2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
5CSYA 3TOPA 4GI9A 1K9DA 3WKZA 3VVGA 4J28A 1B30A 1OGSA 2DT0A 3FY1A 4AZ7A 3BAXA 2JIWA 3VIOA 4U2YA 5E6YA 6TAAA 1JIBA 2E3ZA 2C0HA 4CU7A 5EB8A 1VBUA 2WNWA 3HG5A 1AQHA 3M46A 2X1IA 2DT3A 2WBKA 1UH2A 4MJ4A 1NWSA 1A3HA 3IGUA 1KCKA 4TVDA 1C8YA 1NP2A 4PMXA 3WH5A 3EMCA 2FH6A 2YA2A 5BRPA 2YIHA 1GQIA 1MQRA 1E6XM 4HA3A 3NSXA 3AZRA 1EIBA 3WD0A 1KXHA 1JGIA 2Y5EA 2XVPA 4TTUA 1R8LA 4U3AA 1GNXA 5D4YA 3W4RA 5TD4A 2DEPA 4GKLA 1KGUA 3CV5A 1UYQA 1UWQA 3GXMA 3CPUA 2E9MA 4N42A 2ZXBA 3WNPA 5A6KA 2WMFA 3ARXA 3RIKA 1PIGA 2FYVA 3WIJA 4NZJA 3EJUA 3BUIA 4JFWA 2VZSA 1E3XA 1QBBA 1ESWA 1QHOA 1BVNP 1VEOA 2WM0A 1NH6A 1NOFA 4FF5A 1O7DC 1WKYA 3WNMA 3QHNA 3VM7A 4DO5A 4BF7A 1H3GA 2ZUVA 3ALGA 3L4XA 3U7BA 2YDQA 5BCAA 3D52A 2G8ZA 5D9NA 2BVDA 3CIVA 1EHNA 4GO8A 1F4HA 1UR8A 1G0CA 5EFDA 4DM2A 2V3GA 6A3HA 4TX6A 1GCYA 4GXPA 4AISA 4D6CA 3ZMRA 1OGGA 1D7FA 4MDPA 1MW2A 3DX4A 3ZM8A 2XSBA 3MV11 4CVWA 1EQPA 3RM8A 5BWFA 3F5KA 3EDKA 1J0KA 5GNXA 4WKAA 2WCAA 2CNCA 4H41A 4PMQA 4H04A 1TQSA 2XVGA 2OYKA 4BCEA 3VILA 1MW3A 3M6DA 4WKFA 4AMWA 4CD6A 1BYBA 4QDMA 4W7WA 1ZU8A 3AIBA 3VGFA 2AOSA 5AYIA 1IZJA 2J77A 4D1IA 3L4VA 2YFOA 3CUFA 1UWTA 3AFBA 3RO8A 3ARZA 2EEXA 3VSUA 3PBGA 4EE9A 1R7AA 2WZIA 2BNJA 5CLWA 1JFXA 2XIBA 1B90A 3VMNA 3VTRA 2F1BA 4L4OA 3TA9A 1CBGA 1JF5A 1VBRA 3VSTA 2E40A 3W6MA 5CQ1A 4XX6A 1UA7A 2D73A 2FE0A 4Z2JA 4PUDA 3GNPA 4YPJA 5HNNA 2ZX9A 3PZUA 2IXUA 4OUEA 3W37A 2YDSA 1QWUA 3HG3A 4MNMA 1GOIA 1XD1A 1UR1A 2GK1A 3IANA 3VIJA 1FFQA 1H5VA 3GXTA 4FNRA 3FXYA 4U5KA 5A8NA 3CHEA 4MAVA 1CENA 1OB0A 3IAPA 4BQ3A 1HJSA 3BLKA 4S3JA 4HU0A 4ZE5A 5I5RA 1EA9C 4B9YA 2CKSA 1B3VA 3AS1A 3SCRA 4CN4A 2ZUNA 3DX1A 1CGTA 2WHKA 3CZEA 3VMPA 3VU2A 4ZENA 4CGTA 4X0VA 5GNZA 4LYRA 3CC1A 3N1AA 3BAWA 1CNVA 4CD4A 1KQYA 1SYTA 1JAEA 3WD2A 2JE8A 1D3CA 2IXVA 2WSPA 2W67A 3UCQA 1CEOA 1E5NA 3LX9A 2PF0A 3L2MA 3EYPA 3CZKA 3WQ6A 2BFGA 3A6OA 2YBTA 4B3LA 2OW6A 4U31A 2VR4A 5LA2A 1JF6A 4PCTA 1J18A 3PZQA 5BXSA 2XFYA 1UD5A 1JAKA 2VZVA 1QHPA 3GBDA 2IGTA 5A6LA 1CDGA 1VFFA 2VZOA 3UG5A 1UZ4A 2X2YA 3J7HA 3ARUA 3OZPA 4UOQA 2OSWA 1TQVA 3W25A 3WNNA 3AMGA 5JBFA 1VEPA 4W8BA 4B3KA 2VX4A 2WVSA 3OGRA 4J3WA 3W38A 4MB1A 3WQVA 4DWSC 6CGTA 4A3YA 3JUGA 2WC7A 1P6WA 1BQCA 3GM8A 1WAWA 1ISXA 1CXLA 3K46A 1EXPA 1W1YA 4AXNA 2XGIA 5GNYA 3UG3A 4W84A 4AY1A 2BS9A 1CXHA 2QHAA 1TZ7A 1EGZA 5I79A 2EPNA 3WDIA 5A3HA 2GJPA 1WPCA 5BRQA 1JZ7A 4CD5A 3WH6A 5JIPA 3WNOA 1MW0A 3WDJA 2VJXA 2DDXA 1V6YA 5IHRA 2X2HA 3SUWA 2D2OA 3EJQA 4PCSA 3VDBA 5A8MA 3GNOA 1E6PA 1W9PA 2XFFA 3MV01 3BUQA 1WZMA 4WF7A 4MB4A 2NSXA 1KGWA 1K9TA 4CCEA 1Q6CA 1V03A 1LL6A 2YL6A 3PZTA 5CPQA 1RPKA 1I75A 8CGTA 3VSVA 2CBUA 2ZX7A 4W89A 1H1NA 1GQJA 2XM1A 1W1PA 5HXMA 1Q6FA 5M5DA 3GZAA 3EDDA 4PMOA 1R34A 1KBKA 1B3WA 3WY2A 3VIGA 4DWSA 1V02A 2WKGA 4FK9A 4W88A 1WCGA 1CECA 3F4VA 4FNUA 3UG4A 3POCA 1VFOA 2VC9A 3A5VA 1O6IA 4TUFA 4D6HA 1JL8A 1XH2A 3IJ7A 1EH9A 5EFFA 4P7LA 3GTNA 2WW5A 3GBEA 3ZQ9A 2VZUA 3TONA 1HJWA 1UASA 1UKOA 3PHAA 3TTYA 2O92A 3TTSA 2DQXA 3S5YA 1KBBA 5HPOA 1H49A 1W3LA 3BUPA 2DSVA 3MUY1 4PBGA 4HPHA 2CCRA 1MVYA 1GOMA 3T0BA 3WH8A 4GZIA 1W3KA 3WMSA 3ARYA 1HX0A 4EAMA 2VT0A 2ZIDA 1TA3B 5ABHA 1NOWA 1GOOA 3KWXA 3VDCA 1JDDA 5IHSA 1H11A 2QMKA 3AOFA 4YHEA 2VNCA 3DHPA 1MXGA 3OGSA 2BY3A 4PMVA 2YL9A 4QCFA 1LJYA 4J27A 1H0IA 2Z1SA 1GONA 4IISA 4UOJA 3AHZA 3A4XA 3ZIZA 2VVNA 3EDEA 3ARTA 4Q7NA 1M53A 4M82A 5I2UA 2EXOA 4CD8A 3D5HA 3LXCA 1DWIM 2ALWA 1IZKA 5I78A 1E6SM 1KQZA 3ZSSA 3VDHA 4AMXA 3ZOAA 1FP9A 3EJTA 2J7EA 2CEQA 4F66A 4ZXOA 1HJUA 2NT0A 4MB3A 3MMWA 3N17A 1XYZA 4A4AA 4GQRA 1YHTA 1FH8A 3K1DA 1XH1A 2XVLA 1QBAA 5JBEA 3OGVA 1WZKA 1V6UA 2OWWA 2G3JA 3HG2A 4X9YA 1J0JA 3OG2A 3ARPA 4CU6A 3QR3A 4UFLA 3EDFA 5AC4A 2J7GA 2WMJA 4FNQA 4D1JA 1QI3A 1UQZA 4PN2A 4TOQA 1HWWA 5A1AA 1TQWA 3LPPA 1US3A 4M24A 3VD9A 2XN0A 4V27A 1KB3A 1QI2A 3UETA 1L0PA 5ABGA 4PSRA 3N9KA 4AIOA 3BUDA 2G41A 3CHDA 4U5IA 1UD3A 2GJXA 1TVNA 3GYCA 5A6AA 2ZUMA 3CHCA 1BGAA 3MUZ1 2FHFA 5HPCA 1MQPA 4AZCA 1R7OA 3EMQA 3W27A 1CGWA 4KRUA 5FCZA 2YFNA 4UQAA 3PZ9A 2XVKA 3BCFA 3ZR6A 3RM4A 1G9HA 3SCWA 2ZX5A 4X0NA 2WYSA 2UY3A 3ZR5A 1ODUA 2F7RA 1C92A 1BF2A 4LQ1A 1J10A 2HISA 4M56A 1TE1A 4J3VA 4AW7A 2B31A 4MNLA 1E55A 5A6BD 4JKMA 5FKYA 5D9PA 2PWGA 4KRTA 3AIWA 3FW6A 1QI5A 3OLDA 4W87A 5LYRA 1L8NA 2DSUA 2WC3A 3LMYA 5CZKA 1VJSA 2O9OA 2ZUWA 1FHDA 2A3EA 1TCMA 1QNQA 4P7QA 5DT5A 4D6IA 3VGEA 5DFAA 2VX5A 5GQBA 1JG9A 5ABFA 1HJQA 1E0XA 1Q6DA 2BV9A 2J75A 4NSBA 3WEOA 4PUEA 4KH2A 3HZ3A 2VL4A 3BCDA 5A95A 4AZBA 3HU7A 1UA3A 4W8LA 3RCNA 1R75A 5E6ZA 3CGTA 1AQMA 2EPOA 1IV8A 3VGBA 3WDPP 3WH9A 1E6ZA 3D50A 3WBEA 4A3HA 1BYDA 2A3AA 4MPKA 4RE2A 1AMYA 5AY7A 3VD5A 2DH2A 1T0OA 3AISA 4IPNB 2CBVA 3AYRA 4DUWA 4IM4A 3OLIA 5F7UA 1PS3A 3T0AA 3QHMA 2GDVA 4LXFA 3N04A 2WZHA 2FDMA 1TQTA 5A6MA 2OWCA 2G4FA 1LG2A 3AMLA 2ZWYA 2WWDA 4Z2LA 3F5JA 2ZICA 2VMFA 4HOZA 3AIRA 5FL0A 4D72A 3WUBA 2WK2A 2J8GA 4BQ5A 1UH4A 4GZEA 2XSAA 4AZGA 3H55A 1Z32X 1J0ZA 3SUVA 1JI2A 1OWQA 4W5ZA 2VX7A 4NXKA 2WZEA 3ARVA 3SCTA 3AZSA 4M8UA 1E3ZA 1C7TA 3AQUA 3A21A 