2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
2EACA 3WL0A 1V3LA 1PX8A 3MKKA 3VIGA 4P8WA 4CVWA 1UH4A 4B9ZA 3NDYA 1KR1A 4GO9A 3D4ZA 4XUYA 3N13A 3IJ9A 3SCNA 1TQTA 4V27A 1VBRA 3QR3A 2XVKA 3W0KA 1VIWA 2DT3A 2ZX6A 3W82A 3CTTA 2G3JA 4PN2A 2BVTA 5HOSA 1TQWA 2V3DA 4BA0A 2D23A 1Q6DA 4J3XA 1GOWA 2V3FA 3BLPX 1MWOA 2XWEA 4WSJA 3QHNA 1MW1A 1GQKA 3BAWA 4ZENA 2FHBA 3WNPA 3OZOA 2GJPA 3WDHA 4P7QA 2XYLA 1GQLA 3L4XA 4EAMA 5EBAA 1GJUA 3A47A 2OYMA 1WZKA 2NT0A 2XM2A 3EMZA 1OM0A 3A24A 3FW6A 4DWSA 3ARSA 1UR1A 3VD3A 3WQ8A 2X1IA 4Z2KA 4B15A 4PTWA 5A6JA 1PBGA 2BVYA 3DYPA 4M1RA 1W2PA 1CBGA 2D0GA 4U5IA 2JE8A 3OA5A 3SCSA 2CXGA 1NWSA 3WNOA 2WMJA 4TTUA 4DO6A 2BY2A 4X9YA 5E6YA 2E4TA 1UKSA 1JDCA 3EBVA 1X6LA 1JZ5A 4MADA 2X0YA 4V28A 1LWJA 3RM8A 4AW7A 1VF8A 2J7DA 1XD0A 1ESWA 3ZT6A 1UD6A 1BFNA 1TE1A 2WLYA 1XSJA 2WZHA 1HL8A 3WH7A 4HA4A 2PWGA 1Q6GA 2WLZA 2OSWA 3AIBA 3CHDA 3WD0A 3EJRA 2CBVA 2DT1A 5M03A 2Q8XA 1MVYA 1B1YA 3WKZA 4J3UA 1IZKA 5A2BA 2G3NA 3ZMRA 2BHUA 2YA0A 1NOWA 5HDRA 4J28A 1R85A 3LXCA 4DUWA 1IZJA 1KGWA 3NCOA 2C8NA 1H4PA 4P7OA 2AMGA 5JIPA 5E0FA 4HZ8A 4PCTA 2YFNA 3HJEA 5IDIA 5AYIA 4D6GA 3GXIA 1V0NA 1VEPA 3RM4A 1TA3A 1XSIA 2XIBA 3EDKA 3DECA 2PF0A 2EPNA 1NOFA 1HWWA 4ATLA 1CGYA 1OIMA 3T2OA 4W88A 3WDIA 2WHJA 1JD9A 1M04A 4WF7A 1K9DA 1GUVA 1EHAA 3L4ZA 2EADA 2WK2A 1WPCA 1ZJBA 5IFPA 1NQ6A 4BS0A 2TAAA 3VM7A 3GDBA 4ZE4A 3BAKA 4M56A 3PZOA 1ISYA 1D7FA 2J8GA 2PWFA 1UWQA 4XZWA 1QVBA 4AMCA 4D6FA 3APGA 2PBOA 1W3LA 3CGTA 2OYKA 3W53A 3RIKA 1KB3A 3MMDA 1B3WA 4GINA 3VD5A 1CGWA 1LG1A 4W5ZA 2FHFA 1N82A 3H53A 4JKLA 3EJPA 5LYRA 2CIPA 2FE0A 3HG3A 3VIPA 4M24A 2QHAA 1HJQA 1GOQA 3L2LA 4BZYA 2J62A 1JI2A 1GVIA 4HOZA 2WXDM 3HU7A 1M53A 3BUQA 5A8PA 5DT5A 3HN3A 4GQQA 2D0FA 3NSXA 5E9AA 4AD1A 1W9DM 1QBAA 4EKJA 2V5DA 5ABFA 1BAGA 4CD5A 1UR8A 1UD4A 1L0PA 2E8YA 4AZIA 1VFMA 1UH2A 2D3LA 1RP8A 4FLOA 3FY1A 2B31A 3RMEA 1GOOA 4CU6A 2D22A 4N0RA 3BAYA 1NARA 4PEEA 3JUGA 3N11A 1HXJA 2G41A 4KRTA 1JYVA 3U5YA 1VFFA 3VINA 1TMQA 5DEZA 4Q22A 5ABEA 1TVPA 4ACZA 3FHAA 5IHSA 4C7FA 5JBFA 