2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
2XUCA 5JBDA 3CLWA 2W67A 2W5FA 2WHMA 4AD2A 2NW0A 5IFPA 3CZJA 4ATWA 3CUHA 3GNRA 4QFUA 1JFHA 1QI3A 1UOKA 4J28A 3W82A 3KWXA 4LYRA 3TTQA 1MYRA 3N04A 3IJ7A 3MS8A 1OINA 1HX0A 1XH0A 1Q6EA 3AIBA 5C8BB 3VIFA 2ZUTA 3RJYA 3ZR6A 3WMCA 4PMDA 4AXNA 1OB0A 1V3JA 1QI0A 2VTFA 5GNYA 2XG9A 4YHGA 1CGTA 1WZKA 2VQTA 1JXKA 1JZ4A 3QHMA 4FLSA 3CO4A 5CPTA 1H3GA 3CZEA 3WQ6A 4W7WA 1ZBWA 2XWEA 4PEEA 1FFRA 1LWHA 2VQUA 1QW9A 1UH4A 3FNDA 1MVYA 5KEZA 1EDTA 2VR5A 3WL1A 2WZEA 3WH6A 2EABA 2WCAA 3GZAA 1LL7A 4QCFA 1NP0A 2JIEA 1V02E 4AMCA 4WK9A 4ZEPA 1OM0A 4U5IA 2YOCA 4PTWA 3WELA 1US2A 2WLZA 2CHNA 3VOCA 3VU2A 3TA9A 3RJXA 2GJXA 3POHA 4AMXA 1K6AA 4N0RA 1JDDA 1UR1A 1QBBA 4CN6A 4UOJA 1LQ0A 2XN1A 2ZUWA 3IK2A 4PSPA 3TTYA 2WNWA 2WHKA 1VJSA 2D0HA 1FH8A 3AXIA 2WCGA 4ZE4A 3VDAA 3MMUA 1UKSA 1D7FA 3ARYA 3LRMA 5BROA 2FYVA 1CLVA 1WZMA 2WYSA 4EK7A 1SYTA 1UH3A 2FH6A 4M29A 3VIHA 1OT1A 4A4AA 3L4VA 1CENA 3WUGA 3IAQA 4MNMA 1W1PA 5E0FA 1PIGA 1UWSA 4J3TA 3ZJKA 2J7GA 3PZUA 2CEQA 5GNXA 4C7GA 4CGTA 5JBEA 3A22A 4JIEA 4W8LA 3BUIA 1JF5A 4D6HA 3FAWA 4WKFA 3T0DA 1JD9A 1QI4A 4P7OA 1BTCA 3MSGA 2EPOA 1UWQA 1E4IA 4JCLA 4R5EA 4ACYA 2CHOA 4QLKA 1F4HA 3ZR5A 1MFVA 1LG1A 3VGGA 3N11A 1XV8A 3GNOA 4CCCA 4H2CA 4UQCA 1H0IA 3CC1A 3GYCA 5GNZA 2D0FA 4GPNA 3N13A 1KXTA 2W91A 3SCVA 1DWFM 3NSNA 1V6UA 5D4YA 1ZJAA 4Q22A 1PBGA 1V0KA 2W4XA 1JAKA 4LQ1A 3A24A 1UHVA 4FNRA 5E6ZA 1H41A 5A8PA 3BUDA 4OZOA 2J62A 3KE0A 1ZS2A 3B9DA 1W9BM 2ZXDA 5E6YA 4DWSC 1TG7A 1J01A 1UWIA 1E0XA 3BAXA 1HP4A 1CGYA 3VD3A 1HL8A 2V3GA 4HA4A 3VUPA 3N1AA 1HVQA 2W63A 3W28A 2QV4A 4E2OA 3VM5A 1JXJA 4LYQA 4WF7A 1XH1A 1VJZA 3ZIZA 3EDDA 1HJUA 3WF3A 1W3LA 1UZ1A 2YLLA 1CLXA 1UKPA 1FP9A 1CDGA 4GINA 2F7QA 1U33A 1OGBA 2IXVA 1JZ7A 5E0CA 3K8MA 4M56A 4R27A 4KGJA 1ITXA 2D2OA 3W0KA 1KGWA 2DSVA 2BHYA 4AZ6A 3AHXA 5I78A 2YL9A 3W38A 4UFLA 1BVZA 4U3AA 3WDPP 4W7UA 1IT0A 1GPFA 3MI6A 3AS3A 5A6BA 1QWNA 3UESA 2XFRA 3PN8A 1QPKA 3U5UA 1E6RA 2WC7A 3EDEA 4DUXA 1NOWA 1MXGA 1J0YA 1QHOA 2ZOXA 2JF6A 2E9LA 1GOMA 3S2CA 1XH2A 4BF7A 1JG9A 2VC9A 1CGUA 1GOKA 4AW7A 2WMFA 3WQVA 3WUBA 2VRJA 5A8QA 1JZ5A 1E15A 2UY3A 3F5KA 1NWSA 5JUVA 4PMYA 4KH2A 1C92A 4CVWA 1WB0A 5IDIA 2A3HA 1I75A 3PZVA 3KL3A 1W9DM 1BPLB 3VO0A 1V0NA 1UR8A 3PZ9A 3WNNA 4CVUA 5BRQA 3PZOA 3SIMA 2ZXAA 4NXSA 2JE8A 3CZNA 1H49A 2BXYA 3WD4A 2JF7A 4TVDA 3WUEA 4EAMA 5A8NA 4HTYA 3RDKA 5HXMA 1GONA 1JAEA 2G8ZA 3VINA 5LA0A 5HPCA 2OWWA 1LWJA 2RGMA 2QMKA 3VGDA 3AMDA 1VFFA 2C7FA 4P8UA 3EYPA 2VX4A 1C8YA 4UNIA 2WMGA 3AZSA 4JKKA 2E8ZA 2WZIA 2XVGA 2D3LA 3LXCA 1QNSA 4OKDA 4QLJA 3AICA 3MKKA 3N12A 4OBSA 1GJWA 3BAIA 4B9YA 3WQ8A 3U57A 4NF7A 3U5YA 1E5JA 3WNMA 3T0BA 2G4FA 2GK1B 5FL0A 3EJQA 4Z2KA 4AWEA 1R75A 3VIMA 3CUJA 3VD5A 1UD2A 2VR4A 2WC3A 1MQRA 3AIWA 2V5DA 2VCCA 4NXKA 2XSBA 3VNYA 3CZSA 3EJSA 4OIFA 1NOFA 3VGEA 1HT6A 5M5DA 2WPGA 2WMHA 2YLAA 3PBGA 3N15A 1BYAA 4PMRA 3BH4A 3H54A 4V27A 3DYPA 2QPUA 3PZMA 1IZJA 1K9EA 4B16A 4HOWA 2GJXB 4YHEA 2WWCA 3A4XA 4A3HA 2WWDA 4MB4A 3AIRA 2WMIB 1TCMA 2YBTA 2QPSA 2VRKA 5BWFA 2Y4SA 3AIVA 3MANA 1CXEA 1KQYA 3BVVA 1PX4A 5ABEA 2GJPA 7A3HA 4NRRA 1KFWA 4Y7EA 4DO5A 2VVSA 3M6DA 4H04A 1LLOA 1ODZA 4GZJA 2WXDM 3AOFA 1D3CA 3NUKA 3PTQA 4AZ5A 3GBDA 2IGTA 1XD1A 2CBUA 1UD4A 4UQAA 4PTVA 1UYQA 3T0AA 4AEFA 1H09A 4P8XA 3GXMA 1QBAA 4LGXA 2EO7A 5GPRA 1DP0A 2E3ZA 4YPJA 2J4GA 3ARQA 3HMCA 1E6QM 2XN2A 4UQEA 3B8SA 4ZENA 4FF5A 4PCSA 3ZJ7A 2FE0A 1QI2A 1V3MA 1MFUA 4UZSA 3L4XA 3VDHA 1PX8A 1JDCA 1E4LA 1E40A 1W9PA 3GXIA 1BLIA 1QNPA 2PWDA 3TTOA 4JKMA 4TUFA 3BCFA 4RE4A 2EADA 3THCA 1ISXA 1JNEA 2O9RA 2XYLA 5ABFA 3W24A 3M7SA 4OOZA 3VIKA 2WVUA 1OSEA 2E9BA 2NT1A 4CU6A 5CPSA 1QVBA 3T08A 5E70A 3F4VA 1JZ2A 2RGLA 4ZFMA 2PBOA 4AY1A 5FKYA 2EPLX 5BXPA 3EMZA 5I2UA 4WIWA 2WHLA 1EO7A 5D8WA 3BC9A 1BVNP 4UFJA 3T2OA 2DT1A 1B3XA 2YDRA 3TOPA 1PZ2A 1H11A 5CSYA 1E70M 4P7RA 3BMVA 4U2YA 3VIOA 4M81A 2J7EA 2Y24A 1HN1A 4W8AA 3ZT5A 4B15A 3A4AA 1C7SA 1WDQA 3BUPA 1Q4NX 4UFKA 4E8DA 4CCDA 4AMWA 1E6PA 2EPMX 2X8RA 3GH5A 2FHFA 3ARVA 3BLPX 1BYBA 2Z1SA 5D9PA 1G1YA 3SUWA 3HG4A 2F1AA 4AD0A 3AS2A 3EMCA 3F5LA 4AZGA 5A69A 2WSPA 3ZSSA 1DTUA 5D9OA 4J3XA 5GQBA 2XFFA 5I0DA 1SFSA 3ARTA 4W87A 2XVLA 4HA1A 3WF1A 2W92A 3WN6A 4DM1A 1E1EA 5AYIA 2VX7A 4V2XA 1VEPA 3D4YA 2CERA 4BS0A 2J79A 2G3NA 2WHJA 1AQHA 4FNTA 3MSDA 3D51A 1EOKA 1K9TA 5EBAA 3D50A 1SMDA 1JL8A 2WBKA 3BUQA 2O92A 2OYMA 3U7BA 3WH8A 4AYGA 3DDFA 1E71M 1OBAA 1WP6A 4TXEA 1PJ9A 4NI3A 4A3YA 2F7RA 1MWOA 2X2HA 4QCEA 5C70A 2JEQA 1QNOA 5I23A 1CIUA 4D6CA 4MDOA 4TTUA 1ISYA 4IUGA 3LPOA 4ATLA 3LRLA 4D72A 4NX0A 3W37A 1TVNA 4TVCA 2VMFA 3GTNA 4MADA 3AISA 4GIAA 1E3XA 5LA2A 4UFHA 1UWRA 2O9OA 3VSUA 5BRPA 3AYSA 1AQMA 5CG0A 5A8MA 3RM4A 3S5YA 3DYMA 3SCTA 1WDRA 1B90A 3NSMA 4MJ2A 4U33A 1MQPA 3O9NA 2J74A 2VL4A 4ML4A 3WIJA 3WF0A 3VPLA 3BAJA 1LF1A 4S3KA 4J27A 4M1RA 1XSKA 4LYPA 1QNQA 2CETA 3B9EA 4CUCA 3MO4A 1J0IA 3IJ8A 4GO9A 2J47A 1W32A 3AS1A 5LA1A 1TA3A 4U31A 2PF0A 4HU0A 4HP5A 1E72M 1XCXA 4M80A 1GQIA 4FMVA 4XZBA 3A47A 3G6MA 3G6LA 4M8UA 1E3ZA 2YL8A 2D0GA 1RD6A 5ABFB 3DHUA 