2WVVB 4B16A 3THCA 1QNRA 4W7VA 2EPKX 1NM9A 3WEZA 3ZT7A 5DF0A 2GVYA 3AICA 4GPNA 2O9PA 1H41A 5A94A 5BYWA 4OGZA 5I0DA 2J62A 5HOSA 1DWFM 3MSDA 1R47A 1V3JA 3W81A 3M07A 2QV4A 3L4YA 3TTOA 2W91A 4GIAA 2PWFA 2QPUA 3LRMA 2VRKA 3U5UA 3DDFA 1LQ0A 2WCGA 2YOCA 1KWGA 3AIQA 1UKPA 2BVTA 1QVBA 1W3HA 3GXIA 3VO0A 1J9YA 2DSZA 4GI8A 3BVVA 4UZSA 1CWYA 3WNKA 1LWHA 3WUGA 3KL5A 2XN1A 1KFWA 2BXYA 5CGMA 2JALA 1WDSA 2PBGA 2VCCA 4H8UA 1EQCA 5FD0A 1XH0A 3WQWA 1MWOA 1E70M 2XM2A 4LYPA 2V38A 1JD9A 4HA4A 2J25A 2C7FA 2NT1A 4MNJA 3AS0A 2XIIA 3FAWA 3HJEA 2DSWA 1XCXA 3GH5A 1E73M 4AYGA 1R46A 3ARQA 3D4YA 3VM5A 1EHAA 3AS3A 2CITA 2A3HA 1JXKA 4D6JA 1XGZA 1G01A 4LPCA 3O9NA 1TFVA 5LA0A 3MMDA 3K4AA 3DX3A 4IUGA 4MTVA 4TXEA 4XZWA 5HDRA 2D24A 1KTCA 1KCLA 2VUYA 3SUUA 2WANA 2PWEA 1SZNA 3OLGA 5JBDA 2ZWZA 2Y24A 2JIEA 3ZJ8A 1XSIA 2ZE0A 3VUPA 3BC9A 3OBAA 4P8WA 1UD2A 1I1WA 1U2YA 3VDAA 3ZSTA 1QNSA 8A3HA 1Q6EA 3TP4A 4AWEA 4LYQA 3AI0A 1MW1A 1GPFA 2D20A 4DUXA 4PEEA 2NW0A 4FLOA 4GI6A 2J7DA 3DYPA 4CCCA 3AJ7A 1J01A 2JEQA 4ZEPA 5D9OA 5CG0A 5EBAA 2EPMX 1JI1A 1FOBA 3T2PA 2G3NA 2G3IA 3OIHA 4JAWA 4W85A 1V3IA 3CZ8A 1HKIA 1SR0A 1TUXA 1JZ2A 2JF6A 2A3BA 4M29A 4C7DA 3GH4A 3BUBA 3VMOA 1Y7VA 4MAZA 4MADA 4W86A 4CD7A 3PZVA 3NJ3A 2QMJA 3WD4A 4E8DA 1E4LA 3AHVA 3NDYA 3GXDA 4Z2GA 1XSJA 3AYSA 1ECEA 1JZ6A 3U7VA 3NIYA 2GK1B 1WB0A 3T2OA 1OSEA 2WHMA 1ZBVA 4L4PA 5AC5A 2WC4A 5A69A 3WEMA 3WF4A 1U33A 3CMGA 3WH7A 4MJ2A 1IT0A 2W92A 1GOWA 1HVXA 3AIEA 3T08A 3DHUA 1QX1A 2X09A 5E0FA 3NCOA 4PRWA 4QLKA 1KR1A 4QFUA 4AEEA 3WDHA 4KMQA 3RMEA 2DIJA 1EO7A 2YA0A 1UD4A 2CXGA 2FHCA 3B8SA 3ZT6A 2ZXDA 1KXTA 1I1XA 4RL3A 1QI0A 1GOKA 3NSMA 2JF7A 3TTQA 2UY5A 4NZCA 4MB5A 3THDA 5I6SA 2MANA 3BVTA 3WY1A 1JYVA 1JYXA 1CGXA 3EJPA 1S46A 3EBVA 1ODZA 3ZT5A 1HP5A 4TVUA 1FH9A 5DMYA 1V3LA 2GJRA 4FMVA 2DPEA 1SMAA 1PAMA 1V6WA 5IFPA 3DC0A 3K8MA 1W1VA 1G1YA 3WFLA 3FHQA 1JZ8A 1HJVA 1ZS2A 2WPGA 2WMIA 3K8LA 5CSUA 4U2ZA 1TR1A 5DO8A 4H8HA 1OT2A 2BHUA 1CZ1A 3I3DA 3A24A 1RD6A 4HPGA 3MUAA 2YJQA 4D71A 2EACA 5E0CA 4AD1A 4ZE4A 1HKJA 4BQ4A 4HZ8A 1BVZA 4XB3A 4UR9A 3N15A 2A3CA 1GHSA 4OOZA 3WD1A 2XFRA 2CPUA 3N18A 2E0PA 1ZBKA 3DX0A 4ATLA 1KWKA 5BXTA 4DO6A 4P7NA 3WDQA 1QI4A 4BS0A 2ZX8A 1MFVA 3RM9A 5JIWA 1HKMA 3II1A 1FFRA 5BXRA 1BYAA 1H0GA 3BAJA 1QW8A 2CYGA 2WSKA 1TA3A 2X0YA 3WQ4A 1CGUA 1ISYA 2RGMA 1CGVA 1M03A 4QAWA 4BA0A 2W4XA 1PBGA 3AMDA 1E1FA 2CHOA 2PB1A 2QF8A 1GVYA 5A2CA 4AD2A 3O2LA 3CLWA 3W29A 2EABA 2CETA 2F2HA 4OOUA 1ITCA 2J74A 1B3ZA 3MANA 3WMBA 3NUKA 5E70A 1B31A 4PSPA 1HVQA 4JZ5A 3PZMA 1WDQA 1VFMA 4Y7EA 3SURA 3B9AA 3T09A 4ZXLA 1GJWA 2JEPA 4UFIA 5CGTA 3WQ5A 1HJXA 3KL0A 3QOMA 1XC6A 3MS8A 3NSNA 1W2PA 5AYBA 3S5ZA 4D6DA 4R5EA 3ARWA 4ACYA 3EJRA 2XG9A 2WLYA 2X05A 3KZSA 1OT1A 4TVCA 3ZO9A 2FHBA 4WSJA 3WF3A 3VPLA 7TAAA 5A6SA 5M17A 1DWGM 1UR4A 2E8ZA 3OLEA 3CZJA 5CLTA 1B3YA 2J47A 3IJ8A 3S6TA 5A6JA 1HXJA 4H8VA 2XHYA 4EKJA 1D2KA 3CUJA 2V3FA 3CMJA 1QPKA 4UCFA 2CIPA 2V5CA 3WSUA 4WSKA 4NRRA 1QHZA 2EJ1A 1UD6A 3D4ZA 3PZIA 4AMCA 4M81A 4HOWA 4JHOA 1HKKA 3AIVA 3UESA 3VX1A 4DUVA 4QLLA 2VI0A 5CPTA 3DYMA 4JFUA 3QOKA 3CZNA 1E15A 2J7FA 1V6VA 3LRLA 4PTXA 3VGHA 3D51A 5D9MA 1C8XA 2OSXA 1UZ1A 1H2JA 2VOTA 1UR0A 1VF8A 1J12A 2VCAA 3CUHA 2WBGA 4H2CA 4PYSA 1PPIA 1PIFA 5FIPA 1E71M 1KTBA 4UFHA 1FH7A 4DO4A 1CIUA 1B1YA 1X1NA 1XV8A 1UWUA 3UERA 1MFUA 2XJ7A 3CBWA 4UNIA 1UQYA 4V28A 4JHZA 2DH3A 3EDJA 1US2A 4PMUA 4UFMA 1V6XA 1RH9A 1BSIA 1EDQA 4AD5A 3W0KA 1CTNA 4YHGA 5FOOA 1VJZA 3WUFA 4PTWA 4EANA 2J78A 1W2VA 3WNLA 4NXSA 1V0NA 1BFNA 4FNSA 3PTKA 4UZUA 3WF2A 1C3FA 4PMZA 1XCWA 5D8ZA 3KEHA 3ZJ6A 3AXXA 2VX6A 3CZLA 5ECUA 4CVUA 3UR8A 4D6EA 2D3LA 1E4IA 2XGBA 2YLLA 3B9EA 5ABEA 1C91A 1WZLA 2FGZA 4J7RA 1UWIA 1J0IA 1DWJM 4UQDA 4P8UA 5C71A 4QCEA 1K6AA 4LX4A 3BVXA 3KL3A 4HA1A 4NF7A 1R86A 1VEMA 1GUVA 2V3DA 4BQ2A 3WUEA 2WCSA 1FP8A 3IAQA 4XV0A 4ZFMA 3WQ8A 1JYNA 4NX0A 3WN6A 3AIUA 2WMHA 1PX4A 5BROA 3L4TA 4UQEA 1UHVA 3VGGA 2UY2A 1UG6A 1B0IA 2WB5A 2WLZA 3WBAA 4ACZB 3A4WA 5M03A 4NI3A 2XWDA 2D0GA 3A4AA 3H54A 2F18A 1J11A 4JKLA 2J7BA 4AIUA 5ABFB 3N13A 3RJYA 3WENA 1E4NA 2WVVA 1CYGA 1G94A 1V08A 3CZGA 2CBIA 2VRQA 1JDAA 2Y8KA 3A47A 4P8XA 1F4AA 1W9XA 3OZOA 2E9BA 4V2XA 1PZ2A 1NQ6A 3W53A 1ISVA 3BSHA 4DWSD 3SIMA 1WP6A 5DEZA 4W5UA 2Y8VA 2PWDA 2VR5A 2GDUA 1PZ3A 3VNYA 5DT7A 2J4GA 3E1F1 3WF1A 3VIPA 4DM1A 3SEPA 1B3XA 3APGA 3PZNA 4RE4A 2OYLA 4HMDA 4OIFA 3I3BA 1GHRA 3LPOA 2UWFA 1BTCA 4C7GA 2W66A 4AD0A 2WVTA 4UOZA 3TV8A 5JUVA 1HF6A 3BGAA 3CH9A 5I23A 3HG4A 3GDBA 3VD7A 4AYSA 1AQ0A 3W26A 3VIMA 3AMKA 1FA2A 1UWSA 4F9DA 2F7PA 3AS2A 3PTMA 1VB9A 1HN1A 2EADA 3K8KA 1CXKA 3GXNA 4CUCA 1X6LA 3GH7A 3W82A 1B9ZA 4UFKA 3L4ZA 1PJ9A 1SMDA 4U3CA 4UQ9A 2BY2A 4HZ7A 1X6NA 2J7HA 3SCQA 1OBAA 2X8RA 3AROA 4ATWA 2CKRA 1TG7A 2Z1KA 1H09A 2V5DA 3MKKA 3D3AA 3MO4A 4AZIA 1OD0A 1JNEA 4CKQA 3A22A 3OA5A 4WK9A 1KXQA 2J8FA 1OGBA 1ZBWA 1NARA 2OW7A 4QLJA 2IUZA 4KGLA 1GQLA 1E56A 3MUIA 2XWEA 2YL8A 2WHJA 1U30A 1XSKA 4M80A 2EO7A 3T0DA 1DHKA 3ECQA 4HMEA 4P7OA 4AD3A 1E5JA 3BMVA 3QGVA 1NWUA 4JFVA 1BPLB 3AMCA 2F7QA 4HZ6A 5IXEA 1M04A 1RP8A 5I3DA 1W1TA 2CERA 2WAGA 4Z2HA 3L2LA 3BVUA 3POHA 1YQ2A 2QPSA 2WKLA 3WD3A 2E8YA 2BY0A 1J0HA 3SCPA 1OM0A 2W61A 2FH8A 2EQDA 3RJXA 3L4UA 1HIZA 4JL2A 4KWUA 2BXZA 2D3NA 4CN1A 1M01A 1C7SA 1LG1A 1EDGA 2WHLA 3CTTA 3WF0A 3ZJKA 4H7VA 2ZUUA 3WELA 3N11A 1Q6GA 1C93A 1E0WA 4J3TA 1E6NA 1NWRA 2D1ZA 2YKKA 4OBRA 3WMCA 2F7OA 4IPLA 2WVUA 2D0FA 5EMYA 5A8OA 3KLLA 1JD7A 1WE5A 4F79A 3SCUA 1KXVA 1C90A 3AZTA 1HL9A 4E8CA 1UKQA 4C7FA 4W93A 1MQQA 2XTKA 1H4PA 1VENA 4JFTA 3LXBA 4HP5A 3ARSA 3SCVA 1BLIA 1XRVA 2X2JA 2YA1A 1CXEA 2GUYA 1GQKA 3I3EA 4FLQA 1V3MA 1LL4A 4UTFA 1GZJA 3A23A 1JDCA 1ISZA 4AD4A 5A6BA 4EK7A 3VIHA 1AVAA 3G6LA 2D0HA 5GPRA 2J7CA 4B9ZA 4W7UA 4QP0A 1W9DM 1HTYA 2D22A 3LPFA 1GOQA 1EDTA 1JYWA 2X0HA 4GO9A 1ISWA 3KE0A 1ZJBA 3AHYA 2WWCA 1NWTA 1V3KA 3DECA 1DEDA 2DT1A 4ATDA 3BH4A 1KGXA 1DWAM 3VOCA 3WY4A 4AC1X 1W3JA 3AXHA 3ALFA 3BMWA 7CGTA 9CGTA 3VGDA 1CLVA 4ML4A 1G5AA 4R27A 1BGGA 2VRJA 3MI6A 1HT6A 3S2CA 1EOKA 1QNOA 3FHAA 2BY1A 3BAIA 4HOXA 1WNOA 2YDRA 2E9LA 1JNDA 2ESCA 3IK2A 1V02E 4HTYA 5BXPA 2EPLX 4TX8A 4JCMA 1R85A 3VIIA 2DGAA 3BLPX 3VIKA 4AZ6A 1B2YA 1W9VA 1OD8A 1HNYA 1JZ5A 2ZUTA 4WIWA 2PI6A 1UOKA 2ZXQA 3WL1A 5CJ5A 2DIEA 1MYRA 2O9TA 4MDOA 4J3UA 1ZB5A 2DSKA 2UY4A 3UR7A 1W9UA 2W63A 3VINA 2G3MA 3SCSA 3RPMA 7A3HA 4AIEA 3RDKA 1QNPA 1CXFA 1E6RA 1QWNA 4TTGA 3B9DA 3BAYA 3VIFA 5A8QA 1BHGA 1RP9A 1GW1A 3WL0A 2BVYA 1VFUA 1E1EA 2BHYA 1PX3A 5E09A 1ITXA 1UR2A 1R33A 1XD0A 4JFSA 4NZFA 4W8AA 5LA1A 4P7RA 5A8PA 4FNPA 4UQCA 2WMIB 2W62A 4D6FA 3L4WA 1UD8A 4XZBA 5I77A 3T2QA 1EO5A 2E4TA 1GORA 1E0VA 2OSYA 2OYMA 3MSGA 1QOXA 4PMDA 4CCDA 2J79A 2OLHA 3WDRA 4Q22A 2OWXA 1K9EA 4F8XA 1LLOA 4F9JA 1HXKA 1SFSA 2CESA 2GFTA 4DWSB 1Q4NX 3MMUA 1UUQA 4N0RA 4PTVA 3H53A 2C8NA 4GQQA 2WMKA 3QHOA 4GINA 1WO2A 2FGLA 1MXDA 2GSJA 5HBFA 3W24A 1BYCA 1WDRA 5KZ6A 3EJSA 2WXDM 3U57A 4UFJA 3DX2A 4FLSA 5CXPA 3PN8A 1WDPA 1E40A 3PZGA 3F5LA 2VO5A 3ZJ7A 4P8VA 5FL1A 4M1RA 2AMGA 4YN5A 5CPSA 2EBNA 2X2IA 3FN9A 1PEZA 1NP0A 1XHGA 1K9FA 1CPUA 3NYDA 3LXAA 4HU8A 3N12A 3W6LA 1V0KA 3DDGA 1UH3A 2TAAA 1V3HA 3CHFA 4RE3A 3AHTA 3BAKA 4JCLA 3ARRA 3DYOA 3A3HA 3SUSA 1W9BM 1HL8A 4D6GA 2QLYA 2ZOXA 5IFTA 5C70A 1DP0A 1KR0A 2D23A 4AEFA 1QW9A 1NOUA 3KLKA 4JL1A 5I24A 1JFHA 3BXWA 4B15A 3CZSA 3BSGA 2WMGA 2EAEA 1TVPA 2W5FA 2JFEX 4Z2KA 1CLXA 1O7AA 2CHNA 3AHXA 4FNTA 3U5YA 3AXIA 1OINA 5M3WA 1E72M 2PWHA 2Q8XA 1JXJA 3CO4A 4BZYA 2ZUSA 4U33A 3BVWA 4UQBA 4JKKA 3VD4A 4J3SA 1VIWA 4KGJA 2ZX6A 5KEZA 4URIA 1M7XA 1JZ3A 1BAGA 4OJYA 4AZHA 3EMZA 3W28A 1WZAA 3WFZA 1VRXA 4OBSA 3GXFA 1DWHM 1V0MA 2HVMA 1BG4A 2Y4SA 3GNRA 1VAHA 1PX8A 3SCNA 1OIMA 2RGLA 1UR9A 1BG9A 3VD3A 5C8BB 2VQUA 4FLRA 3LRKA 2VVSA 1E6QM 5A2BA 1OCQA 2PBOA 1ZBCA 1FHLA 1E4MM 2VURA 3HMCA 2XUCA 3MU7A 1GJUA 3CUGA 4JIEA 4CU8A 5IDIA 4AZ5A 1TQUA 2PC8A 4WLCA 2F8QA 4GZJA 4S3KA 2V3EA 1HP4A 5E1QA 4E2OA 2XVNA 1W32A 1OIFA 4MNKA 1XYFA 2XN2A 1ZL1A 3FAXA 1LWJA 1E9LA 3M7SA 3PZOA 2ZXAA 2XYLA 1ZJAA 1V0LA 1CXIA 1LF1A 4PTMA 2GJXB 1LL7A 4OZOA 1EOMA 2F61A 1CGYA 2BHZA 2F1AA 4Z2IA 3O6AA 2CBJA 4HMCA 3VKKA 2DT2A 3GXPA 1UKSA 1R87A 4AZCB 1TMQA 3VX0A 3OB8A 3NDZA 5A2AA 3IJ9A 2XPKA 5E9AA 2YL5A 3RILA 1E43A 1W91A 2AAAA 3G6MA 4PMRA 4WJXA 3PTQA 4OKDA 3UEQA 4PMNA 3SCOA 1UKTA 4E4PA 1GVIA 4ACZA 3CUIA 1N82A 3FNDA 2YBUA 1UWRA 4LGXA 2YLAA 3VNZA 3HN3A 1J0YA 4XUYA 2Y2WA 2VZTA 4J3XA 2O9RA 1C8QA 3SUTA 3BLBA 1A47A 4K68A 2VQTA 3WY3A 1JZ4A 4WKHA 4CN6A 2VCBA 4PMYA 1DTUA 3LPGA 3K4DA 2VTFA 4NRSA 5D8WA
chains in the Genus database with same CATH superfamily
2F8IA 4ZOBA 3TMLA 3E0FA 4U2YA 4JYDA 1ZXKA 2DBLH 1FP5A 3M0MA 4ZUWB 5CBEA 4A37A 3NK3A 2DYPD 4JIIX 5H35B 3N6YA 4MJ4A 4HKJA 4JFOB 3RE0A 3TH3T 4CMMA 3EMCA 4QNWA 2WJEA 5CJQH 3EX2A 1E6XM 2PPDA 4OKVB 5IROD 4JJHA 2NLIA 2Y5EA 1S8DA 4TTUA 2ERJC 3NPVA 1EJTC 5AZUA 5TQ2H 3ZPDA 3URQA 1A7NL 3GGWA 5DJDA 4Z7QE 4UDTB 3GXMA 4ORZC 4N42A 2V5JA 1VPOH 3QJVB 3VI4E 3WLHA 3N29A 3WIJA 4A2RA 3ZY7A 5I16B 2X0SA 4L0ZA 3NEEA 5LGJA 3NM3A 5B7EA 4V2BA 5CBJA 4MAYD 3VM7A 3WLBA 2DQMA 2YDQA 3D52A 2G8ZA 5HP5A 1F4HA 4H0GA 1SPDA 4L3FA 5DK0A 1J9SA 4LVFA 3B4NA 4WEBL 4ETYA 1EQPA 5BWFA 3PJXA 1J5DA 1P6AB 1J79A 3IDIA 1OARH 5BRZE 3Q3GA 4FQCL 2OYKA 5TQLA 1P4UA 3P7YA 4ASTA 4MJID 4XO9A 2XWJA 1ZU8A 2MSPA 4KC3B 4DKFL 1CG9B 5I0YA 4F8LA 3LCHA 2YOAA 4R7DA 1JFXA 4GEIA 4NYLA 3LV3A 3IJYB 1CBGA 4LDCA 4O2CB 5EA9A 3G6AA 3OMNB 3UCCA 1P7TA 3JV0A 4GVGA 2OMWA 1S7WB 3HG3A 1FKWA 1GOIA 3FB6B 3O4LD 1U8NA 3AAMA 5BRBA 1SJDA 4CQBA 1DN0B 1OB0A 2P5WD 4X5WA 2ZNXA 4O58H 2LABA 4J9JA 1B3VA 3OKYA 3G6JF 4P49A 4QRRD 5KVEE 1PD0A 3VFGH 1SW7A 2NLYA 2NY2B 1OD9A 3ZZSA 4LYRA 1EZLA 2FZNA 5EEXA 2JE8A 3QFJD 5AW9B 5L0QB 4ZDHB 5FF6A 1KZQA 4PCTA 4JM2D 5EDXA 5FEZA 4TV5A 4PL1A 3OKDA 1NSNL 3CHPA 1O95A 5D70H 2R0ZL 3O0FA 1GGUA 1EXGA 3W25A 4YSPA 4MD0A 1VEPA 4KRPD 4L48A 2EYSA 1KB9K 2YPVH 1I8MB 3B7RL 3VQMA 4RAVB 4J3OC 3GHBL 2Z6JA 4A66A 3W7QA 3HLAB 3QORD 1GVRA 1N8ZA 1I0DA 3P2BA 5T3XE 3H21A 2VCOA 1TX0A 5FSEC 3UG3A 1KEML 3SBQA 3NSFA 2LHAA 4IHBA 2VLKD 4A2SA 1ZVYA 4UV4L 4U7KA 5IHRA 4NN6C 3Q1EA 2QUMA 2FRGP 2J12B 2V7NB 4X61A 3E9TA 1SW3A 2YL6A 2GKIA 3I6EA 1VDGA 5IP4A 3GQFA 4LCYA 4W89A 4R34A 4KK5D 4MSWB 4PWKA 5HXMA 5DHEA 5IQMA 1Q6FA 1FCGA 2BASA 5FM8A 1VADA 3WY2A 1NMAL 3HPJB 3ETBF 2SODB 4QAIA 1XF3A 3S98A 1LO2L 1VBJA 4QRPE 4E9XA 1M4KA 3POCA 3H9SB 3SDCB 1O6IA 1M56B 1TKWB 1OAUH 1YN7B 3FQ2A 3KVPA 1UM5L 1IQDB 3LS9A 4XGZB 1HJWA 3HZYA 2Z34A 3BUPA 2QW5A 1XGPB 4IIDA 1H3XA 1NIDA 2J2ZB 3OHXB 1P84J 1YE6A 1J8HA 4F5CE 4ZTPL 5HQMA 3C2FA 1ZA6A 4S3DA 2YK1H 2A1WL 2HJFB 1RZJH 2DKMA 2VAJA 5HJGA 3S35H 1CIDA 3JWNE 3RDJA 1VACA 5AHIA 3IMBA 4UMAA 3ARDD 2PYED 4IRSA 2GGJA 2FIRT 3U0PA 4B5ZA 4LBRA 3MLWL 3O7UA 3D5HA 5TK4A 5CJMA 5C0AA 4X6DE 2VXUH 4ZODA 3C5ZB 3V36A 5JW4N 3PV7A 3GLEA 4Z7AA 3LKQA 1PYFA 3BP6A 3W83A 9XIAA 4A4AA 4R5TA 5EV7A 3O3BB 1YLVA 3QTPA 1N6UA 1IKNC 2KBGA 4BH8B 5J04A 4N9DA 4M7ZB 2D03L 1V7NL 5L9FA 1FL5B 4HETA 4OQVA 2PO6D 5MENE 1A7NH 4RLDA 1AG1O 4ZJ9A 2AI0L 2YPLD 2Y23A 1QFUL 4LUTB 3ARBC 1Q0YH 2C3ZA 4MRCA 2VDPB 3IVKB 1DZBA 4NOFA 3AADB 4K8EA 1MQPA 3PYCA 3O2DA 4PRPA 3B9OA 5ADOL 3CXOA 3CSBA 5CKAA 2IADB 1G9HA 5DYOA 1L9RA 1E8ZA 1NJJA 2F7RA 4NS0A 3EX3A 4WEBH 1R3IL 2RHEA 3NTCL 4MJ5B 3RY5A 1J8RA 5I1AA 2ADFL 3P9MB 1OWRM 4FQCH 1UEYA 4LHUB 8FABB 1TCMA 4YR6B 5FYLD 2APBA 3V5HB 5GQBA 2YXOA 1XBRA 2BV9A 4AZBA 3IPEA 3I85A 1IV8A 2X53A 1IM9D 4E9SA 1BYDA 4JUSA 1GJIA 2CIKB 3JVAA 4BIKA 4IPNB 3QQ1A 4K5LA 4NNXA 3OLIA 4OLWL 5F7UA 3KBWA 4XVUD 3RG1C 4W9EC 3HMWL 4KWSA 2IANA 4JFZL 1AKPA 4PJEB 4HOZA 2DZAA 3VWJB 3B83A 4N85A 3QZ6A 1UH4A 4GZEA 2F9RA 3JZUA 1WJ3A 4C1NB 4DAIA 4G1EB 3KCLA 2DEXX 1IAKB 4TQIA 3FKKA 1IE5A 1E3ZA 2PF6A 3GU9A 1I60A 2CKNA 4B16A 1QNRA 4UDUB 3EYFB 3D39D 3TXAA 1NSNH 3KPPB 2CLZA 3B8UA 2R0ZH 2BOCB 3S8WA 1MZYA 2JB5L 3X3FH 5JPNA 4P2OD 4FXKA 3T6WA 1B6UA 5DFVC 2PRMA 3MCG1 3GHBH 3P3BA 4GI8A 3BVVA 5JZ7D 2IQTA 4D9RD 3MRGB 3JVFC 2FLIA 5C7ZA 2EZ0C 1I6NA 1KEMH 3ZE2E 2P44B 1JD9A 5AUMB 1BJMA 1S7TB 2H2SC 1ZLUH 1Z42A 4GSDH 4HUCA 3G04B 3VZZA 5EFIA 1CDBA 4Z77A 1XGZA 4JFFD 4YHML 2QGYA 1FZJA 1ZJHA 3VD0A 4WHTA 3SUUA 3WAKA 2H41A 1LO2H 2JIEA 5IUSA 5C0RL 1WA2X 1FNGA 1ZSXA 1DLFL 4Y1SA 4EUPH 3H56A 5I1DB 1FX6A 3O6FD 1L9NA 4Y5YC 2ZDSA 1FWHC 3AJ7A 2ASHA 2IAMA 1J2WA 4JAWA 1HKIA 1KENH 3BMXA 4EDWL 3L5LA 3BUBA 2ZONA 1JWSB 3FF7A 3DIFB 3BPCA 4K94C 4E8DA 4FADA 4MIMA 4ZTPH 4XZHA 3GXDA 2A1WH 4GUHA 4UYPA 3A3YB 3U4EB 1FO0L 2WC4A 5E00A 1OPOA 3WH7A 4JM4L 2CRYA 4FNLL 1GMEA 1BWWA 3T08A 4ZW8A 1IEAB 1QX1A 3B1TA 3NFPB 1SZEA 3S3SA 4O54A 2DIJA 3MLWH 5CGQA 5DRNB 2CHXA 1RHHA 2HS8A 5KETA 3G0UA 3UEZA 3BVTA 4PJXE 1TR7A 5HI5D 3DA0A 2FDSA 4DFIA 5KYNA 4FMVA 2DPEA 2VQ4A 5FV1L 3DVFA 2IGLA 1OCWL 1BJ1J 5AHEA 3DC0A 4FTVA 4S1SL 5EEWA 1NANH 4AYEC 1KBWA 4A63A 4Q33A 1OT2A 1RSCA 4I18B 4HPGA 4M5PA 1D2PA 3IDJA 2R91A 4ZFOL 3ZYOA 2Q7YA 2MNRA 2D03H 1V7NH 3EKCA 3MRBB 4NQDD 4HZ8A 2AI0H 2JV6A 4N90D 2PWVA 4X6CF 4UR9A 1OAZH 1QFUH 3PGCA 5CCJA 2PTWA 4P2VA 4W9HC 1MHPL 5GRVL 5I75C 1MG3C 2DYPB 1OO2A 5JIWA 1PYWA 1D9EA 1QVOB 4IDJL 5ADOH 1KKRA 1CFSB 5DC0A 1NFIA 1UB5A 1P6FA 5EZJA 3FT4A 5F89A 1ME8A 1CGVA 3SN1A 3SJ3A 1RZ8B 4P2RE 3T6CA 1R3IH 2IOOA 4MQ7B 1P7HL 3NTCH 3WUWA 2FLRT 2ADFH 4QHKJ 2CMRL 1WDDA 5JPMB 1SQ7A 5HWMA 3MANA 4PSPA 3RY4A 4YGAB 1AACA 4GG9A 1HDMB 4MAYB 4D0BB 2VM3A 3IBEA 1TV8A 5BJTB 1SJBA 3UTTA 1RPXA 1IT8A 4GC4A 3USBA 2Q3AA 2PW1B 4NYUA 3W39B 5A3ID 2BSDA 3T3MF 3DOSB 5KYWA 2J47A 1GYVA 4OLWH 1Z2KA 1NZRA 2CZVA 4IP4A 1QPKA 3IM1A 2V6HA 1KCUL 3HMWH 2GSIB 4G42B 1BV8A 5B39B 5KVEH 4JFZH 1Z5LB 1PZ0A 3FYEB 1OGTA 5EO9A 3ZZQA 3FULA 4K6AA 4JFUA 1RA0A 3TOYA 1YBQA 1JUFA 1NDGB 1KZYA 3S3BB 1J12A 4DP4X 3O4LB 1TREA 3OAZK 4H2CA 2WBGA 3QA3A 2AQNA 4LNRB 1A6ZB 1FYTD 2P5WB 2JB5H 4N0UE 5E1GA 5DK3A 5T3XH 4MBRA 1K3ZA 4QRRB 5LGHH 5KTLA 2ICCA 4ZI8A 1WAUA 5DD0L 3QFJB 4PTWA 1QPOA 4HULB 3TVAA 3KEHA 12E8H 2O61A 3D47A 5ECUA 4PJBA 5T1DL 3KPSA 1R5IA 3C60C 4S3GA 3VW3H 4DIXA 1R86A 4YHMH 4Y89A 4AQAA 1YXCA 4IQHA 1RK6A 3LCFA 1OADA 5BROA 5KAQG 5GJPA 3L4TA 4O1CA 5D1XA 1Z7AA 3X1BA 2Y2TA 3RVWC 2VLKB 2PF8A 5C0RH 1XBVA 1KFKA 4NWUL 1DLFH 3MRDB 4A3UA 5M03A 1AQFA 1KNWA 4P59L 2F6XA 4WFED 1MFEL 5DSCB 2Y8KA 4B5WA 4EDWH 3AAZB 5KSBF 1TTIA 4P23A 3AU2A 3C2VA 2R29A 3WQDA 3M86A 1Q9KB 3BO8A 1WP6A 3JWNH 4J2MA 1FO0H 2GITA 2AJZA 4JM4H 4Z3EA 1DQJA 4HBQA 3D4CA 4FNLH 4UTTA 2OTPA 2HWGA 1IL1B 2PABA 3GINA 4C7GA 3JBG7 5JUVA 4I6VA 3BH9B 5LKNA 3WN5A 5DHYB 3B2PA 5K9JH 2F53A 2Z3FA 3TK7A 1X6LA 2E09A 2Y5TB 2OQYA 3T0EA 3MCYA 1A1OA 1OF2B 3MV9A 1RZGA 4S1SH 3MI2A 4PW3A 3RHWF 3MO4A 4HU2A 3I65A 1OD0A 3W9DA 3ARDB 1H15A 2PYEB 1EC7A 2OW7A 4KGLA 2IPFA 1B0GB 4R0LA 3OMIB 1R3SA 3MACL 5G5DB 4GYJA 4JO5A 5C0AD 4G56A 2R4RL 3QGKC 3W56A 5GGRB 3HQOA 1MHPH 4N1HB 1ACXA 3BK0A 4XNUL 4ZS6C 1YPZE 3GLDA 3QCUH 4B92A 3C4UA 4IDJH 3CTTA 4YZWA 1Q6GA 4PRAA 3EO0B 2NPLX 4IIQC 4NQQA 2R2BA 3NH7H 2XC8A 4JRXE 2CLKA 1E5ZA 3RITA 4WQOA 1IAIM 5B4MC 1R0AL 2PO6B 2XACC 1U9KA 4R4ND 3BVDB 5DD3L 2YPLB 4PRBB 3VNLA 2G30A 5B7FA 3LXBA 1RZKL 1BQLL 3A5FA 2GUYA 3I3EA 3UZZA 4YDVA 1ISZA 4NJ9H 2KMWA 3ECWA 5DQDL 4FTVE 2Z8WC 4PAZA 4OUUB 2NXGA 2GBVA 2X1XR 1EDTA 2P8PA 1BWLA 1N0LA 2IH1B 3L3OB 5HYEA 4Y4FC 4BRVA 4ML4A 3BAEH 4N25A 2VRJA 2Z27A 1E4WL 1F11A 4HOXA 3O8XA 4G6MH 1NL0H 1GPWA 4YHYC 4P4KD 4JCMA 3J8F7 2Z4TA 3VIIA 4OTKA 3O2DL 4WGXA 3QAQA 3WL1A 3KTSA 2FBJL 4HKXB 3DMMA 4EIZC 4KIEA 3L1GA 2BHYA 2AFNA 1R33A 3QG6A 1DTNA 3TLQA 3VKCA 3PL6D 1A7OH 4DK5A 1H3TA 3RVXD 1EO5A 3NGJA 1S7QB 4QOKD 3BPLC 5F3FA 2OLHA 4IL0A 2QCCA 2CUHA 5DD0H 1KFEA 1SFSA 1G4TA 2CRMA 3Q2VA 1LBMA 5HPMB 3D39B 5KJ7E 5T1DH 4NO3A 1DBJL 3L0GA 4H13C 5KZ6A 3A13A 5CXPA 5E23A 3MP5A 4WUIA 5FL1A 3DSFL 2XXGA 3WIIH 1FL6B 2JCWA 1PD1A 2H3NA 3MZTA 4IP7A 1JPTL 1IT9H 1JS4A 2CLEA 2VGBA 5F4XA 3GUFA 4P2YA 2WD0A 1B9BA 3ABGA 1PNDA 4XN5A 3M0IA 2QLYA 2V8MA 4NWUH 2DYSB 4MCYB 1OZUA 3WQFA 4P59H 3S1VA 2D3JA 3JTSA 1L9QA 3UCDA 4ZG1A 3SB0A 5SWSA 5HHMD 2VISB 3RL2B 4FQQB 2PD9A 2YXVA 4JFFB 3B4UA 3RNQA 1X7SA 4EPEC 4DFHA 3ZKMC 3BWSA 4UTMA 3EKZA 5DN1A 3WEXA 1SFLA 2A5UA 4AJ0A 1VR6A 3MNMA 1HKWA 3PUUA 2ZX6A 3NCFB 1V8EA 1BAGA 2Y4SA 2IQAB 3O6FB 5KTEL 3B3DA 4R53A 5DCBA 1M7UA 2RD0A 5IQNA 4PJBE 4ELDA 2OK0H 4ZMOA 2VLRE 2PEVA 3U1SL 2QCDB 4APXB 1HL4A 2P26A 4AZ5A 3CSYB 1KDJA 1TFPA 4MNKA 1M1XB 2CHZA 2XUWA 1T5WB 1EAPB 1VS1A 1CXIA 4LLUA 4EO5A 4Z2IA 3FCUB 4MDJB 1TMQA 4LUYA 2VW4A 4KJWC 5E03A 4XAKD 5C0CA 2XPKA 4YWIA 3BISA 1BIIB 3SCOA 1UKTA 3MACH 3T0TA 2R4RH 1S5TA 2O6EA 4UU9B 3HR5A 3SUTA 1JZGA 1Q72L 1JNLL 4XNUH 2VQTA 2BP1A 4LEXL 5F8RC 4KOCA 5E7FA 4NRSA 4M6ML 2FB2A 3N4EA 4Y5VA 4ODUB 4XCCH 1XG3A 5I00A 2JIWA 3DX8A 4PI2A 3FPXA 3R0NA 4P9HL 15C8L 4DQAA 1GKPA 4YLQT 4MKNA 2D2HA 2ZZ1A 4IU2B 4G5DA 2VE6A 3ZTNL 4H9YA 1NDWA 5FB8B 1QR7A 2G0LA 1NGQL 3QUXA 5DD3H 4TVDA 3TZVA 4NZTL 4XBSA 2F53E 1SHSA 1RZKH 1BQLH 1CQYA 3IBOA 1P7QD 1OQOA 4GSXA 1Q7ZA 1XLEA 2XVPA 2PTTB 3T0EE 1KJVB 1H7PA 1K4CA 1O5PA 1GNXA 5D4YA 3UQNA 3MV9E 2HVJA 4AIXA 4LCCB 4OCNC 2YPVA 1QEWB 5CP3H 1FZOB 3WNPA 5KSWA 1PIIA 2FYVA 3S42A 4HHHA 2W0PA 2VZSA 2X41A 4PY8I 1QHOA 1MUJA 2WM0A 1PMYA 1UOWA 2EGZA 2ADJA 1WKYA 3QHNA 1H3GA 2X3AA 3VH8G 3H4GA 1E4WH 1ACYH 1G0CA 1MRFL 1H8LA 1A6PA 3EYVB 1XF4A 4FFWD 3IJEB 4QR6A 4JVUA 2ZVIA 4KX7A 3CFUA 1CO1A 4HLZH 2OELA 3O2DH 1KJ3L 3GDRA 3EKLA 4AXKA 3GIZL 4BQ8A 5T8GA 3WHE0 5GSVA 4MVAA 4OLXL 2PDKA 2A74B 1BYBA 4W7WA 1V7ML 4U6YB 3JZ7A 3MRIB 4RRPG 1U95A 2N1TE 4D9LL 2IXQA 4DY1A 2XWBA 4LKCB 4OF6A 4D7PA 2FE0A 2KQNA 1DFXA 1T7LA 5FACA 3UY8A 3ZDZB 4LALA 3FXYA 4KQ0A 2E9WA 4MJ6B 1Q65A 1LYXA 3UXAA 2O6DA 2YSTA 4P46C 4EF3A 3W22A 2H9GB 1SZGA 5I5RA 4DGYL 1A7RL 4L8BA 4LARL 3KCJA 5GNZA 3ET9F 1MY5A 5DD1L 1EO8H 1CNVA 1FYTB 8PAZA 4N1EA 1J87A 4PWGA 3DSFH 4UT9L 1JNJA 2OMVB 5FWQA 3PZQA 3PQYA 3R89A 3P30L 5AYTA 2TYSA 1JPTH 1X3DA 2GSHA 4JFQB 1EEPA 2VZOA 1H7WA 3NIDB 4PUWA 4GABA 2AKRA 4B5EA 4U1JA 1T2JA 3CWGA 3TCLA 4S1QH 3RTQA 4B3KA 2VX4A 1T1ZB 2WVSA 4J3WA 1XFPA 3W07A 4HWZA 4OVVA 3VUAA 3FTUA 3NACH 3KPSD 3SPJA 1W1YA 1JNHA 1TPWA 4QIUA 1VGAA 4JN6A 2IWGA 3GKFA 2OMYB 3L0KA 1XWVA 1U8LA 1X5HA 3QDJD 3GDKA 3CH1A 4M9PA 3TBTA 2DDXA 1P84K 4MMXB 4GKZA 2VFIA 3VDBA 3MUUA 1JHTB 3MV01 1WZMA 1TRDA 2NSXA 3INUH 1KGWA 2QGBA 4Q6YA 2R9RA 4FHBD 4FZ8L 1BQRA 3VSVA 2ZX7A 2EE0A 2FO1A 4X63A 3CDZB 4ZMAT 5KTEH 4KESA 3GZAA 3KYMB 3EDDA 2V9TA 5LHDA 4JICA 4OFPA 4LYKA 3K81A 3S88L 4L8DA 1OP5H 1F86A 1U93A 4P23D 1ZKAA 3TU6A 3QZWA 4WCJA 3FB7A 3DSNB 3DX5A 1QSZA 1MFNA 1EH9A 2BM3A 4YTSA 2IPTL 3WS3A 4IGBB 3PHAA 2XYCA 4KO7A 3V4PA 3S5YA 5F7MC 3BICA 1A5SA 2NY5C 3ITXA 1PWMA 2IKGA 3RUGA 1T7XA 4M6PA 4MWAE 5I66B 2VT0A 4JRFA 4QJ3B 1NCAL 1H11A 2X0VA 3B0PA 2BOEX 1FCVA 5HDBE 5JHDB 1TZGL 4LS1A 4PLKC 4UM8A 3RIFF 5LHFA 4WFHE 2P3ZA 3W1TA 2F58L 4QNPF 1Q72H 1JNLH 3VXRE 4UOJA 4W9JC 4LEXH 3AHZA 5EOTA 4I0PD 2JTYA 3VFNA 2VH5L 2OU4A 4M6MH 3UAFA 2EXOA 2OZ3A 1KQZA 4YNYB 4GUJA 2YSWA 4PBVC 3D0LA 4P9HH 2NXYD 4AYID 5IMLA 4RXFA 5TDPB 4F8PA 1YEKL 3S96B 1OFEA 1XGTA 3LVEA 1DO6A 4WI0A 1UW9A 2NY0C 3RDTC 4G6JL 4AGOA 1NSJA 1YEGH 4NZTH 4OGAD 1BXAA 3W1MA 3AQZA 4RGNE 4P9ML 2UXTA 3HG2A 4CU6A 3UWQA 5DMGC 3ZDWA 5AHMA 4ORGB 4KKAC 4TOQA 2WQWA 5ICUA 1JGEA 4ADUA 1R38A 4IMCA 4JFEB 2Y7QA 3TEXA 1ESOA 1XLFA 3N85H 3H12A 4FB7A 3SPGA 1RU9H 5ANMB 3TBVA 3BPOB 2XVKA 1MHEB 1MRFH 4FXLA 2ZP0T 1AJ7H 4OFCA 2FJGA 1JPGA 1J10A 1AGBA 1NOAA 5E2WH 4YDJA 4Y88A 4YDLC 3TQPA 3TC6A 4OJCA 5D9PA 3FX4A 4KRTA 3VXNB 1BF8A 3BRDA 3KPQB 4UV7L 2YRLA 1VKFA 5KSVA 2WC3A 1FH5L 2WMPA 3IWUA 5EEYA 1FHDA 3ME0A 1V7MH 3E2QA 4NIRA 1TVBB 4D9LH 2RA1A 5LNUA 4AVJA 1LRQA 4EUPA 4GEJA 3O8XD 1ICTA 2PGRA 3V3WA 1MLCB 4MNQA 3ZKND 4P5TC 3W7EA 3WBEA 3GD1C 4IKNA 5BO0D 4P4KB 1JPKA 1AMYA 3V0UA 1T0OA 3BVJA 4G43B 2ITDA 4PJ7F 4UBDC 4QRNA 4DGYH 5A6MA 2OWCA 1A7RH 3MLSH 3IUDA 4LARH 3RWEB 1KBJA 5DD1H 4DLMA 3IDUA 5FK9A 4W5ZA 4Y5XA 4NQEE 3GTIA 4UT9H 1DUZB 3ARVA 2VEPA 3PBYA 5AOLA 4QOKB 1HKVA 3P30H 2Z26A 2EIDA 5E9NA 3AICA 5CEYA 2AAMA 3SKOA 1CJYA 4ODWA 3GIVA 2DQIL 1MRDL 4JRLA 3LRMA 1VIZA 2WCGA 1KWGA 2ESVB 4W6YB 3QY6A 5G1TA 4M4RB 4B4FA 2CK2A 4KVNL 3WNKA 4U1GC 2RJGA 2GSEA 5IOPB 2VCCA 4Z7WB 3LM3A 3UF9A 3CC5A 4LYPA 1TO4A 1REQA 2R2EA 5CZSA 2XIIA 1E1CA 3FAWA 3TN0C 3GH5A 3VI4A 4LCRA 3RVVD 3DXAE 4MKVA 1U2HA 5H4ZA 5E4IA 1YTEA 1DHPA 4Y1AE 2FSDA 3Q01A 4L4TB 5LA0A 2V8LA 3LD8C 2E77A 1P0EA 2NYYC 4WGHA 1MFBH 5C9KA 3W2LA 3S88H 2NW3B 5HHMB 4QRAA 4RDQF 1EZ2A 3P9LA 3X17A 4IFKB 4P8WA 4HDIB 5H37G 1QSFE 4JPQA 3FT2B 2D20A 5F1IA 4FLOA 2IPTH 1D6EB 3TL5A 3BCJA 4KI1A 5CU9A 4XP6L 4KKBC 1V3IA 3GVVA 2OR8A 2DBLL 4NG3A 1KM4A 3WBWA 1I9CB 2CLFA 3UYCA 2ZQKA 4PJHE 4EOWL 2JI2A 4Z2GA 3CAWA 5LLIC 1NCAH 5I06A 2GK1B 2C13A 4N6RA 1S9YA 2PCPA 1LOSA 5AC5A 2ISFA 1TZGH 5CJQL 1B4EA 3IKCB 5A69A 2V4LA 3OZYA 2C1HA 5A8GA 2F58H 1AO7A 4QLKA 3DEQA 2K3TA 3VGAC 4KMQA 3IPWA 2XWRA 2VH5H 1VPOL 3PPSA 5I73C 1O9ZA 2RFXA 1RK5A 3IF1B 2WSDA 4HJIA 2OMZB 2VLJD 2VEGA 1YEKH 1S46A 1IXNA 5I6LA 4WTZA 5E7BA 1PAMA 4B0MB 1V6WA 3WK1A 4P9MH 2OV0A 4YHOL 1IKOP 4LHJB 3F5WB 5FA4A 1OFDA 3PUDA 1PLBA 4JMNA 2X5PA 1R3KA 2PDWA 3HCVA 3LYEA 3V0VA 1A6VL 3ARGA 2IGFH 2A7RA 2MMXA 3HGSA 2I07A 1KWKA 1XF2A 1S2VA 3KM2A 5LNRA 1OP4A 4DP7X 1NBQA 3GMMA 4FE9A 1FWBC 4H0HB 1BVKB 1KYFA 3CXHJ 1KT2B 5IMOB 3ULVC 3TPUB 3PPHA 4GY1A 3MPCA 4PWIA 1TQCB 1TQJA 4UV7H 3VFGL 5MEQB 3HV8A 2IF7A 4M43L 4QRPA 3FQTB 3SURA 1VCAA 3BZFB 4DF9A 3JUYA 4LFHG 4HGWA 1NDVA 1J8VA 4H1ZA 2MOGA 5E95B 3NJHA 5J6HB 5IQOA 3HS8A 5D7SH 1X9UA 5B80A 5A6SA 1PE1A 4A7UA 2NSOA 2YPVL 4H8VA 4F5CA 1POJA 3CMJA 4XKYA 4UCFA 4WV1B 3D4ZA 5GS0C 4AMCA 4HOWA 4MZ3A 1FO0A 1X9RA 4XMUA 5C0ND 1EYWA 3BL3A 3EYUH 1O5RA 3CZNA 3V7AG 3BP4B 3TYAA 3AGVA 3NJJA 3SDXB 5I1LA 1IE7C 1UZ1A 4KZEL 4X6DA 5CJ8A 4ZCWA 4QTIL 5JOPD 2DQIH 1MRDH 2ARJA 1CIUA 2FKPA 5DUBB 2YXMA 1HINL 3SSGA 1FNAA 2QCGA 1U1JA 2QKIC 1US0A 2ZXEB 3C8DA 2EXWC 1G7PB 4OCSH 4KVNH 1JN6B 4RRPM 4WO4A 4NKOA 1W5MA 4QHMA 4D0DA 1OAUL 3WJJA 4ZFOA 4H2HA 4IMEA 2X4PB 3AXXA 4RX4D 4L3CB 4DOHE 2XGBA 3TA4D 4X4YA 1DWJM 4UQDA 4P8UA 4FYQA 4HT1L 3BVXA 4NF7A 5GJSL 1MCDA 3EHBC 2WLIA 4NT0A 2WY3B 1RZJL 4ZTYA 2P9RA 1LP9B 3FONA 3QQDA 4YYFA 1TZHA 2E67A 5EBLA 3QDJB 3QIUC 4NSKB 1XSOA 4MMZC 4PJCF 3R5EA 4N1CA 2BRQA 2F18A 3MVTA 1KC7A 1X5KA 3N13A 3KOZA 2VXUL 5C07B 5H1WA 4XP6H 3CZGA 5I5JA 4IUOA 3FO0L 3MZGB 1F4AA 2XPGA 3CVHB 2JKWA 2V0TA 4BSWB 1GG0A 1V54B 4EOWH 2HSIA 3ELAT 1IEHA 3BSHA 4FCHA 3Q7JA 5C1MB 2PWDA 1VQTA 3P93A 3PWAA 3F7PC 2BP0A 3IIOA 3O3DB 2Y6SD 4KXBA 3FC8A 3FBKA 4H6KA 5FJIA 3UC2A 1BTCA 3QQ9D 3HE7D 5I23A 4F1ZA 5L88L 5FYKE 3GNDA 5JDJA 1Q0YL 4KO5A 1SM3H 1JGUL 1AUSL 3L5AA 4LNVA 2JELH 3GH7A 4GXUM 1T89C 3E0VA 3GKWL 1MHCB 2EUZA 4TL5A 5C9XA 3ZIYA 4B50A 2IPKB 1FGVL 2HE5A 3BXNB 4YC2B 5DJXB 4F15C 4C6FA 1A7PL 4YHOH 2NQ3A 2V6AA 2NZ9D 4YHLL 4I0PB 3N19B 2X9ZA 4G6AD 4WEVX 1EEXA 6PCYA 3V4PL 1XB8A 3ICJA 4H5SB 5GVJA 1RJZA 4I2XB 1A6VH 2NXYB 3DROB 1AOHA 4Q89A 3BGFC 4DQOH 1TQXA 4L1HA 3NN8A 4AKOA 5AB3A 5C0BB 2BY0A 4GXMA 2P4AB 2BXZA 5IOKA 3CN2A 3WV0A 1FDLL 5TDOB 5DO2C 1OGAE 1QTPA 1TJXA 3HA0A 4A67A 5A8OA 4S0HA 3PJUA 1AO7E 3QNYB 3ITTA 2R1YA 3IIPA 5CSBA 5F2FA 3H22A 2CLOA 3NJIA 4Z0BL 4OGQC 3MHFA 4FOKA 2AEWA 5BNKA 5GGSY 5DHVB 4X5XB 4M43H 1TELA 3L95A 1M2VB 3WIAA 1GZJA 5GGTH 4ZFGL 1P4LA 1IGCL 1KSRA 4OCWH 4G8TA 1UXLA 2HROA 3OBEA 3CB8A 3UWEA 2ZYRA 5JYLA 1PZAA 1ZNNA 3VOCA 4E4FA 4Z3GA 3X3FL 3FSAA 2FJHB 4YBLC 4PIRF 3S2CA 3BAIA 3IK2A 1U8PA 4QG8A 3W1UA 4YDKL 4WSGA 2DGAA 3B56A 4DXVA 3VIKA 3ROOB 2F54B 1C08B 1WSST 2PI6A 4FABL 2VC5A 2YD3A 5K9XA 3J07A 4LY4A 3PXJA 2VW7A 3W2JA 3QUKA 3L3IB 5D5ME 4KZEH 1CXFA 3EBIA 1E4KA 4QTIH 4TTGA 4PJXA 1YYAA 4GSDL 1RP9A 2VWEE 1VFUA 3GW3A 3ECUA 4L29A 2P7TA 2QUUA 1I9JH 1G4MA 1HINH 1ONXA 3MRQA 5IVOA 3QQXA 1KIQA 3O41A 3V52L 4AHPA 2AF2A 1OD7A 3LS5L 3WDRA 2QHLA 1HXKA 1F9CA 5D05A 1A4AA 1XIDA 3V0TA 3MMUA 1NLBH 2A2QT 3H53A 4R7VA 3X12A 2J8UA 4G2AA 1WCBA 3W7DA 1KENL 9PCYA 1NPJA 2A85A 4HT1H 5HMEA 3ITOA 4UFJA 1ZLUK 2N4IA 3PN8A 4JZJA 3BDBA 3S1UA 1GPOH 3L6FB 1UA6H 5GJSH 4NRYA 4XP1H 3VXPA 3LHPH 1TZIB 4ODTL 3ONBA 3NJVA 1ZSDA 4P2RA 1UJ3C 4WEUD 3S5LB 2BVUA 2PXYA 3LKNB 1GK8A 3FQNA 4P2CG 3LA4A 3JS3A 3KLKA 3VWKB 4PG2A 1OTUC 4ADIA 3E7JA 2P5EE 3SKUD 3MYJA 3QWRD 3FO0H 6FABH 4CQ9A 3MQTA 2CHNA 5H2BB 2GLKA 1S5IL 2ZQ0A 1G87A 4IBYA 2OJEA 3C6SA 5CP3A 4JKKA 3VD4A 4J3SA 3SBFA 2EDMA 3MA8A 2QGEA 2C3VA 3GRGA 5BRZD 5FYKL 3LRKA 3TNNB 3TIDA 1OAZL 3DI3B 5L88H 4JHUA 1LL1A 3UZQB 4G8GD 4U6VH 1JGUH 2VXNA 4QE4A 4TVSa 3LRSA 3GKWH 2XG4A 2X28A 3FAXA 1EIXA 3IUIA 1FRBA 4XIAA 2XIOA 2HRPL 3GSUB 3DV4B 1C5CH 3QNFA 1FGVH 2VITB 1EOMA 1A7PH 1TEGA 2FZ3B 2XZZA 3QEHB 4LVNC 2MNWA 1X7TA 6REQA 3C0JA 5CJBA 1CK0L 4N0UA 4YHLH 3CFBA 5E5UB 3HI5L 1S3RA 3DRTB 5GGVH 1NUDA 3V4PH 3G6MA 4PMRA 2YBUA 3Q1SH 1J0YA 5LIKX 3C6LD 4HLJA 3CBRA 4WU5B 2F74B 1P1ZB 4BKTC 3C5QA 5TK2A 3LPGA 1JWMB 2LU7A 4GFIA 4RAUB 3O9WA 3Q0HA 1FDLH 4YTQA 3QW3A 4HKZA 5BU6A 5A5WA 3GNXA 5AVYB 4OFQA 5E6YA 4Z3TA 4AM0Q 1SO6A 5CBIA 3R8HA 2DWDA 2Z1XA 1AQHA 4LUSB 2F1EA 1R3JB 3ME3A 1J05B 1KJMB 5KVEL 5U7SA 4Z0BH 4HJGB 3STZA 5F7NC 5F44A 3BEVA 3L48A 1MQRA 2DWEA 4W9LC 5DZVA 1AODA 2OTUB 2X40A 1WIUA 2DQFB 4ZQOA 3H42H 4TRPL 4NU7A 3KFTA 4ZFGH 2W95A 1IZCA 3WQGA 1IGCH 3DV6A 1GYAA 4DKTA 2WXPA 5A6KA 2R0WL 1SGJA 1PIGA 4LLQA 1OYAA 3EJUA 4XXCC 4JFWA 1U8CB 3TF7C 2I5GA 3OPZL 3WNMA 3U7BA 3VE0A 5T3XL 3FQRA 2B59A 5LGHL 3DX9B 4WRLA 3WL9A 2I9TB 4YDKH 3UTQA 1CGSL 2XSBA 4WU7A 1XCQA 5IVXF 3KZPA 3F7VB 12E8L 5F2MA 4FABH 4ORMA 4HCFA 3W7LA 3MQIA 4LCUB 1Q6OA 4A2DA 4DK6A 4C55A 4PH6A 4QDMA 3ARFD 3VW3L 4YDMA 2VDRL 5IGXL 1UWTA 2BSBA 4HNNA 3ISYA 3ZVVA 5DRWA 3CPRA 3PK7A 4UQ3B 1UA7A 5C2GA 2RDWA 1AIZA 3H3PL 1TTGA 3V52H 3N55A 3RAJH 3T40A 2Q2LA 1XD1A 1B3OA 3LS5H 3GMPB 2ADGB 2XINA 1FDYA 4FNRA 1ICPA 4JGMA 4EN3C 3SODB 2X4SA 2FPVA 2WKJA 1SW0A 1NJ9B 4H9MA 3PHOA 4OZFH 1PHWA 4NZ4A 2BVQB 3IGAB 3S47A 1YPZA 1AANA 4LOCA 3BIKB 1NCBL 3ZL2A 4JFPB 4C8XA 4ODTH 2ATPB 3GBDA 3PNWB 4ANWA 5IWLC 4JRXA 4WO4D 2CZFA 5MEND 4ZQCA 4MZ8A 4YIQA 1FWDC 5CN3A 5K9JL 1W0VA 3KYOA 4GRMA 1EMTH 1ISXA 2NY6B 2VDLB 5EIIB 3UJEA 1ZLPA 1X5YA 2P53A 2BZCA 2E9GA 3H85A 1S5IH 1KCWA 1KYDA 4F33A 5A8MA 1T80A 2IBZY 3K72B 4AW4A 1COBA 2CNYA 3C8KA 4EF8A 3US9A 5L4JA 1F42A 1V03A 4E6MA 4AE1A 1FTXA 3GJEA 3MUGB 4TO8A 2QSCL 1YEWA 3NJXA 1U83A 3FT0A 4WQ6A 5FYKH 3JZEA 1B3WA 1TWWA 2XISA 3UXDA 4XVSL 3LGDA 2J8UE 2WQDA 3DG3A 1T4KA 2Y1HA 4J2QA 1CECA 4BFGA 1UMLA 5DVPA 2HYMA 3QEQE 4F7KA 5DJ2A 1HCFX 1ONQA 2OMXB 5F4WA 3O8AA 1XC4A 2KLRA 1JL8A 1VZHA 3QCUL 4BFNA 1T1XA 3LB6C 2V2XA 3KLHC 2OULB 3HW7A 3S3JA 2G2RA 2HRPH 4NZUH 3L3HB 3NH7L 2FT8A 3OVRA 1K02A 4X2RA 2F9BT 3DFTA 2AV7A 3MHGA 4JIRA 4HHAB 5DZNA 1CK0H 2RCSL 2ZIDA 3SRDA 4LE8A 3HI5H 5GGVY 3HE7B 4QXGL 3QV7A 2GTWA 1QATA 1MXGA 3QWOB 1K4GA 1Q9OB 5GRVK 4NJ9L 3WTUA 4XZLX 5BUPA 4CADB 4XP9L 3BOFA 1NEUA 4HWNA 3W1ZA 4E5XG 3V79C 5I2UA 5K5YA 4KTYA 5MKGA 3TFKD 4POZD 3L3DA 5DC9B 3KBMA 3RWIB 3B3IB 3RO6A 3VFCA 4JTCA 3NQDA 3MI3A 1A6AB 2NT0A 4S3FA 4QXTA 3BAEL 4XWOC 2X4TB 2A6NA 1NGYB 3ROLB 5FFOA 3HI1B 4UT9A 1ADSA 3H2EA 4NY2A 4G6ML 1NL0L 3BJSA 4MJIB 2OWWA 3PIQB 3VFSA 5KUKA 4TN9A 4OI7A 1UXWB 1S6NA 4B9IA 1L3WA 4UFLA 1S9XA 4TRPH 1DL7H 5HGBB 2G5BA 5JOFB 3QQNA 2N59A 2R0WH 4ZFCA 5HYSB 3FJTA 4WENB 2FQIA 4QRFA 3IE4A 2OMTB 2UY7A 3OPZH 5G4NA 1A7OL 2FHFA 1UVQA 3SBWA 3UJRA 4LOFA 1KPVB 4GUCA 4OVXA 2HVOA 5HD8D 1TE1A 1CGSH 2OXGA 4NFCA 4JM2B 4AT6B 1NQKA 6PTDA 1L9SA 4OW6A 5LYRA 2VLRA 1IXOA 5IB2B 2DW6A 4QS5A 4PUKA 2VDRH 2YGVA 4KRPB 5IGXH 4WDTA 4KI5C 2G60L 3WIIL 3WEOA 5ITFB 3CUPA 1OG0A 4XNMA 3QORB 3CGTA 2AJVL 3WDPP 1IT9L 3H3PH 2I7OA 3WZ0E 2BODX 3V0AC 3C0LA 3DX6A 2DH2A 1T7VA 5DMMA 1M57B 4YHIB 1PS3A 3RMJA 3AG1B 2FDMA 1PCKA 1I4FA 2X6BA 1F13A 1SXAA 5AD0A 3AMLA 5EOQL 3SGJA 4Z2LA 4R96B 5FL0A 3QARA 4B9CA 3RLSA 4ZFFA 2D7TH 4GG6A 2PRLA 3VRIB 2F7FA 3LQAC 3H9YA 3N41F 2AQOA 4JR9L 3O45A 1NCBH 3IDYC 3EJJX 2W0FA 4W7VA 4GACA 5CP7A 4GPNA 2J62A 3CM4A 1LRTA 3KP1A 3MSDA 1IBBA 2IG2L 5CH9A 1OW0C 2AP2A 3TTOA 4QEGA 2VDMB 3KHJA 3OTTA 2OK0L 4K36A 4TNVF 3AIQA 4EX4A 3CAVA 4NZ3A 3G1FA 4H9UA 3WHXB 1J8HD 4GBXC 4QRTA 4JN8A 5EBWB 5AL8A 5ESQB 1P0BA 2H32H 2YB4A 1NGWA 3C3UA 5TE6H 3QFWA 2DSWA 2B08A 3VNKA 3TO4C 2QQKL 4IRSD 4JW3A 4PJ7E 1O6SA 3UABA 2QSCH 4RNRA 3HPFA 4PVMA 3LCLA 2XZQH 4QXVA 2QCHA 2KX9A 3WLWD 3D3FA 2WBJA 3K4AA 4XVSH 4PCNA 4GKTA 3QI9C 5E99H 2NCEA 3FK4A 1HHGB 3QWNA 1XSIA 4HJSA 3S0CA 1HEJC 1BBJA 1RIHH 3ZSTA 1QNSA 4MVBD 1XIWA 4XCCL 4DUXA 1HKFA 2M26A 2AL2B 3MYPA 4LLAA 3FV9A 3LK6A 5EZLB 3T3PF 4XXWC 3DVIA 4N9OB 4Y9BA 3OKMB 2Y1YA 3F12A 1OK0A 5GGSA 5BRZB 1R5WA 2RCSH 4E0RB 4QXGH 1GSMA 2CDGB 4G8GB 4Z7VE 4LLWA 1GZQB 4G80A 3KBSA 4MDRA 4AV5A 5D4HA 4XP9H 2X09A 4PRPD 3NCOA 1KR1A 3PS7A 4DWHA 3B8SA 2PDBA 1KXTA 2N3JA 4HKPA 5GRXG 3M0YA 1WZ1H 2Y7SA 3K5RA 1S5NA 1MCNA 3WE6A 1F3TA 1I31A 5ETUB 2ADIB 1PQZA 1Q66A 3CXHK 1V3LA 3WJMA 1A9EA 4WVXA 4YHPA 3Q8FA 3FS2A 5KSAC 3QC3A 1ACYL 3D05A 4OZHF 5TTRA 1UMYA 1L5GA 1T20B 2WPGA 3C6LB 3DGGA 2EDNA 4U1NA 1A4BA 4AQ8C 4DBWA 2J73A 4JTTA 1IM9B 4HZLA 3TBSB 3MTRA 4A39A 1HKJA 3O9WD 4ENED 4QXIA 3OJDB 3PBMA 2WZPA 4PREB 1TPXC 1I45A 1Q9LB 4IPPA 2M8XA 1OP9A 3UJTL 1S2WA 3P2DA 2V67A 2HT4C 5JLZB 1VP5A 2OXNA 4F7TA 3RL1A 3LY6A 2IAND 3VFVA 2NR6C 1YNPA 1YN6A 5K4ZA 5K3VA 3UU0A 2E7LA 5AAPA 2HKHL 1TA3A 3W3OA 1RZQA 3L3KB 2E7MA 4MXVF 2ALRA 4WEEA 5EBMA 1PBYA 1SFHA 4WTWA 5FIEA 2HDJA 5LXXA 5GRYA 3G6JA 1TCRB 2CETA 1CFNA 1FJ1A 1B3ZA 1PTGA 2CWRA 4XCNA 3IMSA 1EO8L 1MDRA 4TV3A 3EJZC 2Z65C 3T09A 5C86A 4P2OB 1YMHB 2G60H 5E2JA 4K39A 3IRDA 5E6IA 1F6KA 3NSNA 5HVHC 1U3HC 1OABA 5AYBA 4ABQA 1CU4L 2AJVH 3TYEA 4EI6B 1ELSA 1QTYT 3C8FA 1G7IA 4Z7UB 4N86A 3CV7A 3SE6A 4MWAA 4S1QL 2XHYA 3NSYA 5C3LD 3V4LA 3LKOB 1A6UL 2J43A 2OL3B 3GSNA 4WSKA 3UZEC 4AOFA 4B3ZA 2GQ8A 3NACL 3RVTD 4ZVJA 4BWUA 3BKCL 4PMFA 3ARFB 5EOQH 3ZXAC 3RLHA 1GJPA 3BQUC 2R1PA 4ZQPA 2VM4A 1M05B 5CPTA 2A6DA 3H4FA 2AVGA 5GJNA 3VXRA 2ISVA 4FS9A 4JR9H 3DUUA 1ZK9A 1M6OA 4PY7B 3WIFB 5IBLD 3INUL 3IMWA 1DJGA 5EN2B 4XH2A 2NNAB 1MH5A 2A6KA 1MJ8L 1YJDC 2IG2H 4LF1A 1J88A 2MNJB 5HA7A 1X1ZA 5CBAA 3QZNA 1GS8A 2I9EA 3P2TA 2O56A 1F3EA 4HXAL 3LKSA 2IAMD 2MCPL 3QIWA 1AZVA 4NRXA 3LH9A 1V0NA 3VJ6A 5FM4A 1HG3A 3ZJ6A 3SGUA 4GE8A 2HQAA 3TJEL 2AXGB 1HQRB 2NXZD 3ZL4L 3ES6A 5DWPA 2QQKH 4JRXD 1BYOA 4IJBA 2A4AA 1KIUB 3QJFA 2CCVA 1HIML 1CL7L 3NPWA 4A2LA 2YRBA 1NGZB 4P8QA 4MYAA 1OP5K 3EFOA 3RWDB 4GG6E 2YCKX 3CFJB 3BLOA 4FTVD 4Q4PA 4JB9L 3A4AA 3H54A 2GWGA 5EHFA 1YW1A 3WENA 4BFEA 4Q52A 2GAZB 3DI1A 3FQWA 4DJEC 1CFQA 4CNIA 1FORH 5I1EL 4X60A 4NQDB 4JQVC 4PRTA 5FGBC 2X9YA 5GGTA 3LY0A 4L7ZA 5JW5A 1YEGL 4UTBL 5BZXA 3B05A 4MKTA 3HO8A 4KDTA 1NFDE 1ZA3B 4EXAA 3KWVA 2FPYA 5CBEB 3EJYD 4UTAL 3MTWA 3CJPA 3SYQA 3GXUB 4RSVA 4X7EC 1FFNA 1VKXA 1N3NA 2ICEA 3BGAA 4X8GA 4GGBA 2Z24A 1FA2A 1SO5A 1S8DB 4AQOA 2AC0A 3N85L 3FTWA 3GGWB 1RU9L 4NQEA 5I3JA 3CL7A 2G9HA 2N1KA 3NFSL 1B5TA 3MX0B 5REQA 2V5DA 1H09A 1AJ7L 4LAOA 1Z9MA 2YBRA 4YSOA 2HVBA 1YYCA 4NDMB 5LGJB 4JQ1A 1LEGA 3WBXA 3DFPA 5E2WL 2Z91B 1J5HA 3WLBB 4QLJA 3V6ZB 5K2ZA 1U1UA 3QJXA 3UTTD 4M80A 4QHLA 2GI0A 2WLHA 1U4FA 1GKOA 5LAPA 2L04A 3NSDA 2FQEA 3ZIMA 2ZKHH 1YADA 4G1MB 2HNEA 1X38A 3UJTH 3MGOA 4U0QB 1GYMA 3IDIB 2A5HA 3SCPA 3MT1A 3Q3GB 1D5XA 4G7FA 1SLVA 1G9NL 1C7SA 1EZVY 3NCXA 4CC4C 2HKHH 2XWJB 3AXKA 3F4DA 4K3HA 2E6FA 4Y9NA 1C93A 3UROR 3DXAA 2G4GA 1E6NA 4R7DB 4NYLB 4KERA 5C9JB 3G6AB 2WLKA 4F79A 4Y1AA 1P7TB 5H4YA 4P57B 2OMWB 1HL9A 3MLSL 4QEEA 4MZRA 3O63A 1VENA 1OX5A 1BLIA 2ZG2A 1WDWA 2QVHA 1XLLA 1V3MA 4LC6A 4P5SA 3NPSC 2IOMA 3CHOA 1QSFA 3MWAA 1CU4H 4B5NA 1LD9A 4JKWA 3UWYA 3QMRA 4HJ0C 2JK5A 3B37A 3KE0A 3BUYA 3BWUC 1V3KA 2Q8ZA 4BEUA 5FF6B 3WQOA 2RAMA 5EH1A 4NCC2 4Q4RA 2J3SA 4YEEA 4H8WL 5HAOA 4PJHA 5FFLA 2MJWA 1A6UH 3MI6A 3FU8A 2ATSA 4IBWA 2YDRA 3BKCH 4MD0B 3U46B 3HG0A 1IC5L 4FAMA 2YAFA 1R85A 4WZ9A 4FQHA 2HTLC 1P5VB 5LGZA 2NY1C 1N8ZB 4XCYA 5AW4B 2YGQA 4O8RA 2ZYFA 3F64A 1ITQA 3FEQA 3SCSA 7A3HA 4C4BA 5D1XD 1ETZA 1VBHA 1MJ8H 4OLVL 1YRKA 4Z3IA 4DPBX 3ESMA 4IHOA 3DURB 1JVLA 3U2JA 1XB3A 3LHWA 4FNPA 3G6JE 1E5AA 4UQCA 3B40A 1S5MA 5HI3D 4HXAH 1MFBL 2MCPH 5AOZA 4LCYB 4Q22A 1RCQA 1BFOA 4N87A 3T55A 5DX7A 3C0QA 3SO3B 3OVGA 3TJEH 3TN4A 4ZQRA 3ZL4H 4N0CD 3IDMA 1CICC 1II4E 4ETQA 2HB0A 4NZRL 1G9MC 4HX1B 4K9EC 3L81A 3BH8A 3PG9A 3HZYB 1T8XA 1HIMH 5E24E 1CL7H 2F53D 1R3RA 4HUUA 1ZE3H 2TAAA 3DYOA 5EEZA 3TJHD 3A3HA 1J8HB 4LDLB 1ZA6B 3T0ED 2NUTA 3MV9D 3LKPA 3VACA 4QKXB 3VNDA 1PZDA 1SVZA 1KB5L 4JB9H 3KRUA 4AYFA 3SN0A 4YXGA 1VACB 4B15A 2TPSA 4F7CB 2UWEB 1NMBH 3BKJH 3DTXA 4IRSB 3JWOL 2EAEA 2QDWA 3UIZA 3U0PB 7PAZA 4N02A 2GUOA 5I1EH 1NPNA 2EDEA 2B4GA 5M3WA 5MHSD 5C0AB 4JTHA 4UTBH 4M6NL 1DJYA 1EHLH 3HPLA 2DMBA 3IRZA 3PNRB 5GZOC 2Q7AA 3BP6B 5SV3A 4UTAH 1V0MA 3RGVC 4PP1C 4X6CA 1BG9A 3FA4A 4L64A 4BFFA 2IGFL 1SJEA 4GIYA 3GTXA 3IRPX 2VURA 1LLWA 3MU7A 1G84A 4Z1DA 1OT4A 1TYJA 3QBTB 4KK6C 3S36L 3M7SA 1FWWA 1BVOA 3NFSH 1EPXA 2CA3A 1IEBA 1LO5A 3BUVA 3TC3A 2BHZA 4YPGA 4Q9QL 4HMCA 1WXJA 3ABLB 2WBWB 4PRPB 5B3JF 5DYOB 3SGEI 3QE5A 4OM1L 2PR9A 4KOBA 4L1SA 4AC7C 1H6FA 4CMHC 2W3ZA 5I1AB 3PBVA 3DHMA 4KUCF 1G9NH 4GI9A 4NKQB 4KEVA 5D7SL 2DT0A 3WLOA 1I7TB 4Q6JA 4OZFA 4QRBA 3IRSA 4TSAL 2PPGA 1A4JB 3QG7L 2R1KA 4ONOA 1SR9A 4L4VE 1XL4A 3MC5A 4OZGF 3DMMD 3GSQA 4NI8A 3AG3B 4PMXA 3U6XA 1B9KA 2PU1A 4NNXB 3LSOB 5K33A 3BTNA 4Z7NB 3EYUL 1CD9B 5F1NA 3ENEA 2XSKA 3PL6B 3DBXB 2IANB 1DQDL 2WTRA 2XGZA 1XHHA 5D1ZC 4TTDD 1J5SA 1ZVSA 4B6ZA 3ARXA 1XQ4A 3EWXA 2XQYG 1BVNP 4GUFA 5IDZA 4H8WH 3AY2A 5D9NA 2CLZB 2KS0A 2GK0A 4OCSL 1F6FB 3SDAA 2V3GA 4DLFA 2G96A 1IC5H 2VABA 5JPNB 4FXKB 4JHVA 4I7WA 3B8YA 1NCGA 2CLRA 3P3YA 1T96A 2WCAA 3T8XA 3VILA 3QVQA 1DBBL 3OU8A 3STPA 4OLVH 4MWAD 2DYRB 1O68A 5FO9A 2E40A 2ZKXA 5CQ1A 4IOFC 2OZNA 5SWSD 1GGBH 5EFIB 4Z77B 1Q85A 5IW1A 3GXTA 3VXRD 1FZJB 3KPNA 5KW9L 3BLKA 3CV2A 4S3JA 4WHTB 1U58A 2CKSA 5KSBA 2DZBA 3ESVF 3QCTH 1AD0A 4X0VA 1FNGB 4HCIA 1Y8BA 4OI9A 2G9KA 4DHGA 4ZX3A 3MA7A 4NZRH 5BOFA 3GSNL 3G1AA 5J3HD 2BFGA 2PR4H 5LA2A 1KLGA 3G5VA 1XLGA 1J48A 1FWXA 3ZE1F 2TSBA 1OGAA 1OCJA 4P0DA 4W4QA 1QBMH 4PRIE 3HAEH 2OSWA 3BPCB 4WY0B 5D2NB 5AC6A 4I0CC 4QY8A 5E00B 1KB5H 5DFWH 3WEBA 1SM3L 2KDGA 3IB4A 2C71A 3R12A 2JELL 1F05A 2D31A 3JWOH 1EXPA 4PGDA 4Z1BA 2RHGA 5C0CD 1WPCA 3WJZA 2V5RA 5JIPA 2COVD 1MW0A 1W1IE 2XN9E 2EIZA 4R85A 1RHHB 2D2OA 4M6NH 2W6RA 3QAZB 3QEZA 3ZMEA 5DK2A 3VI3B 4O1AA 1T7ZA 4CCEA 1TNNA 8CGTA 2VGGA 3P73A 1CB2A 4UOW1 2NTFB 1FG9C 1ZLWH 3BWAB 3HGOA 4X4ZA 3I7SA 5M5DA 3KBJA 3EOTL 3ML8A 4DQOL 3IDJB 3VXUE 2YW3A 4Y2NA 4ZO8A 2VC9A 3QUXD 4HT3A 5T5NG 3S36H 3TZVD 2FECL 1XWYA 4DP6X 1QAWA 2KYIA 3PGCB 1P7QB 5ESAA 2QS8A 5D5MA 3N2CA 4LUIA 5HPOA 1PKYA 4KDVA 4Q9QH 4ECNA 4HPHA 4P2AA 3L54A 1NFIB 2HG0A 1UB5B 5EZJB 3FT4B 4OM1H 4JG0L 3L5MA 5IW3A 3WUWB 3MB9A 5GGTL 3EOUA 4NQED 5E1AB 3A4XA 5T1LA 2FJUB 1HZKA 4OCWL 3P80A 3DTUB 2J7EA 3UTTB 4TSAH 4HSQA 3QG7H 5C6TH 4A68A 4L1WA 4PVLA 4X50A 4X6CE 4L6DA 1BP3B 1BVWA 2LVEA 2A7BA 1AD9A 4Z17A 2XU9A 4XO4A 1CYWA 2IWEA 1FN4A 3V0SA 5KYWB 5D7LE 5JYMA 2QDVA 4OD2A 1KMGA 1DQDH 2ZADA 3K71A 4JPVL 3VSQA 5ABGA 1H1ZA 1OGTB 4PWJA 2G41A 2P5EA 1YBQB 1JUFB 2NV2A 5EF1A 1I9JL 3KEDA 4MQSB 4GVFA 1U8HB 3HQ1A 1F8IA 2CGYA 4AZCA 5FCZA 2H32A 1NAL1 5CF3A 2QYGA 3B2UD 2VEMA 5J1AB 5HBBA 4WW2C 5BVJA 4AW7A 3UL4A 1I8IA 1QSFD 1LYQA 3PQYD 3NZGA 1NLBL 1CURA 3T3ME 5CZKA 3NZHL 1IBGL 4JG5A 5I3HA 2JFCA 1DBBH 1JUEA 1S4IA 2O72A 1GPOL 2O61B 1UA6L 4PJBB 3RTQD 4XP1L 5C2XA 3LHPL 1FQ9C 3KPSB 1R5IB 3U4FA 1MN4A 2BRRL 4BFKA 2WXLA 2EEFA 1YVLA 1T21A 2A3AA 1GW0A 3KVJA 1UFGA 2CBVA 4AQAB 3ZWSA 5F7WC 5F72S 1AS6A 5KW9H 1TQTA 1W1B1 3W5NA 5D1XB 2ZWYA 4A2FA 2X42A 5EMJA 1EX5A 4YSCA 4YNGA 3TS8A 4YJZL 6FABL 2J8GA 1E50A 5BUGA 5AHFA 5I5IA 1JI2A 3GSNH 3VVWA 4NXKA 2AQRA 1QNVA 1C7TA 4G70B 4L37B 1H41A 3AZUA 4NPYB 4P23B 3W81A 5L9DH 3M07A 2VKZG 5CFHA 3BO8B 4X0KB