1VRXA 1RP9A 3EMCA 2OWXA 2VURA 1FOBA 2WHKA 4B16A 3AMLA 2VX7A 4UOZA 2OYLA 3HG2A 4IISA 1OWQA 4JFTA 3LRKA 2W91A 1HXKA 4MNJA 3WQ6A 3LPGA 2ZXAA 2VJXA 4TVUA 1MW2A 3HG4A 3BVUA 1MYRA 3RPMA 2J7BA 3ARWA 1LL7A 1MQPA 4W7UA 1W1TA 4P7RA 2Z1SA 3AZRA 1VFOA 3G6MA 3QGVA 3NSMA 1DWIM 3S5YA 2WSPA 1E4MM 1ZS2A 4GQRA 4PSPA 4PSRA 1R86A 3UR8A 4PMXA 1TG7A 3CPUA 5BXSA 4D6EA 1TVNA 2WMIA 4TVCA 1XH0A 4PTXA 3WD3A 1WP6A 1BVNP 4S3JA 1HKJA 2WZIA 3OZPA 2NW0A 3MU7A 3W37A 1PZ3A 4OOUA 2WYSA 1M01A 3GXTA 1IT0A 5ABHA 2DSUA 2XFRA 1ISZA 1F4AA 3WSUA 2O9PA 1QHOA 1GPFA 2VTFA 3U57A 4HTYA 3WNLA 3MS8A 3RJXA 2E40A 5BROA 4OOZA 3WY2A 1SR0A 4QLJA 5A6BA 4FLSA 3UEQA 1UASA 3MMUA 2WW5A 3W26A 3WUEA 1DEDA 4MDPA 1VAHA 1E56A 1D2KA 4TTGA 1H11A 1OT1A 4CD4A 3WQ5A 3EMQA 1OD8A 3SUVA 4H41A 3WUGA 3PTMA 2WM0A 1JXKA 1EDQA 4S3KA 4U2ZA 3TTSA 1ITXA 1W3HA 2YL8A 3KZSA 3KLLA 1JG9A 3KL5A 4MB1A 1K9EA 1FFQA 1BYCA 1E5NA 1EH9A 2NSXA 4CGTA 3ARRA 3AZTA 3SCVA 3BXWA 4D72A 5FKYA 1UYQA 3POCA 3AMDA 5CPSA 3VIHA 3GNPA 4QLKA 5DMYA 5AC4A 2XJ7A 2D2OA 4M29A 3WBAA 4HOWA 3BMWA 2YDQA 3WQWA 3ZSTA 3A5VA 1JYWA 4MNKA 4D6IA 4UZSA 4EE9A 3GBEA 1X1NA 2E9BA 4UOQA 1AVAA 3LXBA 1XRVA 2VCAA 1PX3A 2WC3A 4W84A 1GONA 1G0CA 2PWHA 4D6DA 1NOUA 3SURA 2AOSA 4H7VA 2YL5A 5BRPA 1TQSA 4E8DA 1XH1A 1V08A 3LPOA 4JAWA 3D3AA 2XN1A 1CPUA 2JF6A 5EMYA 2QF8A 1W3JA 2ZUTA 1XD1A 1O6IA 1ISXA 1E4LA 3ARZA 2G4FA 1GJWA 2WSKA 2G8ZA 1E4IA 2IXUA 5JBDA 1VJZA 3VIKA 2Y24A 3VIFA 8CGTA 2A3EA 5E6ZA 2A3AA 4Y7EA 1OGBA 1GVYA 1CXIA 1QI2A 1YQ2A 4ZXLA 4PCSA 2VRJA 3ZOAA 2XG9A 4UFJA 4EANA 4U2YA 1V6WA 4CCDA 4J27A 4UQEA 1JDDA 3H55A 5A8NA 2ZE0A 2VQUA 3AISA 4RL3A 4MJ4A 4JIEA 4QP0A 1H0GA 2IUZA 2VCCA 1CWYA 4MJ2A 2X05A 2OLHA 2GUYA 2ZXBA 2VO5A 3DYOA 1QHPA 2VZTA 5D9OA 1KBBA 3W6LA 2A3BA 2O9TA 4WSKA 1G01A 3BC9A 2J8FA 4DO4A 2J78A 4URIA 1CLXA 2ZUVA 4U3CA 2WC4A 2VX6A 3OGSA 1US3A 5KEZA 2YJQA 3T0AA 4D1JA 4Z2JA 4U33A 4UZUA 3WDRA 4W8LA 2ZWYA 2A3CA 3N15A 1B9ZA 2CBIA 4NI3A 5I0DA 3SCUA 1BHGA 3LRLA 3A22A 2FYVA 3B8SA 5A6LA 2JALA 3PZUA 2FHCA 3VDHA 4C7GA 1TR1A 3GZAA 1J0KA 2J77A 1BLIA 