2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
3VIIA 4AZBA 2G8ZA 2J25A 4GPNA 5DEZA 3VSUA 4LXFA 3AIRA 5FKYA 1BGGA 4X0VA 5LA0A 1RP9A 3MKKA 1G0CA 4HA3A 1E43A 2WW5A 1E6PA 1YQ2A 4TVCA 2JE8A 3FHQA 1OWQA 4B15A 1V02A 4P8XA 2CXGA 3VIHA 4XX6A 1ODZA 2EPKX 2VRKA 2V38A 5FCZA 4JFUA 1KBBA 3MS8A 4UQAA 1JYXA 3MI6A 2WPGA 4JHOA 2YL5A 2XN0A 3J7HA 3BVVA 2BNJA 4JKKA 1PIFA 2W61A 3N9KA 4P7QA 5DO8A 2A3AA 3BC9A 2E3ZA 3VU2A 3ZMRA 2NW0A 4TVDA 4JL2A 2WC4A 4F66A 1X6LA 3VVGA 1KTCA 2VC9A 5LYRA 4DUXA 1WZMA 4W5ZA 1VFUA 1OIFA 2FYVA 3VUPA 3WQ8A 3AIEA 4ZENA 1CXFA 1JYWA 2QPUA 4Z2GA 5CSYA 1JIBA 3OLGA 1TUXA 4DWSB 3VD4A 3KEHA 1V0LA 2WMKA 5HNNA 3LRMA 1OB0A 1EIBA 5FD0A 3AHZA 1J01A 5A6LA 1LG2A 3PTQA 3WD2A 3K8LA 4W8BA 1O6IA 3CUGA 2VX7A 3AS2A 4WJXA 4HA1A 4HMDA 1IV8A 1BPLB 1VIWA 1E1FA 1V03A 1PBGA 1R87A 3AZRA 2XWEA 1JI2A 2J7FA 1C93A 4GZIA 1CXEA 1BLIA 3WY2A 3T0AA 3RJXA 2VCBA 2VUYA 1KXVA 4DO5A 3VIPA 4ATDA 5A8MA 4L4OA 2WK2A 4WKAA 5LA2A 3EJSA 1ISZA 3AHTA 2ALWA 1WZLA 4ML4A 3AISA 1W9XA 3OG2A 3N11A 3GDBA 1XSKA 3PZGA 1CGYA 3WDIA 3KLKA 1E1EA 1MW0A 3WF1A 5I6SA 4LYRA 1VENA 5M5DA 4FNSA 4XB3A 2VT0A 5JBEA 4PSRA 2WVVA 1NARA 3GH5A 1JNDA 3AMGA 3CIVA 2YOCA 1KFWA 1UQYA 3ZJ7A 1GHRA 1UWRA 3VINA 1NWSA 3RM4A 3BAYA 3AOFA 3BLBA 1MFVA 1ZL1A 2Y5EA 3VDBA 2GK1B 1R85A 4MB3A 3U57A 2J62A 3A21A 3ALFA 1AQMA 5I2UA 1UKOA 2J74A 2CCRA 4UCFA 5CJ5A 1GOKA 1QW9A 1JF5A 1LL7A 2Z1SA 2C0HA 3TTYA 2NT0A 2DSWA 2W5FA 4ACZB 2VZOA 4OIFA 3T09A 6CGTA 1UKSA 5CQ1A 3WD4A 1CGXA 2X8RA 3VGDA 5E0FA 1T0OA 1UR8A 2J79A 2F2HA 5HDRA 2EPNA 3OGRA 1W9PA 1IZKA 3S5YA 3DHPA 2EQDA 4PUEA 4MPKA 3MSGA 4W7VA 1UA3A 1N82A 1JDDA 1LJYA 1H5VA 2TAAA 3CZLA 1QI3A 2WKGA 3F5KA 4E4PA 2X0HA 2BVTA 1PX4A 2D0FA 4GINA 4DO4A 3GXIA 5A6KA 7TAAA 3HJEA 1J0JA 3VILA 1SR0A 1FOBA 2PWGA 1W1YA 1WO2A 2WZEA 1TQUA 3NJ3A 1XD0A 1BHGA 1UZ1A 3B8SA 4ZE5A 2GSJA 5A8OA 3DHUA 2CERA 3BUQA 4HTYA 3WNOA 4B16A 4Z2JA 1WDPA 2DSZA 1R7OA 3WNLA 1VFFA 1OM0A 1Z32X 2GJXA 1MXGA 3O9NA 4CVUA 4J3XA 3SUSA 4GI8A 2D22A 1GPFA 1H1NA 4HZ8A 4JKLA 4PMDA 2BV9A 3PZ9A 1KQZA 2CBUA 1V3IA 3M46A 5IFPA 3SUWA 3WN6A 3VIFA 3NDYA 2EAEA 1FP9A 2YFNA 4BCEA 2V3GA 4HU0A 1L8NA 5E0CA 4MDOA 2VVNA 1V0NA 1MQQA 1G01A 3UETA 1ISXA 2EPMX 4ZE4A 3RJYA 4EANA 3ZIZA 4TOQA 4AYSA 1XC6A 2YDSA 2D73A 3VDHA 4WKFA 4PSPA 1TZ7A 4TTUA 3WQVA 1EOMA 2D0GA 3W25A 4ZXLA 1CECA 3IGUA 2WZIA 1W3KA 3L4WA 3NSMA 2CIPA 3BAKA 1Y7VA 4PTXA 8CGTA 1V6WA 2VZTA 2PBOA 1W2VA 2ZE0A 2ZXAA 3AXXA 3N15A 3SCWA 3N18A 1CPUA 4QP0A 4HOZA 1HJSA 2CYGA 2J7HA 1JAKA 4AC1X 3QR3A 3EJPA 1LF1A 3VGEA 1Q6EA 3WEMA 3H54A 2OSYA 3CH9A 4AZ7A 3A6OA 1CXIA 2X2HA 1BF2A 1QI5A 1GJUA 1PS3A 1VFOA 3VO0A 5HOSA 1UD8A 1V3KA 1JZ7A 3K4AA 4UOJA 2WCAA 1KTBA 1BVZA 2E40A 1GQKA 3WEZA 1UASA 4W93A 1C8XA 1EGZA 4UQBA 1JI1A 3L4TA 1MW3A 1H2JA 3W82A 2EXOA 1H11A 2G4FA 2XM1A 3AZTA 2W67A 4MJ2A 3OIHA 3VMNA 3AXHA 1R75A 5I77A 3EDFA 5BRPA 3QOKA 4TXEA 4W84A 3VIKA 4AZCA 1WZAA 4JCLA 2D2OA 3L4XA 2VZUA 1MW2A 4AIOA 2OYMA 1QNSA 3WFZA 3VNZA 5IHSA 1WKYA 1VB9A 4AIUA 3RCNA 2XTKA 1AMYA 1EDQA 3ARYA 3A4AA 2WANA 1FFQA 5E6YA 1RH9A 4D6EA 4HZ7A 1DWJM 4BZYA 1E72M 1I75A 2D23A 2WKLA 5A94A 1BTCA 1ZBWA 3NSXA 3CHDA 1E4MM 2WBKA 3S6TA 1KXTA 4CU6A 1PJ9A 1BSIA 1C7TA 3VIMA 2UWFA 3PTMA 2G3NA 1KWKA 4XUYA 3T0BA 4AD2A 5D9PA 3VD3A 3OLIA 1HN1A 5D8WA 1UR0A 3MUY1 1XYFA 1HIZA 1NH6A 5DMYA 1KGXA 3A4WA 1B31A 4PEEA 2E0PA 4B3LA 3U5YA 4PMQA 1E4IA 2ZWYA 3LMYA 3PN8A 2DT1A 3CHCA 3UR7A 4AXNA 3VGFA 4AZHA 3DX3A 4N0RA 1QOXA 4YHEA 4LQ1A 1OGBA 1E6QM 3KL5A 3WDHA 3HU7A 2ZUVA 4JFWA 4PUDA 1HF6A 5DF0A 3WSUA 3L2LA 4CN1A 1C91A 5BXTA 4J3TA 1E73M 2EPOA 4AD1A 3W37A 4RE4A 4B9ZA 2YIHA 3BUPA 3A47A 3A23A 3PZIA 2PWEA 4PTMA 1X1NA 1KXHA 2HVMA 2EADA 2V5CA 3D52A 2O9PA 2JIWA 3VPLA 1K9EA 2D3LA 1VF8A 2VX6A 4TX6A 2Y2WA 1CENA 4QCEA 1ZBCA 3WD1A 4D6GA 2QV4A 1ISYA 1E0VA 2PBGA 1M03A 4WKHA 2XFYA 1UD3A 3HG5A 3AS0A 4D71A 1B30A 3AIVA 3N13A 3AFBA 4HPGA 1DP0A 1LWHA 3BAWA 1ZU8A 2FGZA 2OYLA 1KB3A 4IISA 2VQTA 2CESA 5A8NA 4FF5A 1ZS2A 4L4PA 1W9DM 4EE9A 1UR1A 5I3DA 3EMZA 1KGUA 1G9HA 4IPNB 3W27A 1TQSA 5FOOA 1UWQA 1H49A 1LWJA 1KXQA 2PF0A 4FNRA 1GVYA 5JUVA 4FNPA 1M01A 4TTGA 2UY5A 2WVUA 4UFJA 4A4AA 4WSJA 1TG7A 4RE3A 5GPRA 1C3FA 1XSIA 1OIMA 1OSEA 2YBUA 4MAZA 3ZT7A 1W1VA 2VRJA 2BVYA 1BAGA 4P8UA 3VDCA 3AS3A 5KEZA 1SFSA 5CLTA 1UR2A 1ISVA 3VOCA 1V3JA 2WLYA 2E9LA 4X0NA 3BLPX 5C71A 1GVIA 4RL3A 3WH9A 1JYVA 4CU7A 1E5JA 3DYMA 1W3JA 1TVPA 4PRWA 4GO9A 1TQWA 3U5UA 3BVUA 2CEQA 2XVLA 3BUDA 2X05A 4PMRA 1HTYA 3WL0A 1DHKA 2C8NA 4CD5A 3RPMA 4OOUA 1QNRA 4RE2A 1EO5A 4AZ5A 4CGTA 1E3XA 1J10A 3CUFA 3WF0A 3ZR5A 3KL3A 3RIKA 3SURA 3T2QA 5E6ZA 4MTVA 3FN9A 1R33A 2DT0A 3N1AA 4NX0A 1WP6A 2VQUA 1B3XA 1PZ2A 1C7SA 3N12A 2V3EA 3L4UA 1J0YA 3WDRA 4Q7NA 4KGLA 2VZSA 2GDUA 3OGSA 3PZQA 4HZ6A 2BHZA 1B90A 1V08A 1NP2A 5A2BA 1PX3A 4BQ4A 5A6JA 3SUTA 4PBGA 1WB0A 1J0HA 2WMIB 1VAHA 2BHUA 2PB1A 3BUBA 1FA2A 3BVWA 4U5KA 1HJVA 2BY1A 4V27A 3A3HA 5LA1A 3AYSA 2V5DA 1C90A 1UKPA 4GZEA 4ATWA 4NF7A 2Z1KA 3BXWA 2VX4A 3ARWA 1OD0A 1QI2A 1IZJA 2F61A 3UG3A 5AYIA 4X9YA 3T08A 1QHOA 1C92A 3PZNA 3WEOA 3PZVA 3GXFA 4KMQA 2J8GA 4D1IA 1X6NA 4BQ3A 1CGWA 2WB5A 3CHEA 3CZNA 6A3HA 3FY1A 4LYQA 2C7FA 3TTQA 3ZJ6A 3WH5A 4Z2LA 1JZ6A 3WBEA 5BRQA 3AIBA 3CZGA 2WMFA 3OLEA 5A6AA 2V3FA 3SCVA 4GI9A 3APGA 1UKTA 1SYTA 3RDKA 4PYSA 1QVBA 3DDFA 1EQCA 3UG5A 1UD5A 5I24A 3FNDA 2DQXA 4UFIA 3VIGA 1E6NA 4ZFMA 4QFUA 2ESCA 3OBAA 1DWHM 3BAJA 3PZOA 2ZUNA 1CWYA 2X09A 1H41A 4P7OA 4AD4A 2WXDM 2OSXA 4W7UA 2FDMA 8A3HA 4BQ5A 3QHNA 1V02E 3CBWA 2VVSA 1MFUA 3A4XA 1CZ1A 7A3HA 4CN4A 3IAPA 2XFRA 3RO8A 3IK2A 4ACYA 3B9DA 3UESA 1IT0A 1V0MA 2WHLA 4H04A 5ABHA 1EDTA 2WLZA 3VIOA 1UH2A 4EK7A 3CLWA 1OD8A 3BGAA 2CKSA 4UFHA 5GNZA 4UNIA 4QLKA 1DWGM 2WMJA 3LRKA 1AQ0A 5E9AA 4QLLA 1E4LA 5DT5A 4CUCA 4Z2HA 1TA3A 4DUVA 4A3YA 2YL6A 5A6SA 1NOUA 3IAQA 3MMDA 5A95A 4AD5A 3O6AA 3CV5A 2F7QA 3DX2A 2WAGA 1I1XA 3KWXA 2DEPA 1RPKA 3GXTA 4GKLA 4AIEA 3T0DA 2XYLA 1J0KA 4NZCA 1B3VA 2AOSA 3VIJA 4D72A 4YHGA 2E9MA 2CETA 3VGBA 1VEPA 2EABA 1JD9A 3GXMA 4KWUA 1QI0A 3WH8A 3FAXA 2UY2A 4D6DA 4CD7A 3HG3A 5ABGA 4BQ2A 4U31A 3WF4A 4M8UA 4J28A 3GXPA 2J7BA 1G5AA 1PAMA 2V3DA 1UD2A 1FH8A 3EMCA 4W5UA 1HJWA 2WSKA 4EAMA 2W91A 4NRRA 3AIUA 1B2YA 1E0XA 4PTWA 5A3HA 2WHJA 1UD6A 2XM2A 3K1DA 1JXKA 2GFTA 5IFTA 1M53A 2YFOA 3GTNA 1XRVA 2WCGA 3E1F1 2J75A 5CPQA 4OJYA 4MB5A 4JFSA 1H0IA 1Q6DA 4NSBA 5E09A 2X1IA 4AD3A 2NT1A 4NXSA 3WNMA 4M81A 5TD4A 2QMJA 4V28A 3EJUA 1PX8A 1TA3B 1BG9A 1PZ3A 3A22A 3CZJA 3THCA 3D51A 4CD4A 1D3CA 2DGAA 2OW6A 4H8VA 3N17A 1UWSA 5CGTA 3ARVA 2DIEA 2XG9A 5I0DA 1HVXA 3UCQA 3S5ZA 5FL0A 4DUWA 2XIBA 3CMJA 2EO7A 4M82A 4MNMA 1DWFM 1CYGA 3WUFA 1W91A 2OWWA 5M03A 5JIWA 1NOFA 5M3WA 4MB4A 1G1YA 1D2KA 1OGSA 1MYRA 1KR1A 1D7FA 4TUFA 3W6LA 3ARQA 1XSJA 3G6LA 4A3HA 3U7BA 2DSVA 1DTUA 1GJWA 1HJUA 4N42A 3CZEA 2J7GA 4NXKA 1A47A 4QAWA 3VMOA 5CGMA 4C7FA 4P7NA 1HJQA 5HPOA 1J9YA 4XZBA 4J3SA 4UQEA 2JIEA 4AWEA 4FK9A 2OWCA 1H0GA 4URIA 4CN6A 4Z2KA 2WHMA 4H2CA 3NSNA 4QDMA 4GI6A 1PEZA 3CC1A 2G3IA 1ITXA 4PMXA 4PCTA 1W32A 4LPCA 3ZM8A 5A8PA 1PIGA 4AYGA 1E40A 3PZTA 3CZSA 4FNUA 5GNYA 4AZGA 5A8QA 2RGLA 1ECEA 3JUGA 5D9OA 2X2JA 1E70M 1QHZA 3BMVA 4PMYA 2E8ZA 5EFFA 1FH7A 3WY1A 3DX0A 1WDQA 3SCTA 4GIAA 1GQJA 2W62A 1R46A 2VTFA 1HP4A 5E1QA 5A6MA 1WDSA 2JF6A 1E55A 3WUEA 1H09A 1MWOA 3AZSA 2WHKA 2IXUA 1CGVA 4M80A 2UY4A 2MANA 3WF3A 3PHAA 3K8KA 1Q6FA 2PWHA 2ZUWA 1TR1A 2BY0A 2WCSA 4YPJA 2BXZA 4J3UA 1NWTA 3MV01 1SMAA 2DH2A 3LPFA 2VCCA 3NCOA 4OOZA 5CPSA 3MUIA 3L2MA 3LX9A 2WNWA 2QPSA 3WELA 4NZJA 1LL4A 4FMVA 2ZIDA 5I78A 2PWFA 2VCAA 1W9UA 1AQHA 1UR4A 2D0HA 1GHSA 2Y8KA 4S3KA 3W0KA 3WL1A 2WMIA 2A3BA 3WH7A 4F8XA 1NQ6A 3PBGA 2YA0A 2WM0A 2PWDA 3WENA 4CCDA 4MNLA 4R27A 1NM9A 4AEFA 4ZXOA 1WE5A 2ZX9A 3CO4A 1S46A 2XHYA 4CU8A 2YDQA 3TTOA 4QCFA 1LL6A 1QNOA 1JF6A 1UH4A 2VNCA 3H53A 1TQTA 5ECUA 1KBKA 3D3AA 3DECA 5ABEA 4HOWA 2ZX6A 5HXMA 2YA1A 1FH9A 4W8LA 3AHYA 3F5JA 4J7RA 2F1BA 3IJ9A 1HXJA 1XH2A 1E3ZA 2VJXA 3EMQA 2E4TA 4PN2A 3BVXA 1OCQA 4HMCA 2Y24A 1BYCA 2OW7A 1BQCA 1XCXA 3BAIA 4U3AA 3GNPA 4GQRA 3A5VA 4D6JA 3ALGA 3UERA 1R8LA 3K8MA 4PMNA 2XVPA 2O9TA 3TOPA 2CBJA 2J4GA 2VR4A 3SCQA 5C8BB 4W8AA 2YLLA 3CUJA 1WZKA 3AI0A 1JDCA 3OA5A 1B3WA 4ZEPA 1V6VA 4TX8A 4M24A 1HX0A 2WVTA 4M56A 4IUGA 2XN1A 1R47A 1FFRA 3I3EA 1XV8A 3W4RA 4U3CA 4ACZA 2DIJA 2D3NA 3FXYA 1TCMA 3WF2A 4F79A 3GBDA 1LQ0A 2Y8VA 1JXJA 4PMVA 4BA0A 3ARTA 2X0YA 4F9JA 4WLCA 3VD9A 4UOQA 4CVWA 1CBGA 1XD1A 2RGMA 2YA2A 1EOKA 1F4HA 3L4ZA 3N04A 2VO5A 2OWXA 1VJZA 3AHVA 1J18A 5I79A 3DC0A 5IDIA 3WD3A 3IANA 1W1PA 3VDAA 3K46A 3VSVA 1H4PA 2O9RA 3OZOA 1HKIA 1JZ8A 1HVQA 3MMWA 1ZJAA 4W88A 4P8VA 2XVNA 2BVDA 3D5HA 3WNNA 1KQYA 5BYWA 1I1WA 1PPIA 1WPCA 3EDKA 2WWDA 3F5LA 1K6AA 3PZUA 1VBRA 4AMCA 2HISA 1GOMA 3ZJKA 1LG1A 3POCA 2BY3A 1OINA 3K4DA 1EA9C 1EQPA 3RM8A 1DWIM 1R7AA 3OB8A 3UG4A 2ZX7A 1HKMA 2F8QA 2A3HA 1LLOA 2DT3A 1TQVA 3LPPA 3G6MA 2WWCA 1TE1A 4AW7A 1NWRA 5CXPA 2A3CA 1J12A 1JZ3A 3BVTA 1HJXA 2YL9A 4S3JA 2JEPA 5I5RA 2VMFA 5AC5A 2YBTA 3PZMA 2G3JA 3EJTA 4AZIA 2J47A 2OYKA 3VSTA 2CHNA 9CGTA 5D4YA 3CTTA 7CGTA 5A2AA 4KRUA 2ZUSA 1OGGA 1WCGA 1VEMA 3M6DA 2ZUMA 3AMLA 3SEPA 3LXAA 2XWDA 4QLJA 4U2YA 3VMPA 2YL8A 1WAWA 2DPEA 2J78A 3DDGA 3POHA 4CCEA 3THDA 2J77A 1GQIA 1V3HA 3HMCA 3FAWA 1CNVA 5BXPA 3VNYA 4UZUA 4OGZA 1KGWA 3ZQ9A 1BGAA 2CITA 4HMEA 5A1AA 3W81A 1VRXA 5FIPA 1EH9A 4CD6A 4Q22A 3HZ3A 2ZXBA 4LYPA 2IXVA 2VL4A 2F7RA 4WIWA 4H8HA 1W2PA 3LXBA 4BF7A 2CKRA 1E6ZA 4GZJA 1YHTA 5D9MA 4DWSC 3H55A 2GJRA 5EMYA 1JL8A 1CEOA 3CPUA 2O92A 1E71M 2J8FA 2JFEX 1CLXA 4P7LA 1M04A 2F7PA 1E4NA 3ARZA 3VKKA 4FLQA 2DSKA 3AHXA 4C7DA 3W53A 1A3HA 2XGIA 4MAVA 1B9ZA 2F7OA 1FHDA 2XGBA 4H7VA 1QHPA 4AZ6A 3AS1A 4LX4A 3IJ7A 1QBAA 4OBSA 1JYNA 3WDPP 3BCFA 4HPHA 1E6XM 2B31A 1EHNA 4B9YA 1L0PA 3S2CA 1WDRA 4XV0A 4BS0A 3VGGA 3FHAA 3L4VA 1JDAA 5JIPA 3ECQA 1EDGA 1ISWA 5GNXA 2PC8A 4DWSA 1EHAA 1JGIA 1OT2A 3DYPA 1GOQA 1R86A 3ZSTA 2VX5A 1VFMA 3MV11 3B9EA 3EDJA 2XPKA 1E6RA 2W4XA 4V2XA 3WH6A 3W26A 1VEOA 3WY4A 4JZ5A 3EJQA 3GNRA 4NRSA 5CZKA 3QOMA 4OUEA 4NZFA 5AYBA 3WY3A 1RP8A 2QMKA 4UR9A 4HU8A 4UQDA 4UFKA 3CZ8A 2YLAA 4B3KA 3O2LA 2JALA 4PTVA 1BYBA 3AIQA 5BCAA 1C8YA 5A6BD 3AQUA 2EPLX 3AICA 1HP5A 2FHFA 3WUGA 1QNPA 5I23A 1UWIA 3CGTA 1ODUA 5GQBA 2J7CA 2WSPA 4GXPA 1V6XA 3A24A 4JKMA 1JAEA 4MDPA 1QWNA 1E0WA 3L4YA 1V6YA 4PMZA 4HOXA 3GZAA 5CSUA 3WMSA 3ARSA 5DT7A 3TP4A 1OT1A 1TVNA 2E9BA 3KL0A 1JZ4A 1GORA 4J3WA 3VX1A 2NSXA 4OKDA 1JD7A 3OLDA 2OSWA 2D24A 3WNKA 2CPUA 1SZNA 3ARUA 4AD0A 3CMGA 4PCSA 5BWFA 4XZWA 1W3LA 5CPTA 1GQLA 2E8YA 4JAWA 2XVGA 1J11A 1Q6CA 4IM4A 1SMDA 1HKJA 3WMCA 1GOWA 3GXDA 3AMDA 3AMCA 1UZ4A 1QBBA 1GOIA 3I3DA 1XH1A 4MNJA 4ATLA 6TAAA 1ESWA 3RMEA 2G3MA 3WMBA 1XYZA 5CLWA 3QHOA 4AZCB 3CHFA 2CHOA 4R5EA 3VTRA 4AISA 3WQWA 1JZ5A 1E56A 3GYCA 3AXIA 1CIUA 1XH0A 2PI6A 2BS9A 3W24A 5F7UA 1CDGA 4MB1A 3HG4A 3KLLA 3GNOA 4UQ9A 3WKZA 3T2OA 3BUIA 1E6SM 3VD7A 4JFTA 3BAXA 3D50A 3GH7A 3BLKA 2DH3A 1XHGA 3LRLA 1UH3A 4DM1A 1AVAA 1ITCA 4UOZA 2WZHA 4MJ4A 2YDRA 3NIYA 4FLRA 4NI3A 4HA4A 4CD8A 4HP5A 1QNQA 5JBDA 1HT6A 5ABFA 1UG6A 1MXDA 1V0KA 1V3MA 4W85A 3ZO9A 2X2IA 3WNPA 3BH4A 2GJPA 1JG9A 3W6MA 3WQ6A 3D4ZA 3WBAA 1UUQA 3SUVA 2ZICA 1Q4NX 3DYOA 1H3GA 2WMGA 2GVYA 3WIJA 1FP8A 2FGLA 2VRQA 3MU7A 3ZJ8A 2XN2A 1CLVA 4WK9A 3PTKA 5D8ZA 3ZT5A 1KCLA 4C7GA 2GJXB 1BG4A 1ZBKA 4W86A 2WBGA 2YKKA 2VOTA 3RM9A 1NOWA 3WD0A 1J0ZA 3ARPA 2BXYA 3II1A 2WYSA 3OGVA 4WF7A 1HKKA 3RILA 3MO4A 5E70A 1MVYA 5FL1A 1JFXA 2ZWZA 1JNEA 4D6CA 4UQCA 3BSGA 1HXKA 1DWAM 3FW6A 4M1RA 2UY3A 3MANA 1C8QA 2EBNA 1B0IA 4D6FA 5HBFA 3AMKA 3GM8A 2F1AA 2FH6A 4Y7EA 4E2OA 3B9AA 3ZOAA 4LGXA 4FLOA 2XJ7A 2W66A 4PMUA 3WFLA 5HPCA 1E9LA 5IHRA 4H41A 1BVNP 1P6WA 2DT2A 3MUZ1 1B1YA 5ABFB 2QF8A 4DO6A 4EKJA 2BY2A 1UKQA 4U5IA 1V3LA 3CZKA 2WMHA 4YN5A 2VZVA 1U2YA 3AJ7A 3MUAA 4GO8A 3SCPA 3BCDA 3NDZA 3TA9A 4D1JA 3KE0A 4UFLA 1ZB5A 2WC7A 4D6IA 3WUBA 1RD6A 4Z2IA 5M17A 1QI4A 3VGHA 1BYAA 1VJSA 2DSUA 4P7RA 1US3A 2GK1A 3KZSA 4CCCA 3GH4A 4KRTA 3AIWA 4JL1A 3U7VA 4PMOA 3TTSA 3UR8A 4FNQA 3EDDA 2A3EA 4CKQA 1KR0A 1UD4A 3DX4A 1UWTA 5BXSA 2ZXDA 2IGTA 1HWWA 2VI0A 2CBVA 1K9TA 5A6BA 4W89A 4GQQA 2AMGA 5C70A 1W3HA 5IXEA 1US2A 1F4AA 1KWGA 1M7XA 1O7DC 3ZR6A 4KH2A 3TONA 4M29A 3D4YA 4J3VA 1HNYA 3SCOA 2D20A 4JFVA 1K9DA 2WVSA 2XSAA 4KGJA 2FE0A 1UYQA 2ZUUA 4UTFA 1MQPA 4IPLA 3SCNA 1GCYA 1VBUA 2J7EA 2XFFA 2OLHA 4AY1A 2QHAA 1HL9A 4UZSA 3MMUA 4P8WA 3QGVA 1OBAA 3BSHA 5BXRA 4E8CA 2W92A 3OZPA 1CXKA 1XGZA 1U33A 3GXNA 3SCUA 2EEXA 1MW1A 1BYDA 3HN3A 5A2CA 2BFGA 1E5NA 1TFVA 4K68A 2X2YA 4U33A 2FH8A 2JF7A 2ZOXA 5AC4A 2CNCA 1GZJA 1CXHA 2CBIA 3SCRA 4WSKA 1B3ZA 4J27A 5JBFA 2XUCA 3W38A 3CUHA 5KZ6A 3W29A 1R34A 4FNTA 5A69A 1NWUA 3WQ5A 3I3BA 2QLYA 2JEQA 1XCWA 1QPKA 3ZSSA 1GONA 3SCSA 4OBRA 4JHZA 4MNKA 1NP0A 3T2PA 2G41A 5EB8A 3W28A 2D1ZA 1BFNA 3ARXA 3SIMA 4DWSD 1QW8A 1TMQA 2IUZA 1UQZA 1CGUA 3TV8A 3LXCA 1G94A 1FHLA 3EYPA 2O9OA 4TVUA 4FLSA 3M07A 1GUVA 2GUYA 1HL8A 1Q6GA 1JFHA 1QX1A 3ARRA 4OZOA 4DM2A 3HG2A 3NUKA 2Q8XA 3VX0A 3VM7A 5BROA 2F18A 1K9FA 1W9BM 3AYRA 3CUIA 4JCMA 2ZX5A 4AMWA 2EJ1A 4F9DA 1EXPA 3UEQA 4U2ZA 4E8DA 3AROA 3MSDA 4JIEA 5EBAA 4AMXA 2WC3A 2W63A 2FHBA 3WDJA 1UWUA 5CG0A 1EO7A 1QWUA 2GDVA 2VR5A 2DDXA 2ZUTA 5DFAA 4UFMA 3WDQA 3EDEA 3WQ4A 2XVKA 1J0IA 1UOKA 1W9VA 2XSBA 1WNOA 1UA7A 2ZXQA 1MQRA 5AY7A 1CTNA 3M7SA 1JZ2A 4W7WA 3BMWA 1B3YA 2VURA 5D9NA 2ZX8A 3VM5A 2EACA 4D6HA 2J7DA 3EJRA 1U30A 2YJQA 1CGTA 1CXLA 1DEDA 1ZBVA 1KCKA 1GOOA 2AAAA 3EBVA 3GBEA 1GW1A 1E15A 1O7AA 1UHVA 3NYDA 3QHMA 2FHCA 3LPGA 3ZT6A 2WVVB 1UR9A 3F4VA 4W87A 5EFDA 3DX1A 1V6UA 4H8UA 2XIIA 1GNXA 2Y4SA 2BHYA 1ZJBA 4MADA 3LPOA 3VD5A 4AEEA 1W1TA 3SUUA 3IJ8A
chains in the Genus database with same CATH superfamily
4UNLA 2VXVL 1AUSL 1VH7A 5CEZD 3VIIA 3S37X 1RD5A 5IQMA 3H4XA 1JPST 3VXNA 1HKLH 2X1XR 1HQRA 4ZYKB 3GSWA 3KUMA 4I5XA 4FQ1L 4A21A 2ZZ4A 1AO7D 3OVUB 1PQZA 2J25A 3BRDA 2R2HB 4GPNA 1U8HB 1IVTA 2AQSA 1HJBC 4ZUSB 4F7TA 3KOYA 3P9WB 2QVMA 5FCUL 2ORBH 4F3FA 5FKYA 3ABOA 1FTXA 3WFEL 3ZVHA 3C0LA 4M7LL 4NNCA 3ZWTA 4B3ZA 2PF6A 2I7OA 4JTFA 4FXKB 4GO6B 2OXHB 4NO3B 1H60A 1S5NA 1BZEA 3B1UA 2DTMH 2YQ2A 1G0CA 4HA3A 2MCPH 1MHCB 1YEDB 3QZLA 3WLBA 1MRFH 2UUDH 3OJDB 4MFHA 1QDSA 4P23C 1R9ZA 4WXYA 4GUQA 2JE8A 2OL3A 5EFIA 5IJDC 4RV8A 1YECH 4NSKB 4EI5C 4M5ZL 5BZDA 2Z28A 3H24A 4MY9A 4YYCA 1Q6OA 4G9PA 4JQ3A 5FLUA 3E49A 1IC5H 3VIHA 4XX6A 2ON3A 4GSRA 1XMWA 5J1SC 1L7IH 2FPTA 3OHIA 3UX9B 1UP2A 2ZCHH 2E5DA 2CHXA 5I71C 3F00A 2WW8A 3LGDA 3MS8A 4ONVA 4NHCL 1MELA 3CE1A 4Z0XB 3MI6A 4XHJC 3R8BB 5J1AA 3P0GB 3MFFA 4IU3B 2WLLB 3FUKA 4R90L 3RE0A 3U7YH 1MJJA 1N2RA 2YL5A 3PB0A 5GGVL 1QABA 1BCIA 2BNJA 1G9EA 3UXLA 3LIZA 5LAXB 4MMYB 1U8PA 5FGCE 5HDQH 2R24A 1U8OA 2KZWA 3FQRB 4MAYA 4NIYE 2FIQA 2ZYFA 3EEZA 3TBSB 4BE5A 3QZEA 5B1CA 5D02A 3KD4A 3D33A 4AV5A 5FYJH 4WUUD 5JDSB 2E3ZA 3TH2T 5C0IA 1XZWA 2R2BA 4HIHB 2NW0A 1NCUA 4JL2A 4UNKA 3TURA 4Y8EA 1T5WA 2J1WA 5AZ0A 1GPOH 3UPAA 1ZLSL 4ATTA 4P2VA 2EE6A 1BQSA 4NKMB 3SPVA 3UAJD 4XAGA 1EX0A 4OT7A 5LYRA 3TBWB 1PKQE 2X6BA 1MIML 3LS4L 5SWSB 5C2CA 3ITTA 5I74B 3M0IA 3WQ8A 3KPRE 4P9MH 3KS6A 2ODHA 4OJCA 4TTDD 1F9CA 1JWSB 3FZUD 4WWID 4HQQL 5DJDA 4L0ZA 1JYWA 1RQEA 1SDDB 3RGHA 2R0KH 1Q38A 1VCAA 1YBQB 3F7QA 3MX0A 4MJID 3UWQA 3MHFA 4RXGA 1O5DT 1XLDA 2D7TL 4DWSB 3VXQB 5CEZH 4ZMGA 2JJWA 4XO6A 3S8FB 4B9GA 5HNNA 4AEHH 1MCCA 2AAVA 2Y1YA 3LRMA 1A4BA 1D6EB 3AITA 2BIMA 3BN3B 4URTB 5C6WH 5A6LA 2I9LA 5DTFB 3OAYH 4QXUH 3EB4A 1M1SA 3FC8A 1X97A 1LG2A 4BCXA 1AQKH 3WFBH 1T4KB 4D8ZA 1LP6A 3K8LA 3CHVA 1ETA1 2EDDA 5E9DE 3WAKA 2X70A 2GJ6A 3V4PB 5GJSL 1UACH 1WBXB 1NICA 4PS7A 4CEXC 3RLHA 3VFCA 1JV2B 2VL5B 1TVLA 4B5VA 4KQ4H 1V03A 2DWSA 4MDJB 2L7JA 4RWHA 4D2NA 1PBGA 3EX3A 1VFLA 1SO6A 3ITCA 4NQCA 3R0NA 5F9AC 1GTEA 1E6OH 3P82A 4PRTA 4PREA 1BLIA 2KYIA 4MNHA 5LNEA 3T77A 5EBUA 3TCEA 2KX9A 4IPJA 5BQ7B 2R29L 5H94B 3IMUA 2DJSA 2B59A 2VCBA 1KXVA 5K1NA 3QJQB 1C16A 5DJXB 2R2EA 3U36A 4Z1PA 5BJTB 1GH7A 6TAAA 1XLFA 3NCFB 4ATDA 4QRUA 2HBVA 4LO9A 2CO7A 2CA4A 5LA2A 1AE6H 1ISZA 3QXVA 3T0ED 4Q6XA 3W76A 2ALWA 3DWTA 5C09D 1I1CA 3WO4C 1IO4C 2HMID 2DEWX 1OFRA 2GWGA 2TPSA 3AISA 4JTGA 2N3JA 4F7PA 1ONRA 1RHFA 3RGVB 4ZS6D 3WDIA 1OP9A 1RJQA 1IGYB 1EA0A 4FX5A 1G7JB 2J5LC 4UWQB 2NYKA 1XBYA 1OAQL 1A6TA 5DWPA 4DQOL 3MRGA 4MJIB 5LN4A 2ITDA 5SV4A 1Z44A 3PG8A 3VZXA 2ZYRA 4QQ3A 5CHNA 3MCYA 5I82A 2F5BH 4OCLC 4XMVA 1JNDA 1YDPB 5EUOE 5DY2A 4R26L 2HKHL 4Z5RA 4RMRA 1EEQA 4MDIB 3P9MA 1OCWH 3QUMB 4W68A 3V6OE 3W2DH 2OB3A 4AAJA 5C7HA 4J6RH 4LGRB 2AI0L 4YHIA 2IOIA 3MGAA 1UWRA 3C0JA 3L21A 2ZOOA 1W8NA 4N4PA 4UZGA 3BAYA 2OKMA 3AOFA 4YXHH 5IVZA 2PU1A 3GC5A 4FOMA 2RDXA 5DURB 5B38G 1WH0A 4Z7VF 4OFKA 2BZNA 2KH2B 2WXOA 1WAEA 3B34A 4M9OA 2AJZB 4PS3A 2J62A 1IJNA 4JG1L 3R11A 3ALFA 1AQMA 4AHOA 5JU6A 1UKOA 4XMZA 2J74A 3RPTA 2CCRA 4UIKH 3ZDYE 1DBKL 1A0CA 3EOSA 4L5ZA 4XSLA 4N90E 1WBHA 4Z7UE 3HN8A 4U0QB 5F88B 3KNBA 4HCGA 3SN1A 1LL7A 3V2AR 5HYJD 2Z1SA 4HSQA 1TREA 2EIKB 3GO2A 1DJIA 4UV4H 2NT0A 1OAZH 4G43B 4G8GE 4OF0A 3QW4B 5KTLA 4ACZB 4XIAA 5INDA 4NDMB 3RWIA 4GP5B 1J93A 2EINB 1ORQB 3OKNB 3MRHB 5E24E 4M9PA 1IXPA 2PN5A 3FKUS 4YLCA 3DFNA 3UG8A 4Q32A 2ZRVA 2HRHA 1FNEA 4JB9L 1UT2A 3HFFA 4ODXB 4YGAB 3SQSA 5JXQA 4ELME 4WNQA 2X38A 4OW6A 4GBXA 3CFJB 1H1YA 4ZPVA 3RFRA 4R5TA 1EANA 5B3SB 1IKFH 5L8JB 4PRRA 2R15A 3M17B 4LDCA 3S3DB 3MBEA 1DE5A 1F05A 4JO2H 4GMTL 5LGHL 1FY6A 2DQUL 4XUGA 1IKOP 4B53A 2FVMA 3DOPA 3O3AA 4KIEA 4ZB0A 3WLMA 2R8WA 3ETBF 5HDRA 4ZDHB 4Q9CA 5I18H 3MC0A 5JO5A 4MLJA 2J72A 1E28A 1TNMA 5L8LB 4UTLA 1I1FB 2EE2A 1OFQA 1T7VA 4PJXE 2GJZB 2BHFA 4FX7A 4KETA 1F4WL 4AX3A 1XLCA 2KL6A 4FJ6A 2XFWA 2NCMA 2CO4A 1IC7H 4PUEA 1DIEA 4P46B 32C2A 3RDTC 1GKOA 1N82A 1JDDA 2ODOA 1YPZB 1KIPA 1G0XA 4Z7IA 3WV0A 5IHWA 4PRNA 3KWUA 4DPAX 1LJYA 3WSQL 1X7SA 4HETA 4FXKA 2DLIA 4E4PA 3CUPA 4GQ9L 3WO4B 3NCCB 1ECYA 3DV4B 3UU0A 4M5ZH 3FDKA 5GSVB 4WFHE 3NFPA 2D0FA 1BZQK 3OAYK 4GINA 4PH8A 1DJWA 5DZVA 1MJJB 1N2RB 2I85A 3LVEA 2R1MA 3VXPB 5DVNA 5A6KA 1TO4A 1UCBL 3ZMEA 4HC1L 4IKIA 3VA2C 3CBRA 3IXTB 3TNNA 2PTZA 2CAKA 2X7LA 1M5WA 3FQTB 2ZXCA 3MRCB 3MMEB 1EHLH 1GKQA 4H1LA 1ZT1B 3GR8A 2PWGA 1BGXL 4LCUA 4TKWA 2L4OA 4OFVA 4V1DA 1POKA 1W1YA 3C8FA 3ARBA 3LDVA 1EGJH 4KKRA 5AYUL 4H0GA 2JBMA 3NJ3A 4OZ4A 3HR5A 5HDQL 5CIPH 1MKFA 1T5XB 2EJAA 1UZ1A 1FZMB 1OOWA 1MNNA 5CJ8A 5LN8A 2EKJA 1GVFA 2GSJA 4F7EA 4XCFL 2VRAA 1E0OB 1MUJB 3H9HB 4BWTA 3B7UX 3DHUA 4CBPA 2OX1A 3GHTA 3QG6B 3BUQA 3HQPA 1DORA 4Q7IA 1KXTB 1AZUA 2YWYA 4NNPH 4HTYA 3MBEC 5I19L 1GTNA 4HFWA 3ES7A 4B16A 3PF2A 4I18B 1DSFL 3MGOA 3RB5A 4CVXA 3SGDI 4DN3L 1FFNA 4XP4L 1PTDA 5AW4B 2F9RA 1MXGA 3DA0A 1SUHA 3V5CA 3TBVA 1PZCA 5J6GA 3U1SL 1O4UA 2Z3FA 4HKBB 5IQNA 4QG6A 1CR9L 1RUPH 2O6DA 4KX8A 3H9SB 1JCYA 2OCJA 1NU5A 3P93A 5IFHH 4X2RA 1M2OA 1L7TL 5EZPA 3IDGA 1TR7A 3UIZA 1JCNA 3KYKH 1EFQA 1F56A 1U6AL 2R0WH 3QULA 3V6ZB 3D3VA 4RMUA 1D6VL 3CXDL 3M46A 5C07D 2AQ1A 3AXKA 5GSRA 4DKFL 1A3RH 4AXKA 3VIFA 3NDYA 3FZUC 1K03A 2AJSL 1ACXA 3MNWB 3FJTA 3VXSB 3EWZA 1ZALA 1S1RA 1E5ZA 5T5NF 1TCDA 1T7YA 1KLFB 2XINA 3ARED 4HIIB 3MOBH 5FYJE 1RK6A 4NGHH 3HV8A 4MDOA 4NU7A 1ISXA 3ILEA 2EPMX 4P5UA 1SDYA 3I6LE 4HUXA 4QKTA 1ZHNA 3NQ8A 3G3LA 3QRHA 4QG8A 3ZIZA 3IUDA 2FJHA 1AQDB 4IX2A 3NIDB 4QHUB 2NLYA 5DC2A 5KSVB 3G6JB 1C5CH 4QI3A 4F8OA 4HIBA 5DUPL 4N86A 4NQDD 4PCPA 4ZFOA 3MJWA 4K7FA 2F19L 4WKFA 4E5TA 3IDMA 4PSPA 4PGJA 3JVFC 1R0AH 3TIDB 3KPMB 5F4WA 1EIXA 4MZ8A 5FB8B 3C2RA 4ZXLA 1GMEA 1QWKA 1CECA 3TEUA 1XG3A 4G56A 3TMQA 4YO0B 1TTCA 2WZIA 3NZPA 1R5IA 2W81C 5KVFH 4OQ1A 5LGJA 4E5XG 3UC0H 1W3KA 4I9JA 5JHLH 1QYGH 3PBYA 5JW3L 5EO0A 2CIPA 5C0QA 4C54A 2H26A 5D70L 1J5SA 3OQ8A 1AAJA 4FF7A 4HKJA 8CGTA 5E5UB 3U6XA 2VZTA 1T3FB 4NBZB 1SFTA 5KMYA 3SDCB 5C2UB 3G04B 4LOUD 2ZE0A 3QQDB 3QRBA 4PCKA 3AXXA 1QFOA 4M62H 9PCYA 1WFJA 2Y62A 3K2IA 1CPUA 3KPPA 4DEPC 1FWJC 1HJSA 2J7HA 2QSCH 1A6ZA 3X3GL 3CQKA 3QR3A 1IKFL 2M1KA 2ZXGA 3EJPA 4G9FB 4NYLA 4GEJA 5B39G 5CBJA 4ACPA 5KYYA 4DP0X 5MI0B 4OGYL 3H54A 4LEXL 3CH9A 4IHOA 3H6OA 3UXKA 3BEVB 1YEKL 1I7TA 4HGMA 3S48A 3WTUA 3W1MA 1J9CT 2C3GA 1CXIA 1AZRA 1RIHL 3HN5A 4X7CC 4D3CL 1UD8A 2VR6A 4F1SA 3M41A 3B6SA 1U8JB 5TGBA 1JZ7A 3WFHA 4U7KA 1LQSR 3L12A 3K4AA 1YDPA 5G1MA 4S1DD 4HUVB 3HHSB 2HPMA 3W7NA 2WCAA 1K77A 2JELL 4MD0A 5CGYC 2WUCL 2OTDA 1UATA 1PTAA 2Z25A 1JF1A 2DDQL 1YMMA 3EO1A 3I6GA 5HYSG 1DYSA 1MW3A 1NGZB 1B88A 4U6YA 4OIBA 1P5UC 1RIVL 4O51B 5T1DH 3RURA 1PJWA 2EXOA 1LQAA 2G4FA 4DGIH 5LWYH 1FZJA 4L8BA 2ALDA 2E3VA 4N68A 1MZRA 3F6JA 1UBSA 2WJEA 1LK3H 3B97A 5DDHB 5HY9A 1IE4A 1V6TA 5DD1H 3CFCH 3FUIA 4BHUI 5AN7A 4BFNA 2HVOA 2VGIA 1DLHA 4BKTC 3MZ2A 4BSVA 3NXLA 1S7WA 1CDHA 3DKJA 4OF5A 1AA1B 2WO3B 4Q9QH 3RHGA 4D8OA 5LZLA 2SFPA 3I9AA 1I8KA 5F6IC 2VFIA 3SO3C 3FTUA 1MCJA 3MA8A 4XVUC 4XMXA 3VXGA 4EP8C 3RCNA 1SDDA 3ZZSA 3IIXA 2R56L 1A3LL 2ADJB 3A4AA 1RZQA 4A7GF 1DBBH 4BFFA 4NY2A 2RCSH 4A04A 5DHVA 5K9JL 3UJJL 1IZCA 5E8DH 4DELA 3TEWA 5IJKA 2HROA 2FB2A 3PC0A 4UT6H 1DWJM 1CLKA 1I75A 3S5LB 1YE4A 4EI0A 2D23A 1Q9WA 4X4MA 2I9LB 5DTFA 1BTCA 2R0WL 2Z2BA 3L7RA 2C9SA 4E5XA 2IBBA 4XO7A 3M5ZA 5DZPA 1LOQA 4DESA 1TPUA 3HPSA 3S6TA 3UY7A 2LAAA 3FQUA 4PJ6A 1CBJA 1YBQA 5FGCB 5JPNB 2XETA 3ZTEA 3W1RA 1I3RA 4U7SA 3PJTA 5EOCJ 5HGDA 3ULUE 1ICSA 1Y0EA 4IQLA 4NILA 2WUBL 4RQQB 5ERWA 3WJWA 3BPOC 4LDOB 4R0LB 4PIBA 3RN6A 1WT5C 4V1DB 3HQ1A 4C6MA 3FSTA 5KETA 1K7XA 2G4JA 1UR0A 5TF0A 1R3JA 3WLJA 1AGEB 3QPXL 3KDMB 1NH6A 1YMYA 5J1AB 3T8MA 2F6AA 3VXPA 1AW5A 2OZ8A 1B31A 4PEEA 3IXTA 3TNNB 4QXUL 4PMQA 1E4IA 4QRRE 4E41E 4EE2A 3BARA 3OAUL 2W88A 3QFJA 2IH3B 5AEAA 3GIYA 1K8DA 3T78A 3N55A 5IOKA 5CILL 2Y7MA 4MRBA 3MKGA 1U8OB 1WFIA 3FCPA 4G7YH 2UWEF 25C8L 2FSEA 3BPWA 2ARJB 4KKPA 4YDVB 4J9JA 4QEHA 4LQ1A 4Z77A 2CZDA 4CVZB 3E3HA 1YMMD 3QHZH 3IDNB 4WHDA 3WDHA 1JNHA 5D32A 3TEXA 3IU3B 3HU7A 2ZUVA 2DQGH 8FABA 2KZKA 5I9QB 4JFWA 4TRPL 3SDDA 5ADPL 2A74B 1FDLH 1V7YA 1X1ZA 5DF0A 1FVEB 3D85D 3GI8L 3ITOA 5DHYA 2FKPA 2QDWA 3SO5A 4UTKA 2DYPA 4PGZA 1ZRQA 4ZPTA 5T1JA 3BDKA 1E73M 1CL7I 3WHXA 4IU2A 5D5MF 1MRDL 2C9XA 1H5BC 1OVZA 3OKMA 3QISA 1Z9SA 3W37A 2VC7A 2WJFA 5FKAA 2PGEA 2YDAA 4DKEH 3ID7A 5CJXC 3EXTA 1MCIA 3TJHC 1N4XL 2YIHA 2YQGA 3NEOA 3LKPB 3PZIA 4YX2H 4Z0SA 2QGBA 1KXHA 3V5KA 2I56A 3FQNA 3RJQB 3CH1B 2N0MA 3SBPA 2P46B 1K3UA 3VPLA 1CF1A 4M1DH 2BP3A 4HJWA 2W9EH 1P7TB 2BBFA 3P30L 1TJGL 1JPHA 4AWUA 4ZSOE 4G6MH 3KPNB 3FVMA 3AU2A 2EDWA 3EJZD 5DO2C 2Y23A 3K91A 1YLVA 3V4PH 1H8LA 3SN4A 5E2WH 3PJSB 2PBGA 1F1AA 3K74B 4JOMA 3C09B 4WKHA 4Q8OA 3EWWA 5I30L 3UFYA 1TSIA 4JFDA 4I3RL 3G24A 4X3ZA 3HRPA 3L6FA 4XWGL 4FRWA 1B30A 4OECA 5GRVK 4ZFOB 2JCCB 1JCVA 2ZYIA 3CVCA 3D6GA 4UXDA 4FZIA 4PLJD 3BAWA 4X7SL 4Y9FA 1BIHA 1XGTB 3RZCA 4WI2A 5E5MA 2R1NA 1KPRA 5JORB 4FF5A 3GSQB 4FP8H 1BZ7B 4ZTPL 4UIKL 1JGLL 3H9ZA 4PTTA 3RPIA 1F3XA 3UAAA 4OU1A 2ZOTA 4G8EA 3RWIB 3SJVE 1DIOA 5ICZA 5FF3A 1H1ZA 5IMLA 3C8NA 3QDMD 4GJ1A 1TJHH 1TQSA 1DCEA 4ZB2A 3RPKA 3W11C 1H3TA 5MHSE 1DQJA 4TSAL 4XXWC 1NFDB 1KXQA 5FECB 25C8H 2PF0A 4FNRA 3UTSB 3PY2A 3FCTB 4R8WH 4X63A 4YDLB 2OX5A 3TYUA 4UNVA 3RHWF 1H0DA 3X17A 1FNFA 4NJJA 4K73A 3BWUF 4RSVA 1TG7A 1E8YA 2XZQH 3HRZA 1QFUL 2H3BA 2WO4A 1DQML 4J3OC 4DO7A 1Z1WA 2APWA 2BSDA 4YHYB 4Q6YA 4GG6E 4A63A 3VJ6B 4LSRH 4PJEE 3UYOD 3GKFA 3VFMA 4F7CA 5AL8A 1OARL 1E1CA 2J73A 1S2TA 4EVNB 4Y5XA 5I0VA 1GL4B 3O4OC 4H88H 2BVYA 3FQ2A 5D30A 3ZS4A 2H8XA 1BAGA 4EUPG 4P8UA 2NW2A 3HB3D 1F11A 3NCXA 4GAGH 4ENED 4OFIA 4X6FA 2BSRB 3BGGA 4A2DA 1S7SA 5DT1H 5IRPA 3MA9H 1ISVA 4FQIL 5T1LB 4FXLA 5AVXB 3G3MA 4XOAA 4GABA 1QOKA 5K39A 1JMXA 5I16B 1BA9A 1O9VA 2PUQT 2XKSA 3ARBB 5KWYC 2WPBA 3UJTH 3V5FA 4C6JA 1GVIA 2HB0A 1KCVH 2WTOA 2FIKB 3ZVVA 3C60B 5I1IH 3WH9A 3PB2A 1JYVA 3PL6B 4Y5VB 4M43L 1MFAH 1UIOA 3EYQD 4JO3H 3RWDA 5J0BA 3L5WB 1P7HL 5L7XL 1K7EA 4I1RA 4O9HL 3C5JA 3OKYA 3JV0A 4P48A 5I6KA 5HYJE 4LPUA 1TVPA 4AUBA 4Y16D 5I17B 4DJED 3VFNB 3MCKA 3JYCA 4M5YL 3NH7L 1B4TA 4GO9A 4C56B 1TQWA 5KVGH 1WAAA 1OEPA 2ID5A 2WXIA 4PRWA 2VGLM 4IRSD 2CEQA 2XCMC 4N2LA 2E6JA 4RGNB 4Y4HC 2V5BA 1J8HE 4X5QA 3X3GH 3NURA 4K3ZA 5HQMA 4A6GA 3B2DC 3BAEH 4QIRA 3K71B 3G77A 4PMRA 4L9DA 3H42H 1UEYA 1RAKA 2CK0L 4S2CA 3TAKA 5J06A 4R6UA 3HMXL 3SB3A 4CD5A 3L5LA 3MUUA 4PRHB 3RPMA 1H8OA 4YH6A 1QNRA 1EO5A 2YUXA 4R7VA 3ROOB 3QIUD 5I1LA 4AZ5A 5BRZD 3CUFA 3D46A 5DLMH 3IJSA 3ZR5A 5JW4M 2Q71A 3LTSA 1T96A 3LEPA 2DZBA 1FFOB 4YBHA 5E8NA 5E6ZA 4A66A 1S2CA 3QRGH 3M5YA 1KCZA 3TBVB 3QW9A 4NX0A 1CVRA 2VQUA 1WQVT 8XIAA 2R4SH 3P0VH 2PCPA 3A5FA 5TNVA 1NDGB 2EILB 2I27N 3S6CA 4R26H 4AUUA 1I9JH 1FWRA 4HCFA 4WV1B 2V3EA 1J0YA 1HESA 3L4UA 4WHCA 4BRJA 5BS0E 1ES0A 3M0HA 3N9SA 2GL5A 2VZSA 2KMWA 4NKCA 1W0WA 3EOTH 4JKPL 3OGSA 1J05B 2FYYA 4XNQA 2QT3A 4EXPX 1TR9A 2BHZA 4LLVA 3DLQR 2D03L 1H6TA 5AW3B 3I65A 3NP3A 3VI3F 4EQ3A 3USZA 5A6JA 5HR6A 3U9PL 5E8EA 3OTRA 2NUPB 2VE6B 4W6XB 3CFCL 1WB0A 3VI4A 4ZSTA 4KVCL 5J13B 5DC9B 4DZBB 4JM4L 1MWAH 5TJWK 2EEBA 4GT0A 5IVXA 3KOZA 3ML8A 2Z8WC 2EDBA 1HJVA 2FB3A 2BY1A 5T3XL 5IB5B 1MJ8L 4Z7VE 5FF2A 2G60H 2V5DA 1C90A 4EDXA 1IIHA 1ZT4B 5DEJA 3Q2LA 3HUJA 3GSMA 3ELAT 4HX1A 3BXWA 1N59B 2VX4A 1OD0A 1KN2H 1QI2A 2RAMA 1WFNA 3GNDA 2JB5L 4Q8VA 3DBSA 3UG3A 1EXBA 3H0TB 4Y9BA 1LYXA 2R56H 1GOGA 5JXAH 5AYIA 2ZSWA 3GSRB 4X9YA 5EU5A 3S2MA 3EAUA 1IQDB 3HE7A 4N1EA 4E41B 3CFKA 3FQYA 1SJBA 3PZNA 2AJ3B 3GXFA 3OSKA 4XNUL 3ULUH 4PRID 4ABVA 5JXED 3GS6A 2W5PA 2DLTA 2EYRA 1MLBA 2H26B 4CMMB 3MZTA 4RRPA 4BJLA 1MFCH 3RVWC 1GYCA 1JGVH 3GM0A 5FO2A 3T1GA 4MCYB 3DARA 5HYFA 1F3RB 3C5SB 4TQEH 1U41A 1SMOA 3CHEA 1XEDA 4NN7C 5HHPB 3GYRA 3OVQA 4LRNH 2AFNA 2P8LB 5BRZA 6A3HA 2X53A 1MAKA 4NKOA 4RDQG 1SJHB 3TTQA 1JZ6A 4U1HA 3WK3A 3R06A 3I75A 3L17A 4JFOA 1VD6A 3N3MA 1QFUH 1R3KB 3FRUA 3QPKA 3RIFF 4POYA 1UB3A 1Y5XA 2MQGA 4K3GA 5A6AA 5A8GA 5LQBH 1CT8B 5DJ8B 2RBLA 3SCVA 3LM3A 3T0XA 3FRPB 3I6GB 7FABL 2BXVA 5FEZA 1LO4L 4C59B 1UD5A 3U0TA 1TEFA 1U8JA 5TGBB 3EX6A 2DQXA 4JTSA 2J71A 4WGVB 4YC2B 2ZF9A 1EWDA 2HN7B 5J1TC 1H7WA 1ND0B 4NC2B 1ZEAL 2CUHA 2GKIA 3MJ8B 3NA4A 4Y4FA 1PG7W 2XQYA 5D4QA 5E99L 4AWJC 4ELMF 3TESA 4ZFMA 2O5XL 3CN4A 2V17H 2UBPC 1T99A 3BSMA 1XIBA 4HNTA 2ESCA 5IQLA 5SWSE 2V2HA 3B2VH 3OBAA 3T7VA 3RJOA 3BLEA 5E5MB 1CIDA 3PZOA 4M93B 3UZEC 2YZ5A 4YDMA 2ZUNA 3ATZA 4YJZL 4H6EA 2DMKA 1B4EA 2VJ0A 2XWZA 4J2PA 1CTOA 1YYAA 2HT4C 4R7DA 3GC3A 1N8OE 1I8KB 4JGJA 2JXMA 1NLBH 1RUML 1W1A1 3M9YA 1XVSA 4LNVA 2KLRA 3OR7B 3V0UA 4B41A 1DLHB 3A4XA 2CGYA 1KPRB 2EXWD 2QZ5A 3I2CH 4XAKD 3IAPA 3KPLA 2D4FA 3EG9B 1CLCA 1RIUH 3H4HA 1WC7B 4PJ8A 4K3EL 5C8JB 5HD8C 3BSZA 1P1MA 1KFLA 1UROA 5CEWA 3ESPA 3H6AA 1A1NA 4WQOA 1V0MA 2QQKH 4HNCA 1UJQA 3GPSA 4GRLD 3P4OB 1RLCL 2KS0A 3MJ7A 4O1EA 3OGOE 1GXEA 2NY1D 4AEHL 5ABHA 2ENJA 4Z9KB 5F9OH 1KNOB 3UTZA 5BXFA 5E56A 1CBVL 3GDTA 3UZQA 3W84A 3THUA 3RG1C 1BQHB 4UFHA 1XGQB 3OVGA 1IFGA 1EO8H 1P7BA 3BESR 4K8EA 5GNZA 3SSJA 2WMJA 4F0SA 3LRKA 1AQ0A 3NRFA 4HDIA 5H8PA 4PJ5E 3WX7A 1E4LA 3W2NA 4N8CL 3SY0A 3KP0A 4FLHA 4ZR8A 5FDWB 2V81A 2YB1A 4CNIA 2DAVA 3CNYA 5IFAL 4EF9A 3LS4H 1FWSA 5GS3A 2FIKA 4ZOEA 5A6SA 4N85A 2JKPA 3GMRB 3IAQA 4KK8C 4GK8A 1KFJA 1O7SA 1MEIA 5LIXX 3WH8A 4PJEB 3CPLB 4WUUA 4AD5A 4DGWC 4F57H 2IMNA 3WEAA 1EPVA 1SU5A 1W37A 3UZEA 3DRTA 3O6AA 1TTUA 4JFDD 2IH8A 2DD8L 3DX2A 4W9IC 1RZPA 3EYFB 3KWXA 4NOFA 1WFOA 3DVNB 1DVUA 5H37H 4Z78A 4O1DA 5F0MB 4AIEA 4BQCA 3T0DA 3B8WA 2AJYL 3X14A 1R3RA 5KBKA 1R3JB 4BDVA 1B3VA 3I6TA 1RLBA 4AF0A 3BSZL 1NEZG 1MJ8H 2NY4C 4PCYA 3V3WA 1A7PL 2CETA 5L88L 1I4FA 2Y88A 3DDMA 1Z66A 1G6VK 2R1WB 1UEMA 1R3LA 1JD9A 1T6BX 2EABA 3KEDA 3GXMA 1KUMA 1EFXD 2JF1A 2JJSA 5D7KD 3TWYA 3VXRD 2HYMA 4ZZKA 3Q2NA 2X1UA 4ABWA 3T07A 3HG3A 5G4WA 2FSEB 5ABGA 3WQFA 4BQ2A 4G7SB 4JDTL 2BS8A 3K71A 4X5XA 1R24A 1DBJH 1ETZB 3U9UA 1OYBA 2EPHA 3MCOA 1GCFA 1ZPTA 2VH5L 3RUGA 2W0FA 4S0HA 1FN4B 1JFQH 3PHQA 3QUML 5E94A 4NQCE 5F96H 1HJWA 3EMCA 3BWAB 2UX7A 3FFCE 2VAJA 5J6GB 2B39A 7REQA 1I45A 2W91A 3GIPA 2QKIC 3V6FB 1L6XA 3AIUA 4RGND 3G18A 3WHXB 2DWTA 3GTIA 3G3DA 1UQSA 3SDDD 1NFPA 1EJOL 3MUXA 3OKKB 5E8DL 3NQEA 1MF2L 2ZOUA 4PLKD 3MRPB 4ZD3H 3PY9A 1A21A 3GTNA 2JTDA 5FM8A 2WCGA 3R8RA 2F8VA 3OD3A 3ITVA 1V55B 1S9YA 2X41A 4QAMB 4OJYA 2Q8AL 2HWGA 1WAPA 4JFSA 2LU4A 2WBWB 3CIAA 1I2RA 7TIMA 1YEJH 4RFEB 2NT1A 1INQA 1Q45A 4AYFA 4ZVJA 5JNYB 3NPSB 4ZB5A 4M81A 5TD4A 3HLKA 4WOQA 3F04A 1SJAA 1LQ2A 5C9JA 3EJUA 1PX8A 1TA3B 2NWRA 3M0KA 3DOHA 4MGGA 3KBFA 3PWUB 2TRHA 3L5AA 2XFXB 4H44C 4I0KA 5IKCB 1JRBA 2BOFX 2OMVB 2VOMA 4FALA 1KCXA 1JNNL 4H8QA 2XG5B 2WV8A 2J2ZA 4N0UB 3THCA 2PXYD 4ZMVA 3SN6N 1D3CA 1RJLB 4JPIA 1NQKA 2HAZA 3GSQA 4Z95L 4GKOA 1XYMA 4YO0A 2JJSC 1JNLL 4HOMA 1DOSA 2XPZA 3RDTA 1DQLH 4U3SB 1OCBA 3ARVA 5HQEA 4PD4K 2SEBB 3LEYL 4KK9C 5L9DL 1ZLWH 1X4XA 4S2SA 4P59L 3TW9A 3QQ9C 4MSSA 3WQCA 1DQJB 4OH2A 1Z9MA 3FT3B 3U30C 3EO9H 3TJPA 5FL0A 1N64H 2AI0H 2QDGA 4MBRA 5DD0H 2FL5A 5JDJA 1GHFH 4KNQA 2WCPA 4UT7L 5I1AB 1DWFM 4PJDF 3I6KB 2RKXA 2H1XA 4MXWH 1WGOA 3HE6B 2ABBA 2ZJSH 4G7FA 1NOFA 3PPHA 3HHRB 1XGDA 4MD5A 4BGDA 1AHWB 1SW0A 5KW9L 4MJ5B 4OD2A 1D7FA 5JIDA 4JNMA 4TUFA 3L7FB 2AXHA 2PTYA 2QR0B 3I7SA 2OX5B 5GGTA 1G7MB 5D7JB 5EUKB 1Q66A 2DSVA 3R7MA 1L5GA 4JD4A 3HZMB 5C0BD 1HQ4B 2A0LC 4RCAA 4CMHB 3K2GA 3CZEA 4CILA 2NY6C 5TH2B 2VDOL 4QAWA 2HLFC 4R8WL 3X3FL 4P7NA 5CCZA 4PRNB 4PUBH 2OFQA 4X5RA 1J9YA 3N2OA 2Z4QB 4XZBA 1IC5L 4QISA 4J3SA 1BXXA 1IM3D 1OWRM 3RX8A 2JIEA 4DGIL 3GS7A 1UWAA 4LB8A 2Y72A 4A35A 2J3SA 4GRWE 1WGVA 2WGXA 2GPZA 3HZYA 5FUZL 3W5MA 1AD4A 1M56B 2HN7A 3LKQB 2GDQA 3SE9H 5T5FH 3RVUC 5I8OH 4FFZL 4L23A 3RFZB 1MI3A 4IBSA 1RHHB 3P6LA 5GS0L 2CKBB 1A4AA 1F3WA 2DD8H 4EUPA 3FF8A 4OTXH 3G22A 4BFJA 1OQXA 1WUZA 4IIQB 1QG3A 3C2AL 3ENEA 1W32A 1SJDA 4RISH 4LPCA 4OCNC 4Y2DB 3ZM8A 1ZENA 4LUIA 1DN0A 4HGXA 4C55A 2PYFB 2CE6A 5B4MD 1EZWA 1IEQA 2VYOA 4W9FC 1CI1A 3JZEA 1ZP3A 3MPGA 4GNJA 1S2EA 5GZOC 4AYGA 1W1IE 1DIDA 3T9WA 5LIUX 1DBAL 1DSYA 1JPTL 1NIAA 1CUOA 1CE1L 1YLBB 2BINA 4LIQL 3ZRFC 4GAFB 2DQEL 4YVUA 2RGLA 4DBSA 3JUGA 5IVNA 4MMXB 3SDAD 4UTWC 3PFMA 4Q97A 3M1BA 2CBTA 3SY8A 3FFSA 1QACA 1K3ZA 4HFWB 3QARA 3D2UB 1G9MC 2K9FB 2TSAA 5GGTL 1CO1A 1RLDA 3WK1A 2MJWA 4ODSH 4NRXA 2YEZA 1USQA 3DX0A 5KVGL 3LS9A 3SCTA 4GFTB 1IBDA 2GC4C 1A3RL 3QGAC 4HJJH 4QX4A 1JZHA 2VWSA 2VTFA 4Q8TA 1XGUB 2Z92B 1JPSH 3ZQWA 4RZBA 1PG7L 1G6RA 5B8CB 3WQEA 3D05A 1ZTXH 2ARJQ 3IGAA 1SFJA 1MWOA 2YBGA 4GKSB 4UF7C 4WNSA 1CGVA 4XC1H 4YZFF 5HDLA 4KZDL 2WHKA 1LL1A 1K4GA 1AIFA 3BE7A 4HPOL 3L3GB 4M61B 1XL9A 3IN2A 4EJ1C 2UY4A 4FOKA 2YD4A 4DN3H 3PNWA 4G72B 1FO0H 1W8GA 2E1DA 2MANA 3WF3A 5I1DB 4DNHA 3IWUA 4EBQL 4TOYH 5D72L 3H8AA 4RKAA 2WCSA 2ZP0T 3ZHKA 5E2UL 1MFDL 3T6VA 5CAYB 4IJCA 4QHKI 5HUOA 4PJAF 1WTGT 2GK0B 3NQGA 5CLYA 1TTQA 1XR8B 1Q94A 1BBJA 1R3IL 3KCLA 2DH2A 3BYYA 5FAJA 1IT9H 3SKNB 5I8KH 5T5NG 1IEAB 4G7YL 3K0YA 1R3LB 3ME0B 4ZUUA 4MKVA 3TU6A 3E0VA 3LX9A 3LKOB 5DLLA 1AL7A 1I0DA 5IGXH 2WXMA 3RU8L 5DYOA 3F4NA 2WLIB 2R69H 1UA6L 3AREA 3N44F 4JRYB 4PRDA 5K33A 4BDVB 1LL4A 1W9UA 4FG6D 1P84K 4WCJA 1XLMA 1GHSA 2P53A 3K4WA 3WL1A 3NQBA 3SM0A 5AAMA 1OSZA 1IM9D 5C0GA 1KV7A 5FW6A 5J8OA 2WMIA 3MY9A 2K78A 5C07A 3NQ2A 4NJAL 1JGDA 5D7IF 3AWNA 4P3DA 8FABB 4F8XA 2HJPA 1W17A 4UTIA 2WM0A 2DMHA 2PWDA 4MNQA 5DEGB 1OCNA 2QUNA 2EE9A 1Y6NR 3V16A 4CCDA 4TVPD 5H2BA 3W2MA 1NQBA 4JY8A 1S46A 4KKBD 3STCA 4Z08A 2C1OA 2X4QB 3T4AA 1EUAA 2PGWA 3TTOA 2J55A 1QNOA 4RFOH 1M41A 2PFHA 3S3JA 5JA8B 1BWMA 4LANA 3V6FA 2ZVRA 2OCZA 1GS7A 3KM8A 5JOPE 5HULA 1S7RB 1SYSB 1WBYA 3EH4B 3H53A 5C9WA 1OAJA 1IFRA 4NB7A 5I9QC 2CHDA 1VCBC 4GXVH 3KW3A 3N25A 3U25A 4AEOA 2VJ8A 3WTYA 4XNYL 2AV7A 2QT6A 2LR4A 4HLEA 3F5JA 5CEYB 2F1BA 5IP4A 1HXJA 2VJXA 3QY6A 2VGGA 5AVWB 3GMNA 3EMQA 4PN2A 3KJ6L 4GG6F 1KO0A 1PZ5B 1MJ7L 4K5PA 4LAZA 4OHQA 5C0BB 3NQCA 3MZGB 3B8IA 5DS8B 5GGRB 1XCXA 5CSGA 3BAIA 5D4JA 1X9UA 4FJZA 5HHQA 4EVZA 3N40F 3SOBH 5U4NA 2IPFA 1UZ8A 2VIRA 5HGGS 3JWDH 3U4EB 1H3WM 2ZCKH 1P48A 1XR2A 1ZXKA 4LEQA 4L6HA 1S9XA 3A5VA 4FS9A 5D1XA 2GT9B 3MSRA 1R8LA 4DYEA 2FWLB 3DBXB 3ETSA 2CBJA 4B60A 2GSEA 2J4GA 1GW6A 3U2ZA 2V6AA 4Q6JA 4E0RB 1QO3B 2EKSA 2R83A 3HCVA 4UV7L 5GZOD 2VD8A 1E30A 5E8PA 3UWUA 1URLA 3BP4A 1BJ1H 2AABL 4L8SC 1IYXA 3AI0A 1RIVH 3QUZA 5T1DL 4AENA 2WNGA 1BQHG 2YGNA 3SY6A 1V6VA 2QULA 3PBVA 4TX8A 4KCWA 2A7PA 4JRWA 1E4XL 3ECBB 3BQ6A 4IUGA 3ZKMC 2V7NA 2UZIL 2XN1A 1R47A 3I3EA 4KZCA 3GUTA 1P0DA 2P76A 4JKWA 4M8QA 5AVZB 4BF5A 2CZEA 3FO9A 3VFTB 4WWKB 4U3CA 3MROB 1RZKL 1TCMA 3WF2A 3GBDA 4CGUB 3NQ6A 3I6KA 4IBUA 2ISFA 4O12A 1AHKA 2BVUA 1LXMA 5C7XL 3HO8A 2K3HA 4HEMA 4GY7A 5FFOA 4JTDA 4Y1AE 4A38A 2V5TA 3E2HB 4C4KT 3V5HB 1WEJH 1SW7A 4MKNA 2KZ1B 4UOQA 3S4SB 3K6DA 4IG2A 2WINA 4BZ1A 1N7MH 5IV2B 2OMAA 1A3WA 2AS5M 3OJDA 3Q7JA 4OLWH 1QXLA 2XJKA 4O17A 1NAKL 3VOIA 4IDJL 2EDQA 4JE0A 3QPQC 4I90A 1R19A 2X0UA 3O0RL 4LEOB 3ES6A 1AMXA 1D5RA 1ZVSB 1X9RA 3WN5C 3KYMA 1PW3A 4JHVA 1DTNA 1QCWA 1VJZA 3AHVA 5I79A 4B95C 3LY6A 4HH9A 2VN4A 4TNGA 1V10A 3E0WA 3WD3A 2W38A 4H9ZA 1SXCA 3QQ4A 5L7XH 3IANA 3JW7A 4NZ5A 4Y9AA 3S34L 1MFEL 2FVLA 2ZZ1A 3W3OA 3W83A 3GUWA 3QYNA 4BUQA 1H5BA 4K2UH 4UR8A 1KCVL 3UXFA 2AJXL 2MHAB 1PLGL 3A4EA 3D87B 3DUHA 5JLZB 1N8WA 2OQJB 2YGYA 3BH9B 3RYSA 4PWJA 3QM3A 3TZVA 1P6FA 1KQYA 3BKCL 2FTAA 4NHUB 2VLKD 5I0XA 2VQ4A 4G80B 4Q0XL 2Q09A 3E38A 2OMTB 4OFYA 2JI2A 2YBVA 1KDIA 3F7YB 3C87A 4BHYA 2WWDA 4XOBA 4MVBC 1WBJA 1ASPA 3F5LA 1BD2B 2CBPA 3KCWA 3PZUA 3DO7A 3ME3A 1VBRA 1ZLUH 5EIQA 4INFA 4WD0A 4DX3A 3LB6C 4K7VA 4CQDA 1SO3A 2HISA 4GRWH 4JTHA 1YDVA 4E4UA 4F0KA 2HT2C 2BY3A 2VDLH 1YUHB 5D7JC 1LO5A 1RUKL 1UG9A 3HC2A 4OZHB 1JWSA 4OCMC 5DJDB 2VC2H 1EQPA 4HHPA 4Q8PA 2BVEA 4YMPA 3P4NA 3UG4A 2BNRD 4IOIA 2ZX7A 3MX0B 1BD0A 4XPFH 4C83B 3X12B 3LKPA 5GHWL 4GAJH 2IBZX 4X6CE 5D8JH 1TQVA 3T0EA 3FU7B 3Q48A 1PEWA 4ZFZB 1QPPA 2X9WA 2Z9TA 4N2FA 1TE1A 2DVXA 2ZZ7A 3UJIL 5ISZD 4Z0BH 2Q7YB 5C9RA 4RDZA 4JTTA 3QCUL 1MRCH 2A77L 2J88L 3KXFD 4GXFA 5DJYB 3L3GA 4M61A 5JUVA 3S3PA 3PWUA 2YL9A 5D2WA 3WQPA 5LIWX 4S3JA 4L48A 2VMFA 3QEQA 1CD8A 5AC5A 4J2QA 1A1OB 3IMRA 4AIZA 4M6QA 4POZC 3QI9B 4GG8A 3CVBA 2EIEA 4AYFB 3VSTA 4MNHB 2UXFA 5E9XA 5E2TL 5D7LD 5AZEH 4QGTA 3P3YA 4UM9B 4KRUA 3TNBA 2Y3AA 1VEMA 4C6QA 4I8YA 3FJ4A 4XWOC 4OIAA 5LIYX 5C0GB 4AQ1C 4Y9PA 4QRSA 4A8RA 3SEPA 5KTEH 3YPIA 3MGTB 1AS8A 3KVMA 1AH1A 3P11H 1RJLA 4JPIB 4D9RD 4A7SA 1WAWA 2YL8A 3UTPD 3TSMA 3ABMB 5ESQB 2H3XC 2X9XA 5A7EA 3QRFM 2ACRA 5I28A 1GPWA 3E12A 3ONCA 4WI0B 3GW0A 4HJGB 4HIPA 2ZUYA 1HQRB 3V0DA 3MGOB 4CCEA 3GZQA 2IFFL 4TL4A 3QUYA 4ZMQA 2W60B 4PJBF 4IQJA 2XXCB 4F7PB 1RSCA 1PG7H 3HMCA 1UMLA 3S1XA 3FAWA 4PRAA 4FCHA 2G9HB 3GTVA 3NA9H 4XN7A 5GGUB 4CMHC 5GGQH 3R0KA 4KRZA 1KGWA 5TE6L 1C9WA 2P1YA 5HNRA 1HHKB 1BGAA 3TN3A 1ZPUA 5A1AA 2EG6A 1OP4A 2HUEA 3R0DA 1EH9A 4CD6A 3WFEH 2E5EA 2R0ZH 1YKWA 3NZQA 1QEWA 1W3TA 3V4BA 2QKIB 3PGCA 2WWMD 4IUOA 3X1BA 3VJ6A 5D1QD 4H8HA 1JERA 2X44D 3CJJA 3CX2A 3IJHA 2VW4A 4J6IA 5DD6B 4RGNE 5GRWA 1W2PA 1P84J 1XF5B 3MRIB 4Y19D 4A2GA 4N0FA 5AFAA 2OK0L 1LROA 1OSPL 2XV6B 1MHEB 4OD3L 3H85A 5BMFL 3KRUA 4RNFA 1OAUL 5EFIB 4KKZA 2VENA 2RGSA 3UP1A 3A3XA 3H2NA 5E0KA 2GJRA 3TNMB 1CEOA 1JL8A 3NL6A 3QNXB 3OMZA 4ZFFB 3CV1A 3KW7A 2YRZA 5IT2L 5ECVA 4NO2B 4GKZB 3BO8B 3ZE1B 3OTTA 5K39B 4G2AA 2OLSA 4ZAKC 1CLXA 2QUTA 5DMNA 4HJ0D 4ADIA 4A8IA 2X6UA 3QCUH 4YFLF 3F58H 3OMIB 3WQDA 3SB0A 2OP4L 1E4NA 3H21A 3ZL4L 5EC2B 3ARZA 2K4WA 2ZCGA 3LKQA 4FLQA 1D5ZB 2MQ0A 3DETC 1WWBX 3PXLA 4J12A 4NCC1 3UBHA 3UTTE 2DSKA 4LRTA 4XAPA 3AQXA 4CQCA 3IFNH 4POUB 1UTDA 2YPVH 1U4EA 1RJYA 4XH2A 3N14A 4XPHH 4HK0A 3Q8EA 4PWEA 4GKTA 2WSQA 3TW7A 4Y9NA 5DVLA 1B9ZA 2F7OA 2OMUA 1FJ1B 1SY6A 3GWJA 4JQIH 3Q05A 3M17A 1YW1A 2XGBA 2PYFA 3NM1A 4H7VA 1QHPA 3KAAA 2NY3D 3S5NA 1PO9A 1RQ5A 4ZPVB 1ASQA 2CJ3A 3BP4B 3IWPA 2CSPA 4OBSA 4JFEA 1WC7A 5ITBL 2QVIA 4NKMA 1E6XM 3QWQB 4B9YA 1ACYH 3PQYD 1RIHH 3STLB 3ZDZE 4XV0A 4BS0A 3BIBX 5C09B 3WJXA 3IBOA 1OC7A 3AUOA 1JDAA 4PPTA 5JIPA 5FGSA 2XACC 3ULSA 2OTWB 4XVEA 2BOEX 4KVCH 3VXTB 3BH8A 4FP1A 2PMQA 4CC1A 1XPYA 3E8VA 1BQHA 2QGDA 1XLJA 4DBWA 4DWSA 2FUQA 2IF7A 1NSNL 1EHAA 1OT2A 3DYPA 4HJIA 4ORGA 4YFLI 2NNXA 2GK0A 4FXGB 3GZPA 4WV1A 5DS1A 5F1KC 4G7VH 1BMWA 1F3EA 1GOQA 4KWVA 1K2DA 2BCKA 3B1TA 1T0MB 2EUWA 4KO9A 3B9EA 3C61A 5DHMC 1Q6QA 3TGXA 1T22B 4OAWA 1D5XA 5DK2B 3EDJA 4N2GA 3RIAF 2I1OA 3FOLA 3VQLA 1ZT1A 4ZI8A 1HHGA 5FF6B 4K7PH 2X70B 3QORD 1J9RA 4U3HA 3GQFA 3D39B 3U2SB 3MACL 3T77B 4XAYA 2GFBA 4EI5D 4NRSA 2ZSVB 2NWSA 1QVOA 4GUOA 4NLHA 3L1OL 5AZ2H 5KOMC 4DAGL 4DP2X 4A2HA 3CWNA 1YPZE 4OUEA 5HAOA 3LS5H 1OX5A 3GU9A 4JYEA 1UOVA 3WY3A 2ZKYA 1RP8A 1TQBB 2Y5TB 3P0XA 3WKPA 1SOSA 4EDXB 3G1XA 4OGYH 3EUDA 4FR1A 2BOCB 4UFKA 2EEFA 3IKCB 4DKAA 2YLAA 3HI6L 4JY9A 1Y0LA 4IEFB 1ZAJA 4PTVA 3UZWA 3WIHH 4G8FB 5J04A 1C8YA 1ZVNA 2EPLX 3OPSA 2E46A 2FHFA 2VABA 3FB8A 3W3BA 4Z3FA 4TSCH 1TQJA 3BUVA 4APXA 5BOFA 4K0OA 3UPWA 4JDYA 2XQYG 1QNPA 1HK6A 3G7TA 3GIZH 5I23A 3CGTA 1ODUA 4JKPH 1ZHKB 5D2LA 1M3UA 1RQBA 1UWIA 3W2KA 2BX5A 4P3CL 3V8OA 1KRBC 1TJHL 1JPEA 1V6XA 3SBFA 1AS6A 1TYEB 3HS0C 3KPSA 2D7NA 3ATYA 1GGIH 4KOCA 2PDHA 5GJMA 4I9WE 4P49A 5DEGA 5JOEA 3RCYA 3B7TA 3MHGA 4WTZA 2WQXA 3L4YA 4TUKH 4XZ4A 5LNDA 1U42A 2DIAA 1V6YA 3CD4A 1YEEH 4E5XB 2H6OA 2HJLB 4N2OA 4U6VL 4FQXA 4O52A 4HOXA 3L5XH 3FRUB 3QEQB 2GSIA 4FFVC 1EC7A 2WKOA 4PUKA 3E8UH 4XBSA 3WMSA 5FHBH 3W7MA 1H8SA 4A22A 3TIMA 3PNWB 1BVNT 1M1XB 3TP4A 2C7UA 3ZRCC 1RK0A 4KZDH 4PJCE 5IB3A 1OARH 5TDOA 2E9BA 5CWSA 3VFRA 1THFD 3NGBB 4TL5A 3FMGH 3OF6D 4UTBA 1MCEA 3DC8A 2X3BA 3FOMB 4J3WA 1HEZA 4GFSA 3GI9H 3MV9D 4HIJA 2R6OA 4OKDA 1NFDF 2BIOA 4ONHB 1OW0A 5F88A 5CP3A 4PUJA 1XICA 4DXXA 1U9KA 1PS9A 3CIQA 3WNKA 1SZNA 4PRIE 2PCQA 3SGDH 5F70A 3VQ2C 3SCMD 2W59A 1TV7A 3GG1A 4ZW8A 5BV7L 3APYA 2QKFA 2PDXA 4JPVH 5BWFA 4PJDB 3MRHA 1L0XA 2ED8A 2B14A 2YXFA 4JDVB 4NKIH 4NO5A 3IEBA 4MZYA 2XUWA 5G4HC 4ZJ9A 3S2LA 3TYFA 5AALA 2BSEA 1OZUA 1GYLA 4QTIH 1CLZH 4KOBA 2E8YA 3D5OF 5BOZG 4PV1C 4BK9A 5CZVL 4C56E 1T1XB 4BK8A 3QXBA 2UYLB 3LH9A 5C0CA 3ANVA 1QU4A 4M8QB 5J7CC 3N5AA 5H37G 2CZVA 4XCNB 2BNQA 4P2OA 4PWIA 5KSAB 1YQVH 1W72A 3A4JA 1MHHB 5B4MC 1R9FA 1GOIA 3K6OA 4JM2C 3ORJA 3OHMB 1OD9A 4M1GL 5TTRA 1M2VB 4XRCA 5F9OL 4KCUA 4LFYA 5D9SA 4NJAH 5FAAA 1UC4A 1V7MH 3WLHA 4QRFA 5IFHL 5D8JL 2H1PL 4P4KC 1MJ7H 4X8XA 1ESWA 1RBAA 4FF9A 4C58B 3WMBA 3MJ7B 4P2YA 2WMPB 3LD8B 3MNZA 3MUCA 5CLWA 3T2LA 4HUVA 1CW2A 1AHWA 4WWKA 3QHOA 5C0AA 1R9XA 2CLRA 1VGKB 1S7XA 1DBMH 4G6ML 5D1ZD 3VWJA 1F97A 2OJZH 4GNKB 4P0DA 1ZVSA 4JFQA 3HB3B 3CUZA 3EX1A 1NKOA 4IIGA 3WLTA 3T40A 3DFQA 3VXUA 3WQWA 1M7JA 1PHQA 2OR8A 4KJPD 2A0LD 4KRNA 2F8IA 4QHLA 2WINB 4OJFL 4L2LA 2JLLA 4YTSA 2GAZB 1EAJA 1MHPH 1WS8A 2X6VA 4GLEA 1LD9B 3FBQA 1UB5A 3WI9A 3OHXC 2MCPL 1YTEA 3SQBB 1OAYL 2QKSA 4MB1A 4WUIA 1EHLL 3TO4C 3KLLA 3VFPA 3GNOA 3WKZA 3DROA 2CD0A 2ICEC 3LRHA 1P43A 2V2WB 4KAQL 3GDRA 2XYCA 5SX5K 3W7KA 4XO4A 4DJDA 3OQRA 5HY9B 3BAXA 2JCWA 3FFCD 3S35X 5PCYA 5E08L 2YUZA 5DFVD 3DX5A 3OW1A 4LZKA 4LCCA 3QPEA 1LOSA 1W0VB 5DMIH 3ARBC 1ECQA 1LBFA 5I0YA 1JRHH 2EZ0D 2R69L 1FLTX 2JKAA 3QFEA 5FSEC 3NCJL 1R0MA 1AVAA 1NZRA 1A5AA 3QKZA 3BP6B 2F6UA 5CZSA 4GGHA 1F2XK 2PDKA 4Z18A 3E2QA 5TK2A 1SNRA 3HPJA 3NIDE 2ENQA 3NIYA 3PCYA 4MSWA 3SQRA 4HT1L 5J3HC 3VXOB 1H7PA 5EORH 2OTWA 1XCTB 3RIFK 3TA3B 2XGZA 4I9XA 4CD8A 4HNUA 1CD0A 4K4KA 3DIDA 3O15A 1NTDA 4M4RA 1MXDA 4P4RA 1QSEA 4N0UE 3WNPA 2QUVA 3BOFA 4PR5A 1VKFA 5J5EA 2Q3ZA 2Q7AA 1U58A 4FCAA 1RY7B 1G9MH 4I89A 3B9NA 1YEJL 2XWTA 3W6MA 2A73A 4H0LC 43C9B 2E7DA 3BE1L 2OTUB 3LOTA 1G6RL 1KGIA 2IH1B 2Q76B 4MA1B 3RGVD 3LN9A 4I1NB 3CAWA 3QUKA 1S78C 1JZDC 3JWOH 3WIAA 2OULB 1RY8A 2X4OA 1S5HB 3HI1B 4JRFA 4LU5H 1HCYA 2VRQA 4XN1A 3RUGE 3H9SE 1Z0MA 2BP0A 3TO4A 4FL4C 5D8ZA 1E8XA 5D71L 4C4UA 1AS7A 1PY4A 3G6JA 3HM7A 2GJXB 1BG4A 2PKDA 3IPBA 4KNTA 3CDCA 1ZBKA 3LUTA 2X4RB 3KDMA 3W0WB 5L6YH 2CO2A 3FRPG 1IBGH 4Z7UF 1DJQA 4JDEA 5IKCA 2V17L 5I3KA 1ME8A 1TDQA 1J6PA 4WHBA 3MXWL 4ICNA 4B92A 2OEKA 3ARPA 1VHNA 1VA9A 2HFTA 5IW6A 1UACL 5GGVY 4FMFA 1K4DB 1E5UI 3C5ZB 2K3TA 2WYSA 1P69B 1R5WB 4UM9A 2XH0A 2A21A 3V0VA 1QVOB 3QN3A 5C08D 4H8WL 3C8HA 4BYHA 2TSBA 4B9FA 1UUNA 1P6CA 4OZGE 3QCVH 3E2RA 2FBJH 4KRPC 4L4TE 1XIHA 1NBCA 3THAA 3W7JA 3RVXD 3N1FC 4GCAA 1BZDA 2BSBA 2F54D 5AB9A 1AKJA 4BZ2A 5FL1A 4D6CA 3D0LA 3BSGA 5AB2A 2AK1H 4NQSB 2ESVB 2PABA 1S3RA 1E4XH 4JG0L 3O0KA 3O63A 3FW6A 2G2RB 1NC2A 4F9LC 4B5WA 3MANA 1TFPA 1LGVA 1YVLA 3MV7A 4M03A 4XMPH 1E51A 1I3GL 4W6WB 3ZJAA 3TT3L 1E2VA 1SZEA 8PAZA 1F0LA 1F4XH 4Y8AA 2YAHA 1RKRA 5EBWB 2F1AA 4MD0B 4FZEL 4HV8B 3ZOAA 4H4NA 3L3JA 1ONWA 5LHFA 4PJIF 2R1YB 5EZJB 1PBYA 3D2TA 4A05A 4FLOA 3GUGA 3OR6B 4IBVA 3U9PH 1FA4A 3ASWA 2Q8BH 3V0JA 2YAOA 5IHRA 1V79A 1A0QL 3IJYA 5FKPB 1WZ1H 4XTIA 4YHOH 2FT7A 2ADIB 3NH7H 5EU7E 3DK0A 5DUPH 5MF5A 2E67A 5ABFB 1KYUA 5CJOH 5CGBA 4UTCA 1U3JA 2BY2A 2XZCL 1XZ0B 1U8IB 3AFLA 2EYSB 3RAJL 3TA4D 4L0YA 3FT2B 4HUCA 4YVNA 3WTSA 3R12A 1GHFL 3VZZA 4OLVL 5FEXA 1RHHA 4KJPC 3ITYA 1X5AA 1ADQL 3NACH 3K3QA 1FVPA 3W88A