1BQCA 1XSJA 3KL5A 1R8LA 1GQLA 3GH7A 1JGIA 2V3FA 1FHLA 4KGLA 4PMUA 3PZNA 4MNJA 2W66A 5CSUA 3WY1A 3DDGA 1XYFA 3ZJ6A 2CYGA 3AXHA 3FY1A 5A6SA 1E6XM 4NZCA 1FP8A 4Q7NA 2F7PA 3MUZ1 4P7NA 3A21A 4FNPA 4D6JA 5BXSA 1BG4A 2PC8A 4BCEA 8A3HA 2W61A 4PTMA 1WCGA 3ZM8A 1NWUA 1XRVA 2DSKA 4OBRA 3OA5A 4F79A 1B0IA 1QOXA 3ZT6A 3IANA 4KWUA 3QOMA 4IM4A 4DWSD 2Y5EA 3ZO9A 2EJ1A 1X1NA 2X0YA 3O2LA 2ZX5A 4KMQA 4Z2JA 4MAZA 5CXPA 1GUVA 2XSAA 1LG2A 3OZPA 3SUVA 5BCAA 2UWFA 2BNJA 4PMZA 5A6BD 2C8NA 1FHDA 2YDQA 3NDZA 4TX6A 1WKYA 3TV8A 3VMNA 3EJRA 2XM1A 1CGXA 2DGAA 4UTFA 1KR1A 1J0HA 1OIFA 4B3KA 1V3LA 1JZ6A 2EPNA 1KWGA 1GOWA 1JYNA 2WB5A 3WH5A 2CCRA 3CIVA 2VRQA 2CPUA 1EHNA 1GCYA 2XM2A 1E43A 1QHPA 1GVYA 1UR0A 5FOOA 4JFTA 1XYZA 4GQQA 1JZ8A 1J12A 3DX0A 1FFQA 1HP5A 2EACA 1EGZA 3II1A 1OCQA 1C93A 2B31A 1EOMA 1JYWA 1NARA 4H8VA 3WDIA 3BVWA 6A3HA 3ARZA 4MB1A 1VAHA 4K68A 1E1FA 4ZE5A 3H53A 1NH6A 2BVDA 2WAGA 1QHZA 3RILA 3D3AA 3VD4A 2PBGA 4XUYA 3D5HA 1TFVA 1JI1A 3ECQA 4AD4A 3B9AA 1W2VA 1M03A 1H0GA 5HOSA 1KBKA 1VFOA 1V0LA 4AZHA 2CKSA 2ZICA 5DMYA 4Z2GA 1E6NA 2VI0A 4HMEA 5DFAA 1A3HA 3MUAA 2JEPA 2WLYA 3FAXA 5ABGA 3SCSA 8CGTA 4JL2A 5A6AA 2DH3A 2Y2WA 1PX3A 3QHNA 1UWUA 1U30A 2QLYA 5FIPA 2X09A 1EO5A 3EDKA 1YHTA 2PWHA 1BGAA 2V5CA 1O6IA 3WD2A 3H55A 2VJXA 1D2KA 1V3KA 2VOTA 1DWHM 3AMLA 4MNLA 1CPUA 1HKMA 3RM9A 4JL1A 5HBFA 3LX9A 2YIHA 3M07A 1WAWA 1V02A 4U5KA 1BFNA 4MB3A 3EDJA 2OYKA 3BVTA 3VMOA 3CZKA 1MXDA 3W81A 1HKJA 2VZVA 3U7VA 3ZQ9A 4TTGA 3FHAA 2XGBA 4OGZA 2WK2A 4UZUA 3CTTA 2YA1A 1NWRA 1ZU8A 4JAWA 2G3MA 3D52A 3AIUA 1UASA 1UG6A 2BS9A 1VENA 2VURA 2BHZA 3WY4A 3WEOA 1GZJA 2WW5A 2D23A 1MW3A 1OIMA 5A1AA 4JHOA 3IAPA 1NWTA 1HJWA 3AHTA 4CD4A 1X6NA 3BCDA 1B3VA 1DHKA 3BMWA 2PI6A 3CUFA 3VD9A 1BAGA 2F2HA 1CGVA 4GKLA 3FXYA 1J0ZA 2ZUVA 7TAAA 3OLIA 1UD6A 5D9MA 3GXFA 5AYBA 4BA0A 4JKLA 3AJ7A 1R85A 1E0VA 1KR0A 3KEHA 3VTRA 4UOQA 1TR1A 2F7OA 3PTMA 2OSYA 2EXOA 3AIEA 1BHGA 1B30A 2HVMA 1GJUA 5TD4A 1B3YA 1UA3A 5LYRA 4PMVA 2J78A 4Z2IA 3EJUA 2ALWA 1SZNA 2EBNA 2WKLA 1VFUA 4J3UA 1W9UA 4AZCA 3WF2A 3E1F1 4D1IA 1E9LA 3OGSA 1HJXA 3DX1A 4E4PA 4Z2HA 1TVPA 5A6JA 3F5JA 1M04A 1ECEA 4AZCB 1TQUA 3BLKA 3L4ZA 4CKQA 3L2MA 2DT2A 2BY0A 1V0MA 3DECA 3WNKA 4D6GA 4B9ZA 2BHUA 3K4AA 3WNOA 1CECA 2AMGA 4H8UA 1K9FA 4B3LA 1RPKA 4CD7A 3VNZA 3SURA 1KB3A 3BUBA 2WM0A 2BY1A 3L4WA 1R46A 1C8XA 3HG2A 3GXNA 4PCTA 2A3AA 1G94A 1O7DC 2YA0A 1BYDA 2JALA 3CMGA 2J7DA 3DYOA 4PBGA 1R7OA 2WVVB 4PMQA 3DHPA 1PIFA 1GOQA 1QWUA 4FNUA 4V28A 2J7FA 1R34A 3RMEA 4M24A 2WBGA 2OSWA 2FGLA 2GJRA 3LRKA 1XHGA 3MMDA 3WD0A 4H7VA 1C3FA 4GI8A 1JIBA 4WSKA 1RH9A 1V08A 5F7UA 1HJQA 1UWTA 1V6WA 3I3BA 1RP9A 1V6YA 2WCSA 3AXXA 1B3ZA 4W89A 5JBFA 1TQTA 1EDQA 3K8KA 5A94A 2OYLA 3BSGA 3UCQA 1CTNA 5CGMA 1EQPA 2OWXA 1J18A 4J3SA 2QF8A 1W1VA 4AISA 5E1QA 4UOZA 4W88A 2WSKA 3WFZA 1IV8A 3WBAA 1HJVA 4HPHA 3ALGA 4DM2A 4F9DA 1KQZA 3K8LA 5I77A 3GM8A 3AS0A 2OW7A 3SCPA 1A47A 1WNOA 3CH9A 5IHRA 1FH7A 1XSIA 4C7FA 1Q6DA 5DT5A 3K1DA 3WH9A 4JFWA 3VSVA 1M53A 4DO6A 1UR4A 2FGZA 1HWWA 1ZB5A 2D24A 2WZHA 1M01A 1W9XA 3TP4A 4UQBA 4J3VA 4CD8A 9CGTA 4W8BA 3AHZA 3W27A 3VIIA 3O6AA 1HTYA 3SCQA 1OT2A 1TE1A 4NZFA 5FL1A 1TQWA 5KZ6A 2BFGA 1ZBCA 3DX2A 3IJ9A 1WZAA 1NQ6A 3MUIA 3WNPA 1H1NA 4PN2A 2GUYA 2CKRA 2JIWA 3CHFA 4IISA 1ZBVA 4GQRA 3KLKA 4AIUA 4DO4A 3EBVA 3L4UA 2OSXA 1NP2A 1H2JA 2ZUUA 1R47A 2XFYA 1C91A 3OGRA 1GHSA 2OLHA 5BYWA 1J10A 1JNDA 2D20A 3ALFA 2FH8A 2QHAA 2XWDA 4ZXLA 2E4TA 3KL0A 4UFMA 4QDMA 4AZIA 1CXLA 1MW1A 4X0NA 1ESWA 1GVIA 1W91A 4FNQA 1SMAA 1UZ4A 1QX1A 4TOQA 2XTKA 1HXJA 4PMOA 2J25A 2W62A 1N82A 1XCWA 1KXQA 2VZTA 5M3WA 2O9TA 4MB5A 3A5VA 3CGTA 4FK9A 5EB8A 2ZWYA 5I5RA 4UFIA 4FNSA 4HZ7A 4WKAA 1KTBA 3CHEA 2J7BA 1DWJM 1X6LA 1O7AA 4LPCA 3L4TA 3M46A 3OLGA 3AIQA 5DEZA 2FHBA 1L8NA 1VRXA 4U3CA 3SUUA 5AC4A 2GDUA 1UKTA 1LL4A 2VZSA 3ARRA 1DWAM 4P8WA 6TAAA 4F9JA 2F8QA 3OIHA 3WNLA 3W29A 1UQYA 3WF4A 3BAWA 4QAWA 2ZIDA 1HNYA 2YDSA 3EJTA 3LXAA 3AYRA 4NRSA 1UR9A 3OG2A 3RCNA 2WKGA 2CIPA 3LPFA 4D6FA 3WY2A 4TVUA 1FH9A 2J77A 3BLBA 1VBRA 3CV5A 1MQQA 1H4PA 2YL6A 3FHQA 4DUVA 7CGTA 4JHZA 1E5NA 4HA3A 1E6ZA 4BQ5A 3ARPA 1E73M 3UG3A 2YA2A 1WO2A 4TX8A 3SCOA 1VBUA 3UR8A 3ARWA 4PUEA 2ZWZA 4WJXA 2X2JA 3W6LA 4PYSA 5IXEA 1EH9A 1JYVA 1SR0A 1V6XA 1HVXA 2O9PA 3QR3A 2Y8VA 3WQ5A 2AOSA 4AD5A 1W2PA 2DT3A 1VEMA 3BAYA 5I24A 1HXKA 2XN0A 5FCZA 2AAAA 3MUY1 4MPKA 3VIGA 3WL0A 3SCWA 1CEOA 4GI6A 1ZL1A 3OLEA 1XC6A 3OB8A 3PTKA 2BXZA 4HOXA 3WMBA 3MMWA 1JYXA 3A3HA 2V3EA 4HOZA 3TTSA 2VUYA 4D6EA 5CJ5A 2VCBA 4H8HA 5E9AA 2CXGA 2WVSA 3EJPA 2IUZA 2UY5A 1R7AA 5CLWA 4BQ4A 3GBEA 1E6SM 2XIBA 4CN1A 1ISVA 3WY3A 5CQ1A 1VF8A 5JIPA 1VFMA 3N9KA 4JFUA 3HZ3A 3A6OA 3W6MA 2XVKA 3APGA 1UR2A 1AQ0A 3NJ3A 1LL6A 4GZIA 3CZGA 3WUFA 3CZLA 3N18A 1CGWA 1XGZA 3PZGA 3VILA 2YFNA 4JFVA 3I3EA 2WANA 4JCMA 3VDBA 3NCOA 2NSXA 1S46A 2D73A 4AYSA 4P7LA 1RP8A 1KGUA 3ZMRA 2E0PA 4F66A 2WMJA 3SCNA 1CXFA 1ISZA 5DO8A 3PZQA 1KWKA 2YJQA 4AD1A 1GOIA 1FOBA 3CUGA 3WDHA 2DIJA 2HISA 4JFSA 1BG9A 1CXKA 1UD8A 1R87A 4CCEA 3WQ4A 1EIBA 3K4DA 1W3HA 5D8ZA 2PB1A 2BVYA 5D9NA 1KCKA 2ZX8A 2CITA 