4U31A 3WIJA 4LYRA 1UQYA 2JIWA 3VD7A 5A3HA 5GPRA 3UERA 3VD9A 4LPCA 1GW1A 5FD0A 3RM9A 3ARUA 1HKMA 4C7DA 1VENA 4FNQA 2EPKX 4OZOA 3WEZA 1E73M 1FP8A 3WUBA 4UFHA 4D71A 3WY1A 2GFTA 2CNCA 5F7UA 2PC8A 4Q7NA 3VOCA 4PMYA 2EJ1A 4XX6A 3ZM8A 4AXNA 4GO8A 4FMVA 2XM1A 3KL3A 2Y5EA 3AS0A 2WNWA 1DP0A 5A2CA 1HJWA 2ZIDA 3WENA 3WY3A 5AY7A 1ZL1A 1UZ4A 4NZFA 1KTBA 4DUVA 3ARXA 4RE3A 1UWTA 4AIUA 2QV4A 1JDAA 3OLIA 1BF2A 1Y7VA 3ZT5A 4AD3A 1QWNA 3ZT7A 3J7HA 2Y8KA 3THCA 1TUXA 5C70A 1HJSA 4UFMA 2XPKA 2ZXDA 4JL1A 5AYBA 3TONA 1ISVA 3WH8A 2FGLA 3FAXA 2W67A 4CVUA 1MFUA 1F4HA 3CIVA 4AZ6A 1OIFA 2GK1A 1H1NA 3K4DA 2DH3A 1QI3A 4QDMA 2CERA 3WD1A 4MNMA 1UHVA 3WNKA 4WKFA 4CCCA 4FLQA 3OLDA 3BUPA 3EDJA 2CETA 4M81A 3VIMA 2BS9A 1CXFA 3WQVA 3SCQA 1BG9A 3VDAA 1JZ3A 3VX1A 2XVGA 2EPOA 2EQDA 2CEQA 4JZ5A 1OGSA 2WVVB 4UFKA 4JL2A 1UR0A 1JF6A 1JF5A 2NT1A 3EDEA 4J3TA 3L4WA 3AS1A 3IGUA 4PMRA 3KEHA 5A95A 3IJ7A 2WMHA 3LMYA 1DWAM 2XN0A 1J0IA 2YA2A 1X6NA 4BQ4A 1JFHA 1VEMA 1XHGA 5E09A 1R33A 2E9MA 3ZR5A 3KL0A 5LA1A 4HP5A 1JNDA 1J01A 4JCLA 4FK9A 4GXPA 2ZX9A 5AC5A 1ZB5A 3DYMA 1JAKA 3AMGA 5D8WA 1U30A 1FP9A 3CHCA 4E2OA 1BYAA 3N04A 4F66A 3B9EA 2G3IA 2J47A 1UR9A 1V0MA 4TOQA 1GHSA 4NXSA 1CXLA 1AQHA 1E71M 3CUJA 4K68A 5DF0A 1UH3A 2JEPA 3WDPP 4PBGA 4GPNA 1HX0A 1J11A 5TD4A 2DSZA 2OSYA 3HZ3A 1WDSA 4UQBA 1XC6A 3N9KA 1PJ9A 1NWUA 3FXYA 4DWSC 1WCGA 5CGMA 3NIYA 3MSGA 4GIAA 1B90A 1UR4A 4HMCA 1C92A 4MB4A 4NX0A 3UCQA 3T08A 1UUQA 2PB1A 1R46A 1W3KA 1PX4A 4PUDA 5A6KA 3K8KA 1UKQA 4AWEA 1HIZA 1B3YA 3VIIA 1W1VA 1EOMA 1ZBWA 1GCYA 4B9YA 3IAQA 3WNNA 1R7AA 2DSVA 2WMFA 2DT0A 3BLBA 1V0LA 1ZU8A 3GH7A 2J7HA 3NJ3A 3IJ8A 3PZQA 1H41A 3WMBA 5FL0A 4CN4A 1B2YA 4CKQA 2F18A 1GOIA 4Z2GA 3L4YA 2XTKA 3W81A 2WCSA 4B3LA 2EAEA 1H0IA 3L4TA 1FHLA 2W4XA 2BY3A 3D51A 3OGVA 3VMPA 1GOKA 4W87A 2GSJA 2V38A 1BG4A 2XSAA 1JZ6A 5BRQA 1LF1A 1SYTA 5FOOA 2YL6A 3AXIA 4U3AA 4KRUA 4MNLA 3VM5A 3VUPA 2JFEX 1DWFM 4MPKA 3D5HA 2D3NA 5A1AA 1EA9C 1KGXA 3F5KA 3KWXA 3GH4A 5D9PA 3VNYA 3VSTA 5CLTA 1EIBA 4CD7A 3MUZ1 1WO2A 2X2HA 4OKDA 3ZIZA 