R34A 2ITDA 4KROB 3FRUA 2EE6A 2JKJA 3UG5A 2E67A 3E3HA 2Q2EB 2PYFA 3HTLX 4M03A 2G96A 3R11A 4QRTB 3NMEA 2OJZL 4WW2C 1MNNA 4KDTC 4BFNA 1SFJA 4P9ML 1CXFA 3QE5A 3IDYB 4NYUA 3UWYA 3I6RA 2FQDA 1FI8C 4GUCA 4NNPH 4QKXB 4S1FA 3UF9A 4GP8B 1Y5XA 2DFAA 3V4PA 1OFBA 5IHLB 1MY5A 3ATEA 2VLRD 5F4WA 5HGAB 4LBEB 3G24A 3PGDA 2X0UA 4E41E 2QCHA 1RZ8A 4MMXA 3QZLA 5C9RA 1P4LB 3R7RA 4E41B 5ACZA 3ATZA 3ANVA 5KSUA 3E0LA 4AH2B 3B06A 2XUCA 4WK0B 2FJGA 2YRBA 2V8MA 3ZE2E 3PZGA 3A4DA 2YCKX 3TT1H 3WTSA 2B0SH 4K3DL 1UR8A 2DT0A 3M1BA 4XX1E 2DUXA 1DWGM 3IANA 3S8WA 1HZLA 1ZLUK 1DQJB 4FFYA 1DIKA 3R4RA 2O0TA 2AGJH 5DDHA 1JK9A 5KZCD 4F9PC 1JGMA 5AHLA 4HLJA 4IKIA 3Q48A 1REQB 2OZ4A 2VW4A 4EPSA 3VILA 1HQ4B 2JI3A 1EGJL 3WIHA 1OIMA 4CSPA 3IJQA 4K6AA 3QCTH 4PEKA 1YO4A 5EOCH 5G1TA 3VUSA 3R4DA 4PRID 3VX1A 1KXQE 4CMHB 3NQDA 1AMYA 5FJTA 5JQ9A 2WN2A 1MRFL 2HRPL 2WZAA 4KI5E 2XFRA 2Y06H 4HBQA 3TP4A 2ANUA 3FOLA 4RZ4A 1BJ8A 3ARVA 2WBKA 4R96B 3L0KA 3RMJA 4Q2ZB 3ID7A 4ZQOA 5HVGB 4WJ8A 5AECA 1JCMP 5CH9A 1Q63A 5FAGA 4GIPD 3CUJA 3CV6A 4BEQA 1JGLL 4NCC1 2YD4A 4K8RL 1LVEA 1NM4A 3O41A 4UAOC 4OV5B 4UDTB 1N3NB 5CLTA 2ZRZA 3EPOA 4NIRA 4DAIA 4Q8VA 3ZDXF 1PD6A 1X9LA 4DPBX 3JV4A 4PL1A 4KUZH 3WKML 3CQQA 4AG4H 2KI6A 2UY6A 2FPYA 2FEDD 1O75A 1A6UL 4HIXH 1F0LA 4EAEA 5T3XH 3RWJA 4JFTA 4UTTC 3THUA 4HJFA 1HGYA 1KENH 3SRDA 1EOKA 1SQ2N 3EH3B 5IDZA 1AACA 4DJFC 1KKRA 2DZBA 6ENLA 4Y2DC 4CMHC 2ZA1A 1XBRA 4PCFA 1ORSA 4OB5H 3D25A 4KY1H 3U1QA 4PIRF 2NXYD 3NJJA 4RMTA 5LQBL 5LQBH 2CWRA 4FI7A 1EZLA 5FWQA 1QPXA 5H6HA 2OLSA 1ORQB 4WD0A 3LN5B 4LDOB 2F5AL 2Z4TA 5DJ8A 4RISL 1W0WB 1X4YA 1EGMA 1SNRA 3WK3A 2XJLA 3P0XA 4YHIB 1B2WH 2PWGA 3GSNL 3LKPA 5IB2A 1RURL 2EDWA 3W7EA 2KQNA 4AZUA 4AYFB 2PYEA 3ASNB 3GRWH 2PCYA 3L4TA 2XIOA 1HH9B 2JXMA 5C70A 4KXZI 3A4WA 4TVPH 4ZPVB 1Z1WA 3RA7H 2MEJB 3MNDA 4UB0L 2ATSA 3BSGA 3LNMA 2ZOKB 4XN4A 4S3BA 3BSZA 2QDEA 2NY5C 2X4SB 3TXAA 1H0DA 2QZQA 1SEBA 3LNIA 4GXVH 2KQMA 3H54A 4MJ5B 1G1CA 1VPOH 1GMIA 3AUWB 3QUXC 1R5WA 4MJIE 4XXDA 3SDDC 1Y1UA 4ZX5A 1E5JA 1IKFH 1LP6A 1K4DA 1KM3A 2V82A 2CRMA 4ZNEE 1U95A 4CVZB 3FNKA 3LV5A 1WD9A 3TN0A 2ARWA 3P30L 4X9HA 2QR6A 2R1KA 2Y61A 4H0LC 4GA8A 1JV5A 3HS9A 4ICWA 4KX9A 1YLBB 2I07B 3KLAA 1B30A 4MDIA 2I32A 1O6SA 4FQ2L 4P3CL 3PWLA 1AH4A 3RB5A 5I1KL 2J56A 4ELMA 1KY7A 1BD2A 3IJEA 1XVSA 3EBGA 5I09A 2OKMA 4M5ZL 1BXXA 4P4RB 4FE9A 4HWUA 2HA1A 3NFSL 3UBXI 4PI2A 2GVJA 4NP7A 5C0BB 3EXRA 4MIMA 1PLGH 1ZSDA 4IT1A 1KM0A 1QLEH 2C79A 4BEIA 4M7KL 1JL8A 2EXYD 4NWUL 4A7UA 4L4MA 5D7SH 3P4OB 2YLKA 1EJOH 4GAJL 3GE7A 3QXDA 4LTSA 3NVTA 5J7CC 2ZCHH 4WEEA 1ZZMA 4ES8A 1TUXA 5HYFA 4MZ8A 1K2DA 1IX2A 4M4RA 3SYQA 4DBUA 2FWOA 4LAMA 3AT9A 2REQA 1TTRA 3P54A 3SJVD 2EIEA 5KAQG 4XX1G 1JCVA 4I85A 3V0HA 3K5RA 4XVTH 1KB9J 5BS0A 3VO0A 1TYJA 1J18A 1ZCRA 1QHPA 2O6DA 4XMPL 4AEIH 3MPGA 4F7EA 3RDTD 4IOFD 3H0TB 1GGYA 2I60L 1A7BA 1S9XA 2J71A 1JPKA 5J56B 3MTRA 5D4QA 1RVKA 5J57B 3P3YA 1KJMA 4YMZA 3NPVA 3A3XA 3EYUL 4IQHA 4RQQA 1DIOA 4DBDA 2Z0BA 2FSEB 4D9RE 2V3GA 1VSCA 2A1YA 5HANA 3K8KA 3TMLA 1TJHL 3TCLA 1TQWA 3CH1B 4DO5A 1OLLA 1OZUA 2HE5A 2IQ0A 4OUUA 3TN6A 2DZWA 2QV5A 4MD5A 1NBQA 2NY6C 2RQ8A 2X1IA 2VTFA 5L6UA 4HU3A 3KVPA 3OMIB 1PX3A 1E50A 3IU3A 2VDNH 1S9XB 3MYJB 4LSDA 4GUPA 1M71B 1MJJB 2IGLA 4PJXA 4F37F 5LKYA 2VOMA 3T4YA 5DQJB 3VXRE 3WIHL 1P84J 4LGXA 3IWVA 3GNML 1A5LC 3VVVA 1HILA 4LRNH 2ATKB 5JZ7D 1F7BA 3VKBA 3B7TA 4KKCC 3PAJA 5DMNA 1MLBB 2YEZA 4AIXA 1ZQ5A 3IXAB 5D9SB 3ITCA 2DPEA 2OCCB 1T1XA 1LO5A 3I9AA 3K0WA 3LNFA 3SIKA 5BZDB 2JQAA 1BG9A 2GSEA 3NJVA 2VC6A 3LRSA 2NY0D 4LLQA 3VIMA 5B7YA 4HUNB 3OKLA 1SYVB 2QF7A 1REIA 3O3AA 1ND0A 4A2RA 2WQSA 3W1RA 1S5VA 2EPNA 1ZY9A 4JTKA 4PB0H 1ML0A 5EEZA 4DGIH 2CHOA 2ATKA 4AYEC 4GUGA 4H19A 3FGCA 4P2QE 5IMLB 4UT6H 1YAZA 3ARTA 6XIAA 2A9BA 1G7HB 4KTDL 3WKYA 3G5VA 3LS5L 3SCSA 3GMNA 2A0LC 1C5CL 2NY0B 5KSUB 4HS3A 1SLUA 2WCSA 5DT1H 5BZDA 1WKEA 5AW2B 3PWJA 3KXFA 2DM4A 2DQXA 1SYVA 2GWNA 1XGPB 1DE4B 1MRDL 4WWKC 3FB7B 2Z1SA 1OXYA 3I6SA 5IM7A 3WO4B 4FD0A 1EEZB 2ZUQC 2DBLL 5D2NB 1FDYA 1ICTA 1K77A 1LWJA 1ML1A 2VX4A 4JGNA 3DU0A 2F2HA 4X6DE 2AZUA 2FO4A 2GVYA 2KZWA 3VU2A 1FC2D 3CBJB 4J3OH 3LZ5A 2A9MH 3PXHA 1NCIA 1WQVT 2EYTA 2YXWA 5D55A 3WKPA 3T7VA 3B2MA 4WUKL 5GS1B 2PE4A 4B6ZA 4QM1A 4HOMA 3ZVHB 3G5EA 1FHNA 3GJEB 3KWUA 3B9NA 1NZRA 4WEUD 1J6PA 3SGGA 1QNIA 1FG2A 1AI1H 2VIRA 3HBZA 1PL9A 1AE6L 4IU2A 1JPHA 4DJFD 1HJQA 4EI0A 4W4OA 1P7TB 4A2SA 5EFIB 1A7RL 2A6KB 4GB9A 4HGWA 1NGXB 1ZLVK 4CU6A 5I75B 5ID1B 1YDYA 5KJ4A 1R5VA 3PWPA 1H4PA 3BZFB 4RBPH 1QT1A 3LCWA 1N26A 3KBSA 4K68A 1DJHA 4XISA 4JDZB 3ILDA 4XO4A 3W11D 5E08L 1EC9A 1EEXA 2TMDA 4DW2L 3CZGA 4ZW6A 2XY1A 2F53D 3L23A 5AHEA 4JTTA 3LMJH 4FSAA 5B3SB 3ETBJ 2W63A 4WFHE 1UB6A 3BLOA 5K9JL 1PO9A 1Y1DA 1P7TA 3ECWA 4UXDA 5BROA 1S9YB 3BPNB 4C55A 1LRTA 2PZNA 1RMFH 3T0BA 3RKDC 2JF6A 1G5GA 3UR5A 2Z7YA 3PJTA 4UINL 4PUKA 3R06B 3CVHB 1SJXA 3RI5K 2AQOA 2W5FA 4A7VA 1U8OB 2WMPA 1H62A 5D5MF 2ACQA 1AGDA 2X5PA 4FQXC 4AQOA 5DFTA 1KCZA 2V2WA 2EG8A 4XPTH 1C5BL 1ZLSH 1ZLPA 1SFHA 2HQAA 3HLKA 4XMTA 1QWGA 4TNGA 2YUWA 3G5XA 4MBOA 3MLZH 3PZNA 4H9UA 1EERB 1EA9C 3ZDZE 4LUJA 4FG6C 1AP2A 3LD5A 3GAYA 3GFXA 1HINH 3SGJC 2HWZH 4L29A 2OR7A 2JBMA 2YZ5A 4PR5B 5EBWA 1AH3A 3DVFA 3NCMA 3I02B 4C59B 1E0OB 5AZ2H 1IT7A 1SM3H 1U8OA 2EVGA 3KBVA 3PZUA 3UGRA 2XBZA 1O1HA 4K7FB 3RWHB 1IAMA 4R5XA 4HKJA 3AB0B 2F18A 4N9GA 3TT1L 4WFED 1AJZA 1NCGA 3M7OA 5DJXA 3O6YX 4EF3A 4AD3A 4WEBH 5EPMA 3WH5A 3E0IA 4GYPA 1PKQA 5B4MC 5MP6L 4XZBA 1RK5A 1ZLDA 3ECVA 3EKZA 2B1HH 5LNSA 1TJPA 4LVNB 3BESR 4ZOAA 4S11A 2YC1B 2FATH 2WXMA 4OKVB 2E9MA 1KM6A 1TJMA 3I02A 4FAMA 2XWEA 1TZ9A 1FVCA 4PRBA 5LGYA 1F42A 1FX6A 3VA2C 1IFRA 4GNJA 3O3DA 3ECUA 2ICWI 2YZ1A 3GLAA 2AGKA 5CR8A 1EX5A 3EJSA 3TS8A 1AGCB 3PXJA 1S78C 3FHQA 1CFSA 3S2CA 4P23C 4QRQA 5JNYB 1MCFA 2YQ3A 4UTJA 1JTTA 4D9RD 3B2PA 1QSED 1L9RA 1TETL 3BMWA 4R5VA 3VNYA 2XSXA 4O17A 4XHQA 4ICXA 3HGOA 3L66A 2J7GA 3KPOA 2V9DA 4NQDA 4YEEA 2DQDL 3SD5A 1E71M 3KPRA 4MWAE 4JM2D 4JGMA 4M4RB 4JJ5A 3BWWA 1ACCA 2ZCGA 1R30A 1TQBC 1AGCA 3CLMA 5EO0B 3H55A 3TT3L 1CFMA 2WBWB 3N0PB 4PJAF 4XMVA 3P74A 4XB7A 1T4KB 1M65A 3S83A 2PUQT 4HALA 5JR1L 3S8FB 1GORA 4IIZA 1TJ1A 1NPUA 3U0TB 1FOBA 2IGFH 1MW3A 3TH6A 2WHMA 4OLZH 3H22A 4RCAA 1T04A 4WI0A 3EMCA 2Z1VA 2BY3A 4XBSA 2D7QA 2FZ3B 1MFVA 3UPAA 1WFIA 4RQQB 1G84A 1X5HA 1N6QL 4Q8OA 1RFDL 1G4TA 4M29A 3D47A 3RF9A 3DEQA 3QQ9D 1OARL 2XX0A 4PGBA 1H19A 5CZTA 3OAUL 1DL7L 3QBTB 5C6TL 4E9YA 1ITXA 2VDGA 1QNSA 1FVPA 4MMWA 4AD2A 4DPPA 3FRPA 4DK3A 5HAOA 2F7IA 4NXKA 4WEBL 2QUMA 3JXAA 5I6PA 1HCYA 1L6ZA 3QQ9C 4CW1A 4LB8A 1P4LA 3ABXA 1VKFA 1N8ZB 4LU5L 4NZCA 1L0PA 1CYGA 1ZDSA 1GYLA 1HEZA 2WBJA 1TENA 2AABL 4N2AA 1MOEA 2WQDA 2M2DA 4NP9A 1F58L 2VXSL 5AZ2L 5SWQA 4ENED 1IM3D 3CX5K 3QDHA 2Z4QB 5IEKB 1L9PA 4J27A 4NRXB 1S7QB 3WHE0 1EC7A 1KKOA 5FF4A 2YEZB 1UACH 4PWKA 5D9SA 1HAUA 3ZLQC 1DVFC 4I3RL 4E9RA 4JTEA 3AT8A 5K4XA 1OX6A 5IMKB 3DHPA 3H2PA 1EJFA 4FLOA 4LAJH 3QI9B 3IVSA 3TXVA 3SJ3A 1A3LL 2YAMA 5CEZD 4QT5B 4YDZA 3GXUB 1ND0B 1T8QA 2WPBA 3QW3A 2XPYA 4QYOB 1TDQA 4YHZL 1L7IH 4M3JA 4ZMTA 1NEYA 5JU6A 5AUMB 1KTDA 3AMKA 4FXKA 5HI3D 3W83A 2FECL 4F33B 5F1IA 2R1NA 3Q58A 2X0YA 4MDJB 5DO8A 1MI5E 4H0GA 4EN3C 1EFXA 1I1FB 4IJ3C 1KFJA 2QHAA 4HIXL 1BGXL 3O4LA 2XG9A 1TPFA 3ARPA 1GS6X 2P5PA 4YDNA 2WB1A 1K02A 3MYOA 1HSBA 3KDMA 1M7PA 5IW1B 3RX9A 3VXTA 1JJKA 1EUNA 3QZWG 5DR5H 5E9DB 3QXAA 3VCLB 3NUKA 3QUMB 1P0SE 5AYUL 2IW0A 4ECNA 1GOIA 3BIKA 3FCSA 3RVWC 1EZWA 1DVUA 4J4PD 1IKNC 2DWYA 5CIPA 5EF1A 4WR3A 2F61A 3EF7A 3IYLW 4YXHH 5GGUB 2ZF8A 1Y65A 4UQ3B 4A2GA 4DKFL 1UM5H 4Q14A 5HJBA 1NCWL 4W70A 2CERA 3MZ2A 5GS1A 3WLQA 4AQZA 3FOMA 1ET7A 1L4IA 3LQZA 4TV6A 1ZTXH 4RMRA 4AGLA 4XX6A 2NXYC 5EC1B 3WJYA 1SUHA 1EC8A 1W2VA 3N2TA 4E4UA 4XP1H 3E38A 3IJ9A 3VGAB 3BXNA 3IN0A 3NCYS 3EYQC 2CBMA 2VIRB 3GKZA 3C2RA 3QUMA 3RRXA 3PFMA 4L1HA 2W60A 1PAZA 2EECA 3QR0A 1FFPA 3W81A 4DUXA 4UWMA 2YUXA 4POUB 4AHPA 3QRHA 3FK4A 1LMKA 1YPZA 3BZFA 3S88H 2GIYA 4K8GA 4NQTA 1JUEA 3CXDH 3W88A 5JIDA 5H1WA 2EC9U 3KBEA 4Z1BA 1TJGH 3QCUL 3O3BB 1B3VA 1KV7A 3GAKA 4O19A 2FL5B 3GT6A 1Z6KA 3WE6A 4F7CB 4PMRA 1E28B 2BNRD 4J3UA 1E4NA 4FTDA 4TUKH 2F9RA 4MNHA 4L6OA 4H2HA 3KYAA 4ZS6D 4ETQB 1OTSD 5EIIA 1HJXA 3I50L 5GZOD 2HT2C 2ZPKH 5K93A 4C4KT 4AMWA 4PMZA 4DF0A 2GBUA 1I85C 2OX4A 1UW9A 4BUQA 3EOBB 3NFSH 5DZAA 1CXLA 1HK6A 5E8EB 4PJHF 1K4DB 2QVHA 2DVTA 5EO1A 4OLVL 2H3KA 5J9PA 1GTHA 1I3VA 1YJDC 4WWID 2R1MA 5BU9A 3LIZH 4H1LH 2PGWA 3PHAA 5I1KH 4CMMA 4XPTL 4KVCL 1ZLSL 2QTEA 1W8GA 4IF2A 1CDCA 2OX5A 4QXVA 4N85A 4OQTA 4YQXH 2QGCA 3OWEA 4EI5C 3AM8A 5D2NC 2W88A 2ROYA 1WXZA 2I07A 3B0PA 1WTGT 4N7QA 4RNRA 1DUZA 2QGBA 4HC1A 5D7EA 3CNYA 1CIDA 4J3VA 2EDMA 5GRWA 4S1QL 5ESQB 4YXHL 1RK1B 4EZJA 1IXOA 3GDMA 4RPPA 1S9VA 4XOEA 5D4HA 3OBKA 4HYVA 4QDWA 5LHDA 3WJJA 4KKLD 2GYSA 2YW4A 4WTZG 3NSFA 5C6WH 1TT6A 1VADA 3JZYA 4XOAA 4ALAH 2B7QA 4FLHA 2VDLL 4GMSL 1YBQB 2WXNA 2ZP9A 3CDCA 3QFDA 4GMSH 3GTHA 2YPVH 3L81A 3N91A 4K3JH 1DE5A 3BG3A 4IGSA 3SCMD 4G59C 4AXNA 4WI2A 4G8EA 2X6CA 3T6WA 1GC1C 3OKEB 2BW5A 4E9SA 4I7UA 3QDGE 3CN0A 1AO7A 4I9JA 4I77L 4YGVB 3POCA 4A05A 1T5XB 1RURH 1Q1JH 1CDHA 3FSVA 1CWVA 3O3UN 4Q0XL 1QVBA 3MCG1 1P6FA 4ODTL 3REWA 2WW8A 4I4WA 2IADB 4FYTA 2NSMA 2OYPA 1IM9B 3K8LA 4Y4FD 3QJSB 3S9DB 3BV7A 5DRZA 4H5SB 1WBHA 4G1NA 1E9OA 4JB9H 4PWHA 5LWYH 4KZDH 4ZTOH 1WYIA 1EQWA 5M95B 2E8ZA 3HI6L 1DJXA 3KPOB 4N6RA 2BASA 3HF3A 4F48A 5C9WA 3BGJA 1URIA 1RULL 4LL4A 3CLEH 4OZFB 5HWMA 3F7QA 2CDFA 4OLVH 4TV3A 1H5BB 4OCXL 5ABFB 1QFHA 3ZHNA 5FXCH 4JX4A 1DBMH 2VDMH 5H94B 2ORBH 2I85A 2BY0A 4AT6A 2CU9A 1ZT1B 4IBLT 1FLTX 4QO1B 4XWGL 4AG4L 2D31A 3RCYA 1D7FA 5M7QA 2K45A 2MMXA 5AAWC 2CGYA 5LO7A 5CC5A 4H5SA 3WG7B 2Z8VC 2GUYA 4FYQA 4Y5XC 2IAMA 1TZGL 5EOQL 5IQOA 2IKHA 4Z3EA 1IBBA 3WNKA 5ESAA 1JV2B 4XB8A 4ZEPA 3QG7H 4ELME 2ZCKL 1U8QA 1ZT7B 1OGTB 5CWSA 1VPXA 4WHTB 5DT1L 1JQVA 2V30A 3KWSA 2OWWA 4YTSA 3O2VL 2FJGB 3B03A 5IY5B 3KJ6H 4GRLC 1OTUD 5D71L 3IWUA 5IHUL 2I5IA 3H4WA 3LCHA 5IHWA 5A6AA 5ERWA 4QO1A 3UL4A 4HNLA 5F3FA 4WOQA 1EL3A 4N42A 4AV5A 3WLIA 5FA3B 3UWEA 3HVNA 4QHUB 1B1YA 4HN8A 4XTIA 1WTLA 2J1XA 1M3JA 2Q1EA 5D1ZB 1TMLA 4RAHA 1LF1A 1PZ0A 2C3GA 2WWCA 4GKNA 3PNZA 5F6HI 1TVPA 1EAJA 5D4JA 1HQ4A 4KNUA 1DQDH 1I7UB 1NDYA 1P4IL 3II1A 4KKRA 3QQ0A 1S7TB 5AVWB 3IIPA 2C3XA 1J8RA 1G7PA 1O9ZA 1CYWA 1UM5L 4LMQE 4NQED 5AZ0A 2YGQA 4NNYB 3KBMA 1JXGA 4H6QA 3K2GA 1NKRA 4GXUN 3U7WH 4XN2A 1HOCA 2D03H 5D5MA 3MJMA 4BKLB 3SJVB 1NDMB 3BH8B 3FOLB 4FQHB 3PWVB 3SBWA 2Q71A 1J10A 2Y24A 3QI9A 5B3JE 2H8XA 2YPIA 3EX4A 4FOUA 5HULA 5F0JB 1PHWA 4G7YL 1I1RA 3V4PL 3AAMA 4IRJC 2NW0A 1TV3A 4AZ5A 4KX7A 5AW7B 2DLTA 3LPOA 4Z42C 3MV01