3BAKA 2J7HA 2X2IA 2V3DA 3ZT7A 3NSXA 1AVAA 1L0PA 2YL5A 4HZ6A 2WC4A 3BVXA 4OJYA 2A3CA 1B3WA 3BSHA 3UETA 4DUWA 3MV11 1G0CA 1EDGA 2DT0A 3AHVA 2X05A 1HKKA 1NM9A 3LPGA 3AHYA 2JFEX 2OW6A 3QOKA 1V6VA 5A6MA 2ZX9A 1HL9A 3VIPA 1UA7A 3FW6A 2ZXQA 4XV0A 3I3DA 1V3HA 1UKQA 4S3JA 4YN5A 3SCUA 3S6TA 2CBJA 3WBEA 4LX4A 4XX6A 2UY4A 4UQ9A 1Q6GA 4J7RA 3LMYA 1B1YA 5A2CA 1OWQA 4HU8A 1V03A 4LXFA 1GORA 1WDPA 5BXRA 1JDAA 1HJSA 4W5ZA 4E8CA 1LJYA 2CESA 1E56A 3HU7A 1BGGA 2VZUA 2XVNA 3BXWA 3VIJA 1JFXA 4OOUA 2ZX6A 3HG3A 4FLOA 1ZBKA 2J75A 3OBAA 1UQZA 1E55A 3WDJA 1GHRA 1PS3A 4U2ZA 4MNKA 1QNRA 3AROA 1ITCA 3BVUA 2GFTA 2VCAA 4EKJA 4J3WA 2CBIA 1G01A 1VEOA 4FLRA 2J8GA 5HDRA 5A3HA 2G3IA 3AMGA 3NYDA 1HF6A 1C7TA 2GVYA 5EFDA 2Q8XA 1G9HA 1TA3B 1WE5A 3LXBA 1JZ3A 3JUGA 3EMQA 2Z1KA 4NSBA 4AZBA 4QLLA 2OWCA 2ZXBA 3SUSA 3WDQA 5EFFA 2BVTA 1VIWA 3CHDA 3KZSA 3UG5A 4RE3A 1PZ3A 5CGTA 3VGBA 4GXPA 2DEPA 5DF0A 4HZ8A 2ESCA 3RIKA 5A6LA 3T09A 1OGSA 4X9YA 3N17A 3AMKA 4AC1X 1J9YA 2GK1A 1UD3A 3WD1A 1CXIA 3POCA 2ZE0A 4CU7A 5FD0A 4BQ3A 2X2YA 2ZUSA 1W1YA 1GOOA 4XB3A 3WQWA 2X1IA 2ZUNA 1C90A 2VX6A 3MU7A 2G3JA 3WSUA 1KXVA 1UD5A 2XHYA 4ZXOA 3VX0A 3WMSA 4GZEA 4WSJA 1EA9C 2DQXA 2E40A 1KBBA 1Y7VA 4WKHA 2WMIA 3AZTA 1F4AA 3VM7A 3CHCA 1CWYA 3CBWA 3L2LA 4CN4A 4AEEA 1GW1A 3BGAA 1QW8A 1B9ZA 4HMDA 1WDSA 3VDCA 2XGIA 5ECUA 4H41A 5A8OA 3RO8A 3SUTA 5IFTA 3NDYA 1I1WA 4C7DA 4BQ2A 1GQKA 5EMYA 3WKZA 2WMKA 2ZX7A 1PEZA 3NIYA 3VVGA 2VNCA 1B31A 2VX5A 2VZOA 3D4ZA 4MJ4A 3HN3A 1UUQA 4P7QA 2C0HA 1W3KA 1E0WA 4PMNA 2EPKX 1OGGA 5JIWA 1UKOA 5CZKA 1R33A 5CPQA 3OGVA 4BZYA 4F8XA 6CGTA 5ABHA 3SEPA 3ZJ8A 4GO8A 2WVVA 1Q6CA 2D22A 4PRWA 2D1ZA 5A2AA 2WVTA 2GDVA 3W53A 3MV01 5CLTA 1IZKA 4P8VA 4AD3A 4ATDA 4OUEA 3W26A 3DX4A 2XJ7A 2XPKA 2A3BA 3PZIA 4GI9A 1YQ2A 2J7CA 1W3JA 4AIEA 2PWGA 3VGFA 1AMYA 1H5VA 1V3IA 1NOUA 1M7XA 5I79A 5HNNA 1EXPA 1WZLA 1DEDA 2DSUA 1J0JA 3VGHA 2J8FA 2DH2A 4L4PA 3GXPA 4UQDA 2BY3A 2PWFA 2V38A 1CXHA 4WLCA 3ZOAA 2VO5A 2IXUA 4HPGA 2GSJA 3A4WA 3QHOA 3WH7A 2YKKA 4KRUA 5M03A 1TQVA 2FHCA 1US3A 3WD3A 1PAMA 2F1BA 4M82A 1ODUA 3HJEA 1J11A 3S5ZA 2DPEA 3ZSTA 4W7VA 3RPMA 3WFLA 4AIOA 4W93A 1E4NA 5C71A 5A6KA 5A2BA 4W86A 5DT7A 3GXTA 1UH2A 4CU8A 1VB9A 3PZTA 5IHSA 1KTCA 1JI2A 3DX3A 3J7HA 3UEQA 5AC5A 1XD0A 4KRTA 4EE9A 2D3NA 3IGUA 4UCFA 3T2QA 3CUIA 3WENA 4W85A 4D1JA 2YFOA 2FDMA 1B2YA 4ACZB 2MANA 3ARXA 3GXDA 1HKIA 2CBVA 5E09A 1QI5A 1KXHA 3AZRA 4W84A 3FN9A 1ZJBA 2PWEA 3UR7A 4N42A 1ISWA 1C8QA 2XIIA 4ACZA 5I3DA 1P6WA 4X0VA 4W5UA 1GNXA 5HPOA 3UERA 4FLQA 4HMCA 3AFBA 4PMXA 1EQCA 3WEMA 1K9DA 1JF6A 3GDBA 1EHAA 1E4MM 1DWGM 4CD5A 3HG5A 1TUXA 3KLLA 2EEXA 3DC0A 4MTVA 1I1XA 3CPUA 1TMQA 3TONA 3VD7A 4L4OA 3UG4A 2DSZA 2BY2A 3EDFA 1Q6FA 4XZWA 3VKKA 4RE2A 3PHAA 1G5AA 2YBUA 4NZJA 2X0HA 4EANA 1W1TA 3THDA 4RL3A 4PTXA 2Y8KA 3OZOA 4D71A 5M17A 3LPPA 4IPLA 3A23A 3AQUA 4Z2LA 1KGXA 3QGVA 2DSWA 3L4YA 4MAVA 2DIEA 3RM8A 3AMCA 4D6IA 1R86A 4MDPA 2EAEA 4URIA 1PPIA 5A95A 1WPCA 5BXTA 1FA2A 2E8YA 3WDRA 2E9MA 1CNVA 2VVNA 3K46A 4PUDA 2ZUMA 1T0OA 1W9VA 1DWIM 1JD7A 3VX1A 4D6DA 4DWSA 1CYGA 4JZ5A 2A3EA 3CMJA 1OD0A 1U2YA 1Z32X 4IPNB 4QP0A 4AZ7A 3GH4A 2G41A 3CZ8A 3VSTA 4DWSB 2F61A 1CBGA 1J0KA 3OLDA 1MW0A 2TAAA 2VT0A 1CZ1A 3ARUA 4UR9A 4CD6A 5I6SA 3W25A 3WEZA 2UY2A 2F18A 2NT0A 3AI0A 3W4RA 5AY7A 1HIZA 1BYCA 1BSIA 1TZ7A 2EQDA 1GQJA 1TQSA 3ARSA 3T2PA 1BF2A 2BV9A 2XVPA 3VMPA 1KCLA 1MW2A 3SCRA 1OD8A 2QMJA 4PSRA 3GNPA 2DDXA 2CNCA
chains in the Genus database with same CATH superfamily
4GYFA 3OKNA 4IRSD 5LGZA 1EEXA 4L4VB 1ZUAX 2XUCA 2CMRL 3QY8A 5GGRB 1S2WA 2WOBA 3O3BB 4HXAL 2DJSA 3QC0A 5JBDA 4NX5A 3CLWA 1AZ1A 3L3GB 5JIQA 1UOWA 3QQ0A 1SFLA 5D7EA 1QG3A 2IJ0C 4HHLA 3EYOB 2OZ4A 2W67A 2X3AA 2ESVD 3LN4B 2A3TA 4ZT1A 5E9DE 1TPC1 1L9NA 1DLHB 3SKOB 4MSWB 1UZ6E 4UM8A 4ATWA 4QFUA 1JFHA 2LE9A 3FN0L 4X4ZA 5ACMA 3G6DL 2VN7A 1QXLA 2ZNXA 3FB8A 2YWYA 4ZO7A 3S34H 5SWSD 5LGYA 3N04A 1S5MA 4M5PA 1Q9WB 1EAPA 1VLXA 3IJ7A 2YRPA 4JUSA 5DFVC 3O8XD 2ZKHH 1OINA 1A7RL 4AY0A 4XRCA 1JN6A 3ARFD 4TUOB 1Q6EA 2VWTA 4WDWA 3VIFA 4YGVA 1TSHA 5GISH 1ASQA 1LO3L 3E2HB 4KMLB 3NXFA 2PGFA 2G5BA 3ZR6A 3WMCA 1V5JA 2WAQA 4UB0H 5LIKX 4GRWB 1DJWA 3ZW3A 4AXNA 3X12B 1LL1A 5CZXC 1JWUA 4XCNA 3BWAA 3PAOA 1LRTA 1V3JA 2VTFA 1QI0A 3TOYA 1KC5L 2EVHA 4BK8A 5CZTA 1K4DB 4JG5A 1CGTA 3IB4A 3K3QA 2VDLL 4P2CG 4S1QH 3L3HB 1OD9A 4C56A 5E95B 3THAA 4NJJA 4XI5C 1ODAA 4HX1B 3CZEA 5CS7A 4F2MA 3ELAT 4M4PA 3R2GA 3E38A 1XGEA 3WSQH 3KX6A 1A7NH 3R18A 2Y1VA 4OM0L 4C83A 1L9QA 3OKOB 4JR9L 4PEEA 1D2PA 4YHML 2O55A 1S4IA 3FYIB 4F57L 3ZZQA 1K5NB 1LWHA 2VQUA 4G6MH 4UBDD 4UB9A 4WSHA 1QW9A 1N7MH 2EDXA 1LXMA 3HE6C 3OG6B 4MHHI 1DFBL 1QFWL 5KEZA 4XPGL 3TS8A 1YDYA 3MBFA 3WJLC 1D9KA 3B9KC 3SO5A 4EIZC 1A80A 1OABA 4B3EA 4GEJA 2P3EA 1SEQL 4DVRL 5ISZE 1NCHA 1OLZA 4GIEA 1NP0A 3NYZA 1TJHH 2XJLA 5I3KA 4DKFH 1YNTB 1X7QB 4DLFA 1I1YB 2DJ4A 2EXYD 1H63A 3LZQA 4PTWA 1V10A 4WV1C 2VUOA 4XMPH 4YC2C 5ANME 1EEQA 1EFXA 4V1DE 1ZT1A 1TZAA 4IGBB 4XKYA 1YEWA 1G6CA 4FMKA 3LPWA 1I1AC 4K9EL 1NIUA 1QPNA 4BWWA 1DFBH 4PA8A 2PDGA 2QUVA 4U3SB 1MJ7H 3SN0A 1JDDA 1UR1A 3EKCA 1S7UA 3GIQA 1IEIA 4PJFA 1KT2B 4OT7A 3B2XA 5G5IA 4CN6A 3FS9A 3EOOA 3NGFA 3CLMA 1S5IL 2IADA 3PU7A 2X70B 3TVAA 3VA2C 2ZUWA 5K9QG 1FLTX 5IF0A 1SO3A 4PIBA 3QYCA 2Y88A 2H3NA 4S3FA 3FNKA 4YDMA 2P53A 2YD0A 3T8XA 2X4QA 2NQHA 3GTXA 3LNPA 4A7GF 2X7WA 2AQNA 2G5RA 1I4FB 2K78A 4PJ7E 5F2LA 5HGDB 4HF5L 4PB0H 5KTEL 1X9RA 2VMJA 1TV3A 4UMCA 4U1KA 3L9BA 4BHUA 3WIIH 2XA3A 3WJMB 3TR2A 3CQ0A 2R0KH 5DZOA 1TPEA 2MCPH 1XINA 2BNJA 2P88A 3LRMA 3QISA 3NSCA 1TTGA 2XQ0A 4YZFE 2FYVA 3MOQA 2WYSA 3U4EA 1LJMA 5DLCA 5REQB 2VQ1B 3H9SB 2PO6A 4EK7A 4DB7A 5GISL 3TSBA 2ZTJA 4M29A 4Y2NA 2GL5A 3EW3B 4JGMA 5K59E 1F8MA 1SY6H 5CKGA 2F54E 3EBGA 4RAUA 3K6DA 3SDXF 1REQB 1TMLA 3NJKA 3IAQA 3NQ2A 4HULB 4AIZB 3IDYB 4IPPA 1UWSA 2FJGA 4J3TA 3SCMD 5DMMA 1VRSA 3ZJKA 1XRFA 1NFDB 2WP3O 2QSQA 1BFVH 3TYDA 5TQ0H 2QJHA 4HUUA 1ITQA 4FJ6A 4MWAE 4OAWA 4DWDA 4C7GA 4LARH 1HSBA 1A5BA 5JBEA 5AVVB 1JPTH 2ODHA 3TBYB 2HA1A 1UADC 4FABL 1TPUA 2Z00A 2QVTA 4W8LA 2QELA 4HJEA 4Y2DA 3V4VA 1JF5A 1A3RL 2GGHA 4AY8A 1DL7H 2KZBA 3CSYA 5C0DB 2KMWA 2NX5E 1KY6A 3T0DA 4RFEB 3AU6A 5DJXB 1BTCA 2FQFA 1TTCA 1XCTA 2YEZB 5BVJA 2VFHA 4GXVH 4NY2A 4N6RA 4IQJA 4NZ4A 4YX2H 2DF3A 2B4CC 4PD4K 3M1CA 3LCFA 4AMAA 4WUUD 1ME9A 4C91A 4NRZA 4HUMB 4I5BB 4ABUA 1E90A 2OA9A 4KY2A 3D3VB 4UTAA 5KSBE 4R5VA 3CHRA 4A05A 3VXUE 1JWSB 4O15A 3N2XA 5DJXA 5HJLA 2BP8A 3LB6D 4IXXA 4K3GA 1RHHB 3TO4D 3VGGA 5CR1A 4NQDB 3GNOA 5DXXA 4MJJA 1Y0EA 1NBYA 5BQDA 3O45A 2Q09A 4U1NB 5FX3A 1P5BA 3IFLH 4XT1C 4WWKA 4QJ1A 1G6RA 1CLCA 1GY1A 4HDIB 3RVVC 3GRIA 3SW6A 3CXDL 1IKNA 3WE1A 1IX2A 1Z5LB 3NCJH 3N13A 4O58H 3U2CA 5DZJA 4TQPA 3QI9B 1FPTL 2C15A 4JG1L 4JM0A 4PY7B 3I9GH 4HIJB 2IG2H 2FIRT 1XFCA 5E00A 3S1XA 3TN3A 5D4YA 4UIOA 2YD1A 4QXWA 1XIMA 1PBGA 1KFBA 5HQEA 1EK3A 4LQ1A 4IBYA 4HSHA 4YSCA 1WF5A 1H5YA 1YBQB 2IDCA 1H41A 4ZQNA 2A2QT 4LY4A 2CALA 1ML1A 5A8PA 3E9TA 4QUOA 4Z3IA 1J8VA 5HAOA 3MAWA 2EEFA 5HYSA 3B9DA 3FU9A 1NLBL 4J4PA 4KROC 3OPZH 5I5JA 1GJIA 4C4KT 1U8HB 4XN2A 2W0UA 2FBJH 2Z8VC 1UOLA 4PGZA 4ZTXA 2CLPA 2GITB 4HAFA 3FUKA 4M61B 3BN9C 3TN0B 4Y2WA 2I9TB 1JQXA 3VI2A 3UGRA 3BAXA 4I0PC 2PDFA 2Y06H 3KHDA 3LGEA 3VYNA 1CGYA 1BAWA 3ATFA 4KAQH 4LIQL 3RFAA 7PTDA 3HOGA 1S7RA 3LZRA 4FKEA 1BXXA 4MQ7B 4Y5YC 4HA4A 2H32B 3IJIA 3MN8A 4LVGA 2R83A 3W28A 2WZ6A 3LLDA 1F45A 1VJZA 1HKFA 4EXQA 3U4KA 4GPVA 3U2JA 1QR7A 3ALWA 1I7RB 4Z7VA 1B4LA 3GINA 3C12A 5C0JA 2RAGA 1Z9PA 1SRDA 2XWTA 3MA7B 1UZ1A 4KRPC 3UJIL 1CLXA 5IVXE 1FP9A 1TMHA 1UKPA 3VOCA 4YTSA 1XGQA 1C9SA 4WY7H 5I76A 4E5TA 2P10A 1U33A 2GWNA 2H9AA 1TJIL 5HGBB 4N0UA 1NGYB 3L45A 2VSCA 4HHWA 3GLDA 4LALA 5H94A 2CBMA 5E0CA 4FERA 1Q7QA 4Y16B 1E28B 4O0QA 2VSMB 4MSWA 1K6QH 4UM8B 3EJZD 5HHNA 4TQHA 4JTDA 1HAUA 1ZHAA 4UMGA 4M7SA 5I02A 4LSSH 5EPDA 4M56A 4R27A 1QZ1A 1L9PA 5IFAH 2CWRA 2Y9RT 1CZ8H 1XX1A 4MFHA 1TJ2A 5CCGE 2FGWL 2N7SA 4HJGA 3WHE0 2DSVA 4ZPVA 2AK4A 4L3CA 5B39A 1KBJA 3GDRA 4X83A 3LHZA 3W38A 2H8ZA 4MKVA 1BVZA 1O5QA 2KQNA 1YEYA 1AHMA 1GQNA 3G5ZA 2OCJA 1EZUA 2WKOA 4JREC 5ADOL 1IUZA 3E6HA 5F89B 2Z31B 1HOCA 1WCQA 5D2LB 4N8VA 3T78A 3UJ2A 1QWNA 1CL7I 1O12A 3C5ZA 4LDEB 4WFEE 1G4MA 4JFHD 5I3JA 3VWJD 1EXUA 4EPBC 2H5UA 5LBVA 4L2LA 1IGCL 3Q1SL 3K72B 2A9ML 5EPMA 4U1LA 4LHJB 1HOCB 1I1YA 4NIYE 5D2LA 3RVTD 4L3AA 4QRPA 2H2PC 4PL2A 4XVJL 1MXGA 3K80A 4PJDB 3G1YA 3NOYA 1FO0H 3UGXA 1DE4A 3Q5TA 3H4FA 3NXLA 4ENEC 4OFYD 3U83A 2JWYA 1OTTD 1EC9A 5CN3A 2PTYA 2ZOXA 3V0UA 2E9LA 3F4NA 5T8IA 4OY9A 1W9DM 3B43A 3C6LB 5EOQL 5I0WA 2CW6A 4EI6B 3VRIB 5J12B 4R7DB 3B9OA 1LLWA 2ALAA 5DWUH 2ED8A 2IQTA 1H6UA 3PJLA 1RLBA 4X6BB 2BO0A 5CMAA 5CUSH 5J9PB 2WMFA 1KBWA 2OSLB 1N6VA 3MACL 2AITA 4MCNA 4JDTL 1IBGH 4O2EB 1HINL 3RWJA 4BM7A 3TEWA 1NWSA 3ABOA 3DKLA 3V0TA 2XWBB 3VC5A 2ZOUA 1KJ2B 3QMRA 2ZPKL 5F1UA 2XA8H 4A8NA 4KH2A 4ASTA 3GKWL 4WNQB 4CW1B 2A9DA 3LD8B 4HWNA 4FHAA 4ERAA 5IP4A 5IIEB 4X6BA 5IDIA 3LTVA 4HEPA 1V7NH 1MIEL 3GSMA 3VO0A 4M62H 3VXNA 5AHNA 2N7AA 3PZ9A 4HK6A 3TH6A 1HS6A 2ZCZA 5E1AA 3H1ZA 1S5HB 1SN5A 5BO1H 3GC4A 3F58L 2KZWA 2WQXA 3SIMA 3IJEB 4FP1A 1AKJD 3SZ8A 3B0YA 5ITFA 2BSTB 4JIRA 1UA6H 3B56A 1I9JH 1QNZH 1MHPH 2XXCB 4RAUB 3D7PA 2J71A 3TA3C 4ATTA 4H01A 5AAPA 4L37A 4LPWA 2NUTB 5L6YL 3O07A 4IBZA 2XU2A 1PB0A 5LAPA 3RVWC 5EZPA 2EUZA 4OCRL 2HMCA 4CNPA 1MRFL 2EDQA 4UNTA 3PF3A 2Q86B 3NZ8B 4TVDA 1QQDA 3LD5A 3IGFA 4PJAF 3ZE2F 5E2TH 3UBXG 3KVMA 1DQQB 3HNTL 3MO1B 1AL8A 1XICA 5GHWL 2G2RA 4FJYA 4LL9A 4HTYA 3RWIA 4OI9A 5D4JA 1KCRL 5K9KA 4FG2A 1U8JA 1AC6A 1ET5A 1MEWA 1OQOA 1REIA 3VINA 3E2SA 1JV5A 1WGVA 1TJ0A 1Z5HA 5I15H 2NWSA 2WO2B 5AWNL 4PJ5E 2OL3H 3T65A 3KPQA 2PYEE 4OLVL 4JPVH 2K3TA 3ALXA 2OWWA 3VKJA 2QHRL 3E96A 4EVZA 2XTSA 1XIEA 4K23H 2DWTA 3VZYA 1LTXA 2HJKA 3EWZA 1AR1C 1SGKA 2C7FA 3BO8B 3ZL1A 3HF3A 4ERIA 1GS7A 3ESVF 1JN6B 1QMUA 1DN0A 3QEQE 4N4YB 4TUOA 5IEHB 3FTZA 3ANUA 2EDHA 3FU7B 4UNIA 4DKEL 4JKKA 2GCYB 4M1GL 2E8ZA 2OZ0A 1FN4A 1AXIB 2VDLB 1ADQH 1OC7A 1NBYB 4QLJA 1BM3L 3FFCB 3PHQB 3ZLHA 2R29A 1D3HA 2ZTKA 2SEBB 1MJJA 5J1AA 1OFAA 3GJEA 2ZDSA 2CJSA 4MS8C 3BAIA 3AQXA 2UZ9A 3WQ8A 5CJOL 5AVUB 2AJXL 1EAQA 1FIEA 1LO5A 5CR8A 5KJ7E 3BJFA 1DVUA 4X7SH 3K6SB 1E5UI 3LV6A 3W9DB 3C86A 3FB5A 3FQTB 2M2DA 4YQXL 3UX9B 3V18A 2KC0A 3LCYA 3WNMA 3T0BA 4WI5A 2FVMA 5JLZB 3CT2A 2XQYG 3GY1A 4E2BA 4QIRA 3NO1A 1MVUB 2YCEA 1U8CA 1N0LB 3EJQA 4X6CB 4I1PA 5IVOA 3DFTA 3LV5A 4R5TA 3DC8A 3V5DB 2ZNWA 1TVHB 5KOVC 3VIMA 3CUJA 1R3JA 1UD2A 3PGFH 1W31A 5HMSA 1FHGA 2AXFA 5J0BA 4NYUA 5EIIB 3RRAA 1DBAH 4FIRA 3ZKNC 2EE0A 2NY2C 2Y7QB 3FQNA 1AQKL 1PYWA 5ICZA 4NXKA 3SE4C 1OFDA 3VNYA 2VCCA 3IIOA 4WJEA 3CZSA 4OIFA 1NOFA 4L3EE 1UOZA 4XCYB 3QMSA 4JQVA 4JRXB 1T1YB 4EIUA 2EIKB 5LBSH 3N15A 3SZKC 4GJJA 1SVZA 3JXAA 3VD1A 5DTFB 3AALA 1M71A 3CSGA 2HXUA 3FO0H 3GBML 4QRPD 5L2JA 3T1FB 3W1RA 5DC0A 4E9XA 4GIRA 1MHPL 3CV6A 1KG0A 5EU9A 2DIAA 1R9ZA 3MDJA 1R3KA 1SPQA 2WBJD 2WWCA 3WIFB 4A8RA 4CC4A 2MNRA 2FD6L 2DDQL 3S37X 2WWDA 3VWJA 3ES7A 4LEFA 2IOOA 2PPAA 2ZCKL 4PAZA 3GKAA 2EGZA 2YBTA 4KCVA 1BZ8A 3MRJA 2IIJA 1HQRA 1DBMH 3MJ7B 4K9EC 5CSZB 1V7NL 2BSRB 4XH2A 2FX9L 1H0DA 3K71B 1KQYA 1PX4A 3OHXC 2ZRYA 2B3IA 1JNLL 4TLTA 5LZLA 5LBGA 4AQ1C 2EEDA 2X4QB 4YHOH 3S5NA 4CBPA 1M7DB 3SY1A 2BSLA 2AK4D 4TQ8A 4FZEL 3A67H 2BIMA 4NRRA 4PJFE 4FX7A 3QJXA 1O9ZA 2EYTA 1ROWA 1YNLH 5FECA 4PJGF 3GJFB 3QEUB 3BXNA 4DP4X 3GKFA 3PNRB 4ES9A 5EDXA 3JTBA 4O00A 2ACQA 4H04A 5DJ8B 2OELA 1SSDA 2VQ4A 1ODZA 4GZJA 3GVVA 1QASA 3EYVA 2CHRA 5LGJA 2A6JA 4FL4C 5BS0D 3BOXA 1BZ7B 5G55A 1KCUH 2IGTA 3VQMA 4V2BA 3M5XA 2WD0A 5IB3A 1XD1A 3RG6A 1OCNA 4Y7MA 1UD4A 1S3HA 2FJKA 3VFLA 1IQDA 4KKAC 4OZFG 5LCVL 4PJBA 4Z7VB 1X8CA 1ND0B 4LSQH 1J8HD 4L64A 2HP4A 4YDKL 3O8XB 2FPYA 1CQKA 1NBVH 1SY6A 4AEFA 4CAGA 1XT5A 4GSDL 4P8XA 1QBAA 3QI9D 4LGXA 5INDB 1XR9B 2NTFA 5BMWA 1OGTA 1WWCA 2W1NA 4BDVB 2QW5A 3QR0A 3NTYA 3LTPA 2CR0A 2JXMA 4N9OB 4G1EB 2FO1A 4JQIH 4ZFQA 2XG5A 2GIYA 3APNA 3SBRA 2E3ZA 2ADIB 1VSCA 3LCXA 1EERB 1UWEH 3CMOH 2J4GA 2JKNA 2WV8A 2CLZB 3KOZA 3E80A 2X1OA 1BBJA 1OGAB 3B3IA 2EUXA 2VD8A 4WJ8A 2Y3AA 2EKSB 2IKIA 4R2GC 5AYTA 3SDDB 3R0KA 4IZGA 3QEZA 4DGVH 1EJOH 1EYEA 3TXAA 4GXWA 3MLPA 3EO9L 3U9WA 3ZJ7A 2WXOA 1A6AA 3S35X 2C1GA 4X9SA 2BWQA 5HI4C 3L4XA 1XRTA 3TN0D 2IS7A 1WKFA 3RPIB 1PX8A 4TQTA 1XGUA 4MJHA 3NIFE 3HZYB 4H4NA 1E4LA 4XMLL 1NSNL 3CSFA 4W81A 4MQTB 3TZVA 3HNTH 3NVQA 3HR6A 2FX8L 1P4BL 3UAFA 1IZCA 3GXIA 1ASPA 3WLQA 4BQBA 1Z3RA 3O06A 1JFQH 2HKFH 4QOKB 1RK1A 4KHTH 2NCEA 4HBQA 4LCVA 4FEIA 4PUJA 4BGDA 5HVHB 4JYFA 2EADA 2A7BA 3P3UA 1P4LA 1V7AA 2OQYA 3CO8A 4LAMA 3F2CA 1P5VA 4BSVA 3PYCA 4APQA 4PCFA 1MCCA 1DPMA 1HESA 3KDMA 2FJHA 5CGYC 3CK5A 3W24A 5JIIA 4AX7A 4XN4A 3SDAC 2CH8A 2ZCKH 2VEFA 5AL8A 1RQBA 4ERSH 4HUXB 4CU6A 2ZUYA 2DQCH 3MHUA 4JTCA 4PGDA 3MRKB 5B80A 1U58A 3DK0A 5E70A 1JZ2A 3F4VA 1TJMA 2JCWA 4ODSH 1E50A 1S7TA 3GMLB 1MLCA 5GS0C 5MENB 1JCLA 1RZFL 1EYWA 4WOQA 5FKYA 3TQPA 2JKLA 3P02A 1U8HA 1WAPA 3QLDA 1IM3A 2FSEB 3MRFA 4JFFA 2OMVA 4ALAH 3EMZA 3SN4A 3BYTA 4YK4B 4NJIA 3DI3B 4JQXA 3RTQC 4WDXA 5JOFB 4QD2E 3W23A 4P2QE 1RZGB 1YLBB 2NCMA 4NP4H 4UFJA 4CLMA 4CC0A 2F5BL 2O6CA 4GRLB 5MEOA 1B3XA 4Y2DD 4G5ZH 5FYJD 5K9KB 5E5LA 5MENA 1PZ2A 4A7QA 1NELA 1RPXA 1TV5A 4HUNB 3IVKA 3QRGL 4HVBA 2WJZA 2VLJD 3JV4B 1E70M 4OZ4B 4P7RA 2YBGA 2YGQA 3M6YA 4IEFB 4NKDB 1ZOXA 3H7UA 1I1FA 2DQHL 2VXSH 4GZ7A 4OQVA 3RR4A 4JM4H 1HN1A 1KPVA 3QRFM 1HXYB 2YPVA 3SODB 4S0HA 4XMKL 4UFHA 4MG4A 1R6WA 3MDUA 1S7SA 2GHWB 2X6VA 2X9YA 1MF2L 2I27N 3KP0A 5FB8B 4UFKA 1BMGA 1EAPB 3SY6A 4HWEL 2E74C 3IS1X 3HIZA 2QCFA 4F9PA 2VEIA 3SZ6A 2A4CA 2ZOTA 1R5VA 1VH7A 2FEEL 1MFDH 1KCBA 3DOSB 4NWUH 1I1FB 3ZTNH 2PU0A 4GLRI 4NN5C 3WEXA 3W7PA 3NM3A 1BOGA 1UCWA 5EUKB 4YDLB 2FHFA 5HHQB 3TJIA 5KSVB 3ARVA 4KUZL 2MOVA 5BXFA 1U8JB 3FFDA 3EYFA 3AYTA 3U2IA 2HS6A 3NR0A 1SYVB 2IPGA 4N9DA 4IMEA 1J8KA 5D9PA 4N2OA 1K02A 1ZRQA 3TXVA 1NGQH 5J8OA 3SKMB 5A69A 5MF5A 1ZPUA 2A38A 2X1PA 3LEYL 4JPVL 4KFMA 1OP3H 3ZYIA 3ANYA 3UVAA 5D9OA 2NSQA 4PV1C 2I7SA 2QF7A 1UMLA 3WJYA 3VCLB 1AGCB 3LZOA 1QK0A 3V3WA 4PQXA 4KJPD 1R3JB 4LVOB 4K7PH 1RLWA 1HGYA 1YPZF 3ARTA 4TSAL 3SYOA 3WBXA 4EN2A 1ZJIA 1FTXA 1B2WH 2NNRA 1E2ZA 1T5AA 2QNEA 5B8CA 1YDOA 3WF1A 4C6KA 2GK0B 3PHQA 1PU0A 4QRRE 1E1EA 3RR1A 1EFXD 4Q4OA 4R84A 3H4HA 2PDWA 2XIJA 3GG7A 4C6PA 1MY7A 4PJDA 2MIZA 3RWHB 2QGDA 4RDVA 3ZRSA 4P9HH 4XSMA 1AUSL 3O6KH 2X4NA 3C09B 2PR4L 3UIZA 5IGXH 2C1HA 3SQLA 4Y9MA 2OXHB 5DHMC 3P93A 5FUOL 1KIRA 1YC8A 3OHXA 5FO8B 4FNTA 3W9EA 5JW3L 1AQHA 4FXJA 1WLHA 4OLXL 5FJUA 4FFYA 5ESQB 3IJDA 5ABZA 4AVHA 4XI5D 3ABKB 4JM2C 4IBQA 5AVNA 2O92A 2X44D 4MVBD 4UIKL 5CCKH 1YTEA 5CJQL 4AYGA 1G7IB 1YADA 3VUSA 4JJHA 2WNGA 4O17A 1E2VA 1NANI 3BUYB 3GMNA 2ZPKH 4LOUD 4XNUH 1G9ML 1PJ9A 4NI3A 4GG6A 2FZ9A 3I65A 4A3YA 2F7RA 3IJYB 1I7TA 2G9HA 4KKBD 1S3KL 1PQZB 5DURB 4QJ4B 2ESVB 4M5YL 3QJHA 5HSFA 2RJMA 3BLEA 2JEQA 5E6UB 3T2NH 2XZAH 4JZNA 2CLVA 4X99B 4IP7A 1IXNA 1EMTL 2BP5M 4LEBA 4M8VA 2JQXA 2BSTA 3LPOA 2HTMA 4GG6B 1R5WA 1D8WA 2K4AA 1U3YA 4TVCA 1XIWD 2X89A 3V7MA 4ZQCA 2VMFA 4XMPL 3ZQWA 2RDTA 4H26B 3RUGB 5FYLL 3QNFA 4XN9A 2FYMA 4XVSH 3ARFA 4NG3A 5LIUX 1Y5VA 3PWLA 1V7YA 4FXTA 4XBEL 7ENLA 3O8XA 3SBWC 1FWSA 1OFPA 4NQ1A 2JELH 4HIHA 1XLBA 3BZGA 1TR9A 5HJBA 4TS6A 4KEVA 5DQDL 1ITBB 2QVFB 1GG1A 4JPSA 4BKSC 4HNLA 5DCEA 4HSAC 2YXGA 3N29A 4L56A 1AANA 5CGBA 1Z69A 2J88L 1LO2H 4RDQF 3WK1A 4HHAB 5TFSL 3NQ7A 5A8MA 1VFBA 3DYMA 2R24A 4S1DD 3NG3A 4JQVC 3NSMA 4NSKB 4R7OA 3DX6A 2O5XL 3O9NA 2VKZG 5J5RA 1ONWA 1S3TC 3WIJA 3NT0A 4XVDA 2E46A 2VWEE 4ICCX 1Q0YH 1LF1A 2DP3A 2B1HL 4J27A 3QIUC 3ZHLA 3UXLA 4MUPA 3U0HA 1YNYA 4J3ZA 4MJ5A 1UJPA 2KT6A 5AQ0A 4RGMB 3E8UH 5CIPB 4O28A 4QLKA 2V17L 2HK1A 3IJ8A 4DFHA 3VXGA 3D12B 2CKBA 3VG9B 1IC5L 4EWND 2VRAA 3AS1A 3LZ5A 5JQ9A 3TO2B 5H37G 4N6RB 3F03K 3IMVA 2REQA 1QBML 1E72M 5CZRA 2UZPA 2W9MA 4H8NA 4JBSA 2SEBA 4UAOC 1WVZA 4L1SA 1OGTB 4BDVA 3A47A 4J3OG 3EIFA 3UJIH 4DQOL 3G6MA 2Z7UA 1NBQA 5E94B 4F15C 1BFOB 2AV1B 4FG0A 1Q65A 4JTGA 4RPQA 3UT0A 1MCEA 1CDJA 3NH7L 2ISDA 4BSVB 1HZKA 4DEPB 2ZKHL 4APQB 4NAJA 3WTVA 3WKYA 3D08A 3GWJA 2Z2UA 1R8LA 2FATH 3EYQD 3NAAL 5D1QB 1GQLA 1IEBB 2NY5C 2FUQA 2HYMA 3H2MA 4KGLA 2V33A 2BXVA 1MHCA 1QPXA 1EEZA 5JHDE 4DZBA 4GYPC 3WK2A 5CSUA 5KJ4A 4ADUA 1CT8A 5D2NC 1SW7A 1XYFA 5ICXB 3RPIA 3CQKA 2CYGA 1XGUB 1RQ5A 2AJSL 4XR8C 5A7BA 3FY1A 1SPDA 2YUWA 1KCSH 4DP7X 1E6XM 4NZCA 1FP8A 1HL2A 2X4PB 2ICCA 4NERA 4EOWL 4KCWA 3CQQA 2XZCH 5AKTA 1SW0A 1QEWA 4X8GA 2XICA 1DSFL 2QTVA 2Z2AA 5BXSA 1T20B 1DSYA 2JKJA 3QHTC 3KDNA 4CQ8A 2PPFA 1T7VA 3LV3A 1BG4A 4Q56A 1VHNA 3R8QA 3MROB 1TFHA 5DR5L 3WAKA 3AY4C 1TETH 2FX7H 3LKNA 3TL5A 2DSKA 5D2XA 3UIYA 5F3HA 4G8AC 3KUMA 4FQQB 4M4RA 3F2LA 1A3XA 2GVGA 2I9LA 5ELIA 3IANA 3PFMA 3QOMA 3WNJA 2QVHA 4MWAC 2J88H 5ADPL 1TPXB 3I9GL 1F8TL 1PYFA 1I9RL 4HZAA 1X1NA 4I90A 3KTSA 4NJHA 5C2XA 4YGVB 1E9PA 3B2VL 5E6ID 3H26A 1AO7D 3VZZA 4KMQA 2IANE 4MAZA 5FF2A 2NLJB 5L0QB 4OU3A 3OZPA 3EH2A 3SUVA 5BCAA 1FZMA 5CBAA 2R14A 3JUYA 1WBZA 2SFPA 2WO5A 1LDSA 3D6GA 3DESA 5A6BD 5I03A 5IFJB 1FHDA 7TIMA 3IWVA 2PDIA 4HPNA 3NWRA 2YDQA 4TX6A 3W0WB 3H7BB 4W6YB 4C4UA 3QDJA 3QORB 4UT9A 3TV8A 3EJRA 4R7VA 5DJ8A 4NBZB 3V7AE 4HZLB 3P67A 4BUQA 4D2JA 2XXMB 3IIPA 3FSZA 4JTAA 2X6MA 1F41A 3CFBA 1KR1A 2QEZA 4O9HH 2PRLA 3RVVD 4E41E 2BLEA 3H0TA 4HGKC 3V0HA 1OIFA 1QPOA 1JZ6A 5GIRA 4YL2A 5MEQA 1G9MH 2EPNA 1KWGA 1HUVA 1U0QA 2ZZ7A 5TQLA 4IRZL 5D7IE 4EOWH 1U8PB 3VOIA 5A2KH 1QSFE 4Q7DA 3BWZA 4I2XA 1CLKA 2EJAA 3H9SE 2CPUA 4WUKH 2OOFA 2VDNL 2Z4QB 1GCYA 1GG0A 3AWGA 3X3GH 2XM2A 1GVYA 4QTFA 3VXQB 5FOOA 2WGXA 4UU9A 4K8RD 1XYZA 2APXA 3VWKB 1XIBA 5SWZE 3RPKA 3SQBA 4HC1L 5E2UL 2XZ9A 1JZ8A 4CDHA 3QKEA 5CSSA 3VTAA 4H2AA 3WEXB 2AQOA 4Z0JA 1FFQA 1HP5A 4JKNA 3ONBA 4RISL 1EGZA 1A5NC 4TVPH 5F70A 5FUOH 3K2GA 3LENA 5AW4B 1BXUA 4R4BA 4RFNB 1H9DA 3EEZA 4K8GA 2B31A 2I56A 5EBWA 1VYRA 2C16A 1M3IA 3QDGA 2MOGA 5C0AD 1B0GA 3CFEA 4I77H 4MB1A 3RE0A 1JJUA 3ULSA 4ZE5A 3CDFA 1NH6A 2BVDA 2CRZA 2WAGA 2PPCA 5C07A 2J1ZA 3EHBD 3IDNB 4NZ5A 1CB7B 1WTLA 5HVWA 3GTIA 4JTSA 2J6XA 4A3UA 4Z3EA 4EDXA 3RURA 3VD4A 4P9MH 2VLJA 1KM6A 1EUAA 5F9DC 4OZIF 1BCIA 1E27B 2CUMA 1NMAL 2FECL 3OC5A 4ZAKA 2XSKA 3ECQA 4KKXA 4B53A 4A66A 5FWQA 3APMA 1H0GA 1Q63A 3QUMA 5HOSA 3EFOB 4LLVB 5HWJA 2K9FB 3V7PA 1DQDH 2CKSA 1YEFH 3O2VH 3QUXB 3UPAA 4OZIB 3WJXA 1U1HA 3W1AA 1IM3D 2H8XA 1FYTD 2VI0A 5KVGE 4ELMF 1IXQA 3RZCB 1YPIA 1QLEH 3NQCA 4HYRA 1YEHL 5ABGA 3MUHL 3FSAA 3UZVA 2RTTA 5E4AA 4NL1A 3ES6B 3QQ9D 4GSQA 4RIRB 4YAQA 4R90H 1KLUA 5D1ZI 2QLYA 2KLSA 3MOAL 4UQ3A 2X09A 3BZDA 3ZBMA 2KS0A 2Q7AA 3K6OA 3FB6B 5FIPA 1EO5A 3MUJA 4HVXA 4G8GD 1V8EA 3UYPB 1JGLH 4LSTH 2PWHA 4GY1A 3GHSA 4PMFA 3HHSA 4PBWD 3KOXA 1H9VA 1YPZE 3VNJA 1SF5A 1ELSA 1MF2H 2GSIB 3DG6A 2WO4A 1E7VA 3EAUA 1E9QA 1EGJH 1KLUB 2VOTA 4GHRA 3NN8A 5BMXA 2N01B 3OVPA 5D1ZD 1A4LA 1YE4A 2C1PA 1TTAA 1UEYA 3M1BB 4MNLA 1JVOA 4O4YH 1RZGA 4DEFA 5HBFA 4M3PA 3CFJB 3GRBA 3IACA 2VJ8A 3EGDB 2A6NA 2I07B 3TNMB 3M07A 4U4BA 1DQLH 2P9RA 4Q52A 3UABA 3ZE0F 2Q8LA 1UENA 4JQAA 1WBXB 1BJMA 2AKMA 2CDFB 1WFNA 4TL4A 2CKNA 3BPCB 1UJQA 2L3BA 4PV9B 3FCTB 4PJXE 3TBTB 1SJBA 1UWXH 1ZMYA 5D5MF 2P5WB 1CQYA 5DC2A 2J2ZB 3VMOA 3MP5A 4HCDA 4TMBA 1KB9J 3CZKA 4OIIL 5IUSA 1UT9A 4RAVA 3ZN6A 3ZL2A 2ZONA 3NIGB 4MJ5B 3TNMA 5HJDA 1IXPA 2B08A 2VZVA 4EDWH 5E2VH 3TR9A 1KTKE 3BLFA 4M48H 3DO3A 3FHAA 2ODOA 5LIXX 4RLDA 3L5WA 4OGZA 1NDMA 4LCWE 3FA3A 1YMME 5C0CE 3RL1A 2QUUA 3MRLA 4UZUA 5JNYB 3CTTA 3GSVB 4DXKA 1VADA 5HANA 2ACRA 2HDJA 3FT3A 1ZU8A 1RJLB 3AIUA 3ARDA 2CM6A 1HSBB 1G6RB 4JX5A 1I7UA 1BOGB 3P73A 4TVPL 4JGJA 3AXLA 3H9ZA 4PCYA 4AJWA 3KWWA 5SV4A 1N6QL 2QKIB 1ZNNA 5DQJB 5KSAD 4JN8A 4KVNL 1H7WA 2BHZA 5EEWA 3N73A 3GSNA 3QPKA 1WZ1L 3E02A 4KKRA 1UROA 3BZFA 5TDNA 1WG3A 4PBEA 3LSOA 3IRDA 3RAOA 4QHUA 4UTCA 1LLAA 2YRBA 4TOYH 1ICPA 4ZMLA 3S1VA 1MH5B 5J1AB 4PWJA 4GMSL 2WWKO 1U3NA 3KPOA 4Y9FA 5D93C 2EVFA 1RY0A 4JHOA 5F88B 2A6KA 2RMNA 3NSDA 4RSYA 2P8BA 1BVNT 4Z18A 1HJWA 4ZFOL 1LHZA 3TESA 2OK0L 4Y8AA 4U1GC 3QULA 3O4LB 1EFQA 2V5KA 3NCWA 4TX9A 4JFPB 1ILSA 4TSAH 3LZ3A 1A6ZA 1DHKA 4G11A 1HE7A 2F8VA 3HAEH 5XIAA 2QCLA 4PE8A 4X0KB 3HC3L 2UUDH 3CUFA 1K77A 3E12A 2F2HA 4ZTOH 1LD9A 5FKAA 3MRBB 3T04D 1TYJA 2P44B 1T1WB 2ZUVA 3SDXB 2YHGA 4LOVA 2ITDA 2Y61A 1H62A 1FNAA 3MMEA 1U8LB 1L3NA 3HPJA 3HLAB 3QJUB 2PURA 1FZKB 3RFZA 5F3BB 5SX4H 4BA0A 3BRDA 1AO7B 2AAVA 3FK3A 3IF1B 3MNVB 4CILA 1O9VA 2PCPB 5KVDL 3VTRA 4Y4HD 3UEZA 3OMZA 4XHJD 3VOJA 3LKRA 5IB4B 4KIRA 3AIEA 25C8L 1BHGA 3KS0J 4Y4FD 3O6FC 1B30A 2J6VA 1HWGB 4FKKA 5AW9B 1E8WA 4QXGH 2HVMA 1B3YA 2LT9A 3HOJA 5KS9F 5LYRA 4HUWA 3TLRA 1R3KB 3DKHA 3EJUA 1FLRH 4M02A 4XAKE 1IFGA 5C2UB 1AGEB 2OQJA 3U6RB 1AZUA 3ITVA 5LCVH 1GAFH 4FTDA 3W3OA 3PP3H 1I7TB 3E1F1 5TJWK 1S39A 2CKBL 5HPMA 4R7NA 3OSVA 2Q8BL 1AK5A 4LSUH 1GGBL 1PYWB 3C6LD 5ICZB 1OE3A 1I0DA 3BOFA 2CLVB 2VC5A 4EXBA 4Y19E 1BZEA 1ECEA 1IWPA 1KM4A 4GGHA 4GG8B 2AK1L 3BLKA 4L4TE 2EIZA 5DZNA 4C8XA 3FDWA 3LIZL 2IANB 2OO0A 1CF8L 3TW6A 2H4EA 5L9FA 1OPOA 3I02A 4NP4L 1S7WB 1V0MA 4MZ1A 3KHOA 3WNKA 4AG4H 1QPRA 1T04B 2X9ZA 4B9ZA 3K4AA 5DYOB 3V0WL 3R8RA 2IPTL 3REQB 4WEMB 4Y2OA 1ACXA 5CO1A 3OAZK 3GNDA 4F3HA 3EJCA 2GSGB 1LTDA 2K4WA 3FPXA 4LEXL 5I74B 4EMZA 1YEJL 3C5ZB 4WU5B 4GABA 4PJGA 2OEKA 5F4SA 4CSTA 3SURA 2J88A 4Q8OA 3C2AL 3V0VA 3L4WA 4JRYA 4JMNA 4YVUA 2K7QA 4RNJA 1C8XA 3NPSC 4U1LB 4PCTA 1NCCH 1BYDA 1KTDA 3GGWB 1LK2A 3PWPE 2EZ0C 3CMGA 3RWGB 3T0XA 3VUAA 2YBRB 1TTJA 4JD4A 4N2BA 3T6CA 1QWUA 4FNUA 3CSTA 2DQUH 2J7FA 2Y5JA 1A7PL 2PLTA 2BVUA 1AD9B 1JHTA 2J20A 2WBGA 4L9YA 4BI5A 1UTDA 3Q6FB 4ELMB 3UXFA 4CEUC 2EDMA 1EUUA 2FGLA 4NN6B 4A2RA 4Z1YA 3VNMA 3LRKA 4FP8L 4M43L 3UTTA 4WU7A 3RTQD 1D9KC 5C6TL 2B1AH 1XF2A 1KV5A 3CM4A 3WD0A 1LYXA 3DETC 3PBVA 3QGKC 4GI8A 4NNYA 3LH2L 1JIBA 1GGCH 1V08A 3BT2L 1LP9E 3VFVB 1G87A 1HHJB 1K8IB 3R10A 5AKQA 1ZSXA 1V6WA 1DJNA 2CPCA 2WIMA 3I3BA 1T4KA 4B5SA 4IHOA 3AQYA 3QUXA 4HH8A 2F74A 4OCLC 4DETA 2QKFA 1MFCL 3HE7A 4YNYB 2Z65C 3OL2A 3W7NA 1CURA 2Q8AL 1GOHA 1TQTA 1EDQA 3K8KA 3NZSA 2PETA 5D1QA 1VD6A 5AHEA 3SRFA 4YL9A 4ZFZB 4OBTA 4NO0A 2BOFX 5A94A 2FZBA 5HMDA 4K94H 4H25A 1EQPA 2OWXA 5EH1A 4F40A 4H5SB 1AKJA 4HLEA 6FABL 3CX2A 4P2RE 1BM3H 4W1TA 2ZZ5A 3UROR 4JTQA 5T1MB 2APFA 3RIAF 3V5HA 1W0VB 5AZ2L 2PD9A 2B16A 2XFGB 3QVQA 4G8EA 1BD2E 2VYRE 4NM8L 1L0XA 1MI5B 4UOZA 2O0TA 3GR4A 1GIGL 1J5IA 1T5XA 3BHBA 5F7NC 5IG7B 2RFXB 4G8FB 4I4WB 1ZSHA 3RX4A 4JK0D 4G70B 3BK0A 3RBSA 1BVLB 4FIQA 4DM2A 3QZPA 3MR9B 4WO0A 5DEFA 5HI4D 4MD0B 4XOBA 4CMHC 3ITLA 5I77A 4R0LB 3LB0A 4OM1H 5H4ZA 4NUWA 5XIMA 1RZ8B 4HH9A 3GM8A 1BF8A 1HEHC 2A9CA 2R8WA 1XKYA 2QQKL 1BXNA 3E6EA 3PPGA 3HMXL 3R94A 4LRNH 1VS1A 1UJTA 1FVCA 1KCWA 3OD3A 1N2RA 4O2FB 5HYQA 4YHYB 1FIGL 4O02H 3B8DA 3H24A 2H0FA 2NDGA 4IIFA 4O2CA 4DUOA 4HG4K 2WXKA 1UR4A 5SWUA 1I7ZB 5EBUA 3S2NA 2R1WA 1YEIH 1DQKA 3JWNH 4GBXB 1A8ZA 4KKAD 1J79A 1WBHA 3IDMB 5T1LD 2A6IA 5JOEA 1W9XA 3QAZB 3TP4A 1OCJA 3GJEB 1R2RA 3LDVA 3QJQB 4CD8A 5I19L 3EGDA 2OQLA 2XZQL 2B39A 4IKKA 3INUL 4XAWL 2GVEA 4P7NA 3W83A 3C6SA 1S5NA 5C6MA 1IIKA 3D2TA 4OLZH 3TFBA 4DKDC 3AHZA 4YSPA 2XKSA 1DQIA 2BH0A 3TH4T 1YXYA 3W70A 4KJYB 2ARJB 1HTYA 2ON3A 5ALCL 1K03A 5J13B 1TE1A 2DV0A 2XG4B 2QADB 3QO0A 4NZFA 1BD0A 2X9WA 5JHLH 4KBXA 4G71B 5MEOB 1KBGL 1U8PA 4YDLC 3B4NA 4FDWA 1A0QL 3FU8A 3C5XA 2I9UA 3E2RA 3TMLA 3TN6A 1OHQA 3IJ9A 3OZKA 5IWLC 4HIQA 1RMFL 2CZNA 2X7LB 3WNPA 3KMDA 3MUIA 4HCFA 4MWFB 5IMOA 2GUOB 1D9EA 5FA3B 5LN8A 2CKRA 3NJIA 2CU0A 1EC8A 2JIWA 4XP1L 4Y9EA 2ZUQB 3C5ZC 4YN3A 4NZ1A 1OARL 3QYQA 4XIMA 4AIUA 3KLKA 4PD4J 1MFDL 2YYUA 2DZBA 1ZD6A 4B60A 3V4VH 1B0GB 3CFEB 2KYIA 3F65A 3GM0A 3L4UA 3RRQA 4KKZA 3EBVA 3PR2A 2OLAA 3UFYA 5BNKA 1BLNB 2IF7A 5I26A 5I9QC 3OGRA 5B3SB 1GHSA 3F62A 1J10A 2J73A 3CHVA 2DI7A 3QY7A 3KPRD 3MCYA 3IMRA 4U6YA 3QG6A 1W5OA 4J4PC 4YDIL 1L0QA 3C60D 3V0IA 2IALA 2A7RA 4UFMA 3RN6A 4M1GH 1A9BA 1BEUA 3VAVA 1NGWA 4X0NA 2UY6B 4X0KA 1K5NA 1KB5H 4OZGF 1KD0A 1OVZA 1B9KA 4HSCX 4HPOL 1R38A 1XBZA 2LFGA 5FF4A 4Z7WF 5FECB 4ZX6A 1SMAA 4L29B 1KDJA 2DUAA 4JN2A 1QX1A 3SD2A 4BINA 3TKFA 5K2ZA 2ITDB 5DMYA 1FI8C 2QHRH 5IBXA 4WDIA 3O4OC 4J4PD 3QTGA 2IPUK 2Z93B 3QH3A 4NIRA 3US1A 4Q6XA 3NOIA 2V5LA 2W62A 3EG9A 4IU3B 1QJWA 1AGFA 1UPPA 1XUZA 1KXQA 3KYOB 2J9YA 3CV2A 2E5CA 3SFKA 2EIZB 2J5LB 4MS8D 3ENLA 4Q6IB 5GRVK 4YHZL 2VAJA 3WOVA 3WAJA 2O9TA 4U1GB 5C3IA 4JY6B 5EO1A 3B0XA 4XVEA 1O60A 3A5VA 1ID5I 3KJ6L 5A2FA 1R19A 1NEZA 1TJGL 2BFVH 5EB8A 3HZKA 1ZLDA 2XQYK 3EGSA 4I13B 4U1HA 4QNPE 2OEMA 5D4HA 3BIAX 3BPLB 5E2JA 1A4JB 3S3JA 1NFDE 2W9EL 4YH6A 3W9EB 3CHEA 4H8PA 3UAEA 4DPPA 3UWUA 3OLGA 5E4OA 4WCYL 5DRIA 3RL2B 4MQXD 3DI1A 3CX5J 1AR1D 1VRDA 2XFWA 1WZ1H 2ZXCA 2PAJA 4MYPA 4R4FL 1BRLA 4N2GA 1VRXA 5AG9A 1P9MC 1YPZA 4ZUWA 1FAIL 4FXGB 1CLYL 4U3CA 3U0PA 1LNUA 1C29A 3B9NA 3WLLA 3OHIA 1YAZA 5AC4A 5GSVB 5FKPB 2VZSA 1WISA 4CQCA 2AMXA 1OD7A 3GMNB 4DEWA 5I1GL 1JCXA 3G0SA 1FFNB 1KV3A 4LB8A 4N8CL 4PRDA 3EKZA 1WITA 4F9JA 4C4KO 4PP2A 3OIHA 3WF4A 1IIHA 3CH1A 3W29A 1NDTA 2AJVH 3FONA 4X98B 2DWEA 3SDDD 3B8UA 4S3GA 3VQLA 1HNYA 1V8HA 3EO0A 3WIAA 2YDSA 3C5JB 1IQWL 4CQBA 3KM1A 4Q97A 2BM3A 3TNOA 2L0DA 4H8QA 1RIHL 3Q8FA 4YBLC 3WLSA 1C5DB 3T0CA 2WKGA 4J6IA 4D6FA 2Z7ZA 4KUCD 4KK8D 1CFTB 4TVUA 4CMMB 1FH9A 3BLBA 2J77A 4J1OA 4OTKA 1G7MB 5CJXC 5H35B 2V2TB 4JN6A 3PFUA 5IVZB 1IGTB 3NL2A 3W9ZA 3FS2A 5JHDA 2QVMA 3RUGF 1YMMA 4HJUA 3QWRA 1IAOB 1FP5A 4NC1E 4MZRA 1MJ8L 4HU2A 1E6ZA 5TAOA 1QFUH 1Z6JT 4GP4B 5CFHA 5JXED 1XPYA 3N4FA 3FSOA 4K94L 3AXKA 3L9RA 4EQ2A 3B03A 5GJPA 1WO2A 1PSKL 1JF1B 3PV7A 1KEML 3F4CA 3H2QA 1MREL 1VBUA 1CC3A 3M17A 5E08L 1LP9B 4RX4D 2I57A 5E00B 4YS1A 3O3DB 3N06B 1F3RB 1OAXH 2VDRL 2EVGA 4PYSA 1V77A 3W6LA 2DZSA 1JYVA 2NZIA 1V6XA 2GIXA 2O9PA 5HHPB 2RCSL 1YNQA 1XLKA 4LCRA 1TTIA 2AOSA 4XNYH 5CC3A 3LCLA 4AD5A 1O94A 2O5YH 3L8QA 2DT3A 3IS0X 2LW3A 2VO8A 4OF0A 2DJMA 4XXWC 3OZLA 5DQ9A 4QTHA 5I24A 4GC4A 3FEQA 2C9PA 2QAPA 2AAAA 3UBPC 2R2EA 2QV2A 3GB7A 4Q58C 2PDMA 1RZ8A 4HH9B 4LAKA 3WL0A 2H6RA 1NQBA 4WJ5A 2O93L 1K3IA 2X4PA 3G1AA 3OLEA 3T4WA 1P7KA 1PV8A 1ACZA 1A6VL 4LSSL 5EU5B 3MMWA 4AENB 5TDPA 3SPCA 4F8NA 4R9OA 1ZK5A 4HK0A 3S9DB 2AK4E 1BZOA 3CLEL 4A38A 3IDIA 3E9UA 1PVHA 2V3EA 2RQ8A 4WJ5B 4DY1A 3OV6A 3V5HB 2A7NA 2R56H 4MBRA 1A4AA 1W0VA 2VUYA 1PW3A 5L4JA 4D6EA 8XIAA 2HJFB 4H20L 3GC2A 3UP1A 3JYBA 5LGHL 2E7BA 4LSPL 2NY2B 1G7VA 4N2CA 1GVOA 2VWEC 2A6IB 1PZBA 1RD5A 2WOQA 1ISVA 5FEZA 3EWCA 1ZA3B 1OIOA 4L1GA 4FQIH 5EUOA 5EUKA 5C2BH 1CBJA 4AVIA 3QQ1A 5H8UA 4L9LC 2WQRA 1VFMA 4FQ2H 1OP9A 3DETD 4FQHB 4JFUA 4DTGL 5HYJA 3A6OA 1P7TB 1J5TA 2HJFA 3FXGA 3GG0A 4GC3A 3W6MA 1D9KD 4XAZA 1UR2A 1AQ0A 3NJ3A 5CGQA 3QXAA 3US9A 2GFBA 2YC1A 3Q3GB 3WUFA 3CZLA 2P8CA 1G0DA 1MNUL 1CGWA 1GL4B 4P59L 3X3GL 3HGOA 3N18A 4Z23A 5AB2A 2QDWA 1XR8B 3SJNA 4XOEA 2DS4A 3I84A 3PLYA 1KPVB 3CLFL 5D8JH 3W56A 4HZLA 1S46A 1QWGA 2B7PA 1SVBA 2OZ4H 2A85A 4QRBA 4ZPVB 4GKNA 5B39B 5C0RH 1Q8MA 4BJHA 4O19A 2P8PA 1KKOA 2BGQA 2PCEA 1O7SA 3IYLW 3ARED 3W7CA 5D7SH 1S1RA 3DVGA 4C56D 2HEJA 4LOCA 3WLIA 3SCNA 1CXFA 1IC1A 1LO4H 4HS8H 4K38A 1AHWB 1WGOA 4YO0A 2VE6A 3R6IA 4AD1A 1EDYA 5BS0B 2OZ8A 5FDWA 3CN1A 3QEQB 1I3UA 1T1XA 4GQPH 3WQ4A 1OAKH 5AZEL 4XISA 2J57A 2Y23A 3IRPX 3VI3A 3GSOB 5KYXB 4PJFB 5D8ZA 2N1TE 4QRPB 5EMUA 3K7UA 3PE9A 5D9NA 1AGDB 2VL5A 1Z9SB 4ZS6C 3GUGA 1N59B 4F48A 2QGCA 2ZX8A 3KLHD 3WLOA 2CZ5A 3KR3H 4GBDA 2V3DA 5C7VA 4IBVA 3PUGA 2HSIA 5GSRA 1D5BB 1E5BA 2YL5A 2FGBA 3PPHA 5SX5H 5JW4M 3BVXA 1J1OL 4OJYA 1ZZMA 1YNTA 3L5LA 4XO5A 2Z31A 5CMAB 5AAMC 5J9PA 2HJPA 4R3UA 3BT2H 4IIQA 3BSZL 2IW0A 1DEEA 3S5OA 3W84A 2X3BA 2VLJB 3WSQL 4KWVA 1EDGA 3AHVA 3KPMB 2X05A 4MTMA 1NM9A 4G6CA 5C0GB 1AS8A 2YQ2A 3QZNA 4PH8A 3W1ZA 1CD0A 3K2IA 1EGJA 4PTNA 1P84J 2GJZB 2OW6A 4M7LH 4MA7L 3R12A 4P23B 1MHHB 4FXKA 1G1KA 4Q6IA 4G9FA 2LLEA 3N2BA 1REQA 4N2IA 2ZX9A 4MF4A 3SOBL 1FVPA 1PZUB 3O7UA 4WXYA 1I3RA 4R4BB 3M43A 1RZJC 4Z0BL 4UUIA 4KOCA 3RHGA 3FCGA 4YIWA 1F3JA 5G4WA 4UUJB 1ZWIA 1A5UA 5DVKA 2DQIH 3AQZA 4S3JA 3WLWC 4J2QA 4EIBA 4O5LH 1NY1A 3KP1A 3Q43A 2ACSA 2UY4A 4XBKA 3EGXB 2E6QA 4GY0A 2R69H 2B9BA 3OTTA 4L37B 4K5PA 4NLHA 3AJXA 5I07A 4UTMA 3OP2A 3NH7H 3LDBB 1I2NA 4UTWA 3HRPA 4ECLA 5LNWA 1K8DA 5D7LA 1Q1JH 4OV9A 5SX5K 2UZYB 3IGAA 4LRIA 5F0PB 3NZHL 3WO3B 2VLKD 1HJSA 3FFOA 4W5ZA 1IBGL 2P52A 3FN0H 1OF0A 4F8TA 4E8CA 4J1UA 4D9PA 5DD5H 2DTMH 3L6FA 4KKQA 1ML0A 2EHHA 2YW3A 4M6AA 1HKLL 3PP4H 4JAMA 4L7ZA 1TG8A 3MFFA 2CHZA 3DGCR 2DMCA 1QA9B 5IW1B 2AZUA 1BGGA 2ZXWB 2POTA 1T2JA 2ZCHL 4WQOA 1U5JA 5HHVH 3WFDH 1ZBKA 1ZVSA 4MX7A 2J75A 2DWYA 3URBA 3D25A 4X5WA 5JU6A 1PS3A 2KDYA 3CZFA 4U2ZA 5DVLA 3GNML 3QRBA 4UXDA 3RL2A 2FTWA 2G5WA 4YPGA 1N8FA 4LL4A 2WZ5A 2EG7A 3LNGA 1E9OA 2XQYA 3RGVB 2F54A 1FNHA 3T1WA 4EKJA 4J3WA 1CWVA 1G0XA 4TYUA 2NZ9D 1FCBA 3QDGE 4FLRA 4NAEA 5ICYA 4XK2A 5CBEB 3QQNA 1IEQA 4KMTL 3AMGA 3ABZA 4LUSA 2D9QB 1A5OC 1S7XA 5CP7A 3AG2B 2VDMH 2VFEA 1C7TA 2H2PD 4UDUA 3PIQB 2PW2A 1L6PA 1RPUA 4QHMB 1HI6A 1G9HA 4S10A 3FJLA 4BZ1H 2HTLD 3UZEC 4U6XA 3B8TA 4NQDA 2WZPD 1FDZA 4LW7A 4E41B 5F8QC 1PKQA 1WE5A 3MV7D 1JZ3A 3JUGA 3EMQA 1NC2D 1Z2KA 2Z1KA 2ZTBA 3DVIA 5DJCB 4P2YA 4ALAC 3MP3A 5DQ9B 4C60A 3GS7A 2YKLH 3UYIA 4U6VL 1NCDL 4KQ3L 4GYJA 4EUPB 4IF2A 1R6VA 1O1ZA 4B0MB 1FFOB 5EFFA 3RNKB 2DBJA 1ZY9A 3KZSA 4DNHA 1WWWX 4Q4IA 2B5IB 3TF7C 2PGWA 1PZ3A 4ZMVA 1ED3B 5IROC 4XPHL 3VGBA 2PYEB 2DEPA 4GXPA 4XBSA 4K7FB 5D2LE 5LNEA 3CQJA 5K9JL 1A7OL 1A6PA 1I7RA 3RIKA 4M3KB 5EIVA 4Z8FL 1OGSA 3LNMA 4B5VA 1SGJA 2AJZA 1UGNA 1FXQA 2OR2A 1JK9A 1PZ5B 3RITA 3DHDA 3N17A 5IBLD 1IYXA 4AC1X 1XGQB 2Q3RA 3KPSD 4BBWA 4X2RA 5KZDA 4ZQOA 2V38A 4YDVB 2GK1A 3AXMA 4KS0A 1Z0MA 1C9DA 2X3CA 4JVPA 1X9UA 1F5ZA 3POCA 2ZE0A 1Q85A 3CHXA 3F4DA 2JI3A 2X2YA 3IJLA 4FLHA 3TEXA 4GIOA 32C2B 2WXFA 3JWDH 4HHGA 2PDPA 4MD4B 3D85A 3LM3A 1TE6A 4XB3A 2RGSA 4UTAL 3P3SA 5JIMA 1EC7A 3MKCA 2X1IA 3N34A 4P5UA 4YDVA 2PDYA 4CNSA 5F9WC 4F7CB 2QPFA 4XX5A 2BX5A 3U2SA 5IB2A 3MU7A 3WSUA 4UYPA 5H2ZA 2WCPA 3NIGF 1LD9B 1UD5A 4XO7A 3N5AA 3RYSA 4MDIB 2HFTA 1UT2A 2GTWB 3G5VA 1KGYE 3I50L 2GI0A 3M5YA 2GT9A 4I0PD 2DW5A 4FOMA 4WSJA 5KYUB 2HLFD 2Y1AA 2FLMA 3VXPB 2JMRA 3S96A 3PWPA 2E40A 4WJG3 2WUCH 3QQDA 5EZOH 3GIVA 1F4AA 5FO9A 4PRPB 5I5IA 1T66D 3IMTA 4NUGL 4W4NA 3O1NA 1FPTH 2XNAA 4TPRL 4QNPF 3RFZC 4A1RA 4PJ7F 4BE6A 3LKPA 4TXVB 3IDGA 2CMRH 3LQAH 4MVBC 2FFIA 2PLKA 1H0DB 1ZA3A 4HMDA 3OG4B 3CXDH 1WC7A 2GBVA 4YBQD 3H85A 1A1OB 4X8CA 5ALBH 1SQMA 5E51A 3RMJA 4LPXA 1WK0A 1VFTA 2C18A 3P84A 2ZG2A 4NC2B 5HHOB 4FTVA 4RV8A 5BZZA 5ECUA 4H41A 3VTTA 3SUTA 1GZQB 3O6FA 1AODA 3LMJH 2DZPA 2R1PA 3W2MA 4LSTL 5FLVA 1P6CA 3TWBA 3HC4L 3MLSL 4JVUA 4NQVB 5CEXB 1M57B