4UFIA 3OBAA 3BH4A 3PBGA 5I24A 1E6NA 3VTRA 1PIGA 3A4XA 3NYDA 3SEPA 3ZR6A 2D0HA 1R87A 1NWTA 1C91A 1QX1A 1O7DC 2ZX7A 3WDQA 3BGAA 2EEXA 1JFXA 3GM8A 3W6MA 2C7FA 4W7WA 3SUSA 1V02E 1GORA 1C7SA 1W2VA 2ZWZA 3ARVA 3UESA 5I6SA 2WVTA 1CZ1A 1KXTA 3WD2A 3CZKA 2WCAA 1HNYA 3BVXA 1UA7A 2XHYA 1CGUA 3SUTA 1HKKA 4OUEA 2D20A 1LQ0A 5HBFA 2YFOA 2CITA 4J3SA 5A8MA 3WF2A 4MB5A 4AZGA 3BUIA 2E0PA 3S2CA 1PS3A 3O9NA 4AD2A 2Y4SA 1UD8A 1QNSA 1JD7A 1HTYA 2VT0A 2ZX5A 4QCEA 1J12A 4PMVA 4ACYA 4W8AA 2BVDA 2GJXB 4WIWA 1FH9A 4W85A 4DUXA 1CNVA 4J3VA 4AY1A 4NZJA 4E8CA 2ALWA 1CENA 1HJUA 3AIUA 3VMNA 4NF7A 3BVVA 3U5UA 3PZTA 2BXYA 1CGVA 1OD0A 2VRKA 2BNJA 2DIEA 4UQCA 1C3FA 5I79A 3LPPA 2JF7A 3DX1A 4WKHA 5CPQA 4CU7A 1QNPA 4X0VA 3E1F1 1VB9A 4OIFA 5DT7A 2DEPA 3GNRA 4AC1X 5I5RA 1CXHA 3SCWA 1VBUA 4AIEA 1WZLA 4CD6A 2WVVA 3VILA 3AJ7A 2XN2A 1WDPA 3W24A 5GNZA 1BVZA 3AIRA 1ITCA 3NDZA 1BGGA 3VGBA 1WE5A 1V0KA 1V6YA 5E0CA 4EK7A 5IXEA 3B9AA 2VVNA 2VVSA 1UZ1A 2WB5A 1E6RA 2BY1A 3WFZA 2ZICA 2EPMX 2XWDA 2VZUA 4UFLA 5CPTA 3EJSA 1B3VA 4CN1A 3VVGA 2V5CA 3KLKA 3AHTA 1KCKA 4XZBA 4CD8A 1SMDA 2XVLA 1XYFA 1JYNA 1GQIA 3CLWA 3POHA 3CUGA 1J0ZA 3RJYA 2XVPA 1V3JA 4XB3A 2AAAA 2VL4A 2X2JA 4PMDA 2CBJA 1NP0A 1CXEA 4N42A 3BUBA 1I1XA 1QI0A 3AFBA 3QOMA 2W66A 3PTQA 3G6LA 3MV01 1G9HA 1V3MA 2XFFA 3LXAA 4MAVA 4FNRA 1OT2A 3A23A 1RPKA 4AZHA 4JFVA 5IFTA 3BUDA 3T2PA 3DHUA 4AMXA 3BMVA 1E6ZA 3WQ4A 3ARYA 4Z2HA 3CUIA 2CBUA 3UR7A 3GH5A 2WC7A 3A4WA 1E0WA 1J18A 2GDVA 4GZIA 3A4AA 1WDQA 4LX4A 4GZJA 1Q6CA 1E55A 1GOMA 3W29A 3VDBA 4YHGA 4HA3A 3SUWA 3AS2A 4QAWA 3W28A 3CZ8A 3AMCA 4JKKA 2QPUA 3DDFA 2DH2A 2D73A 5IHRA 1JZ4A 2E3ZA 1KTCA 3WEOA 5JIWA 3IAPA 1QNRA 3SIMA 1C8QA 3MUY1 2XGIA 3VGEA 4A3YA 1UWUA 4HZ7A 5ECUA 3BVWA 1JZ7A 4GI6A 5A2AA 1V6VA 3AHZA 4D1IA 4UQ9A 3TTOA 2XUCA 3BAIA 2W61A 3WFLA 4W8BA 1CEOA 1B0IA 3BAXA 3L4VA 1E0VA 2J4GA 2VR4A 4ZEPA 3ZQ9A 1Q6EA 1E1EA 2PWDA 4IM4A 4BF7A 4KGJA 1RH9A 2YBUA 3BCDA 3CZEA 5ABGA 2RGLA 2ZUMA 2F7OA 1UG6A 3ARQA 1LL4A 1WAWA 1PPIA 2VZSA 4DO5A 1LLOA 4D6HA 1KXVA 2UWFA 1TCMA 1P6WA 3DX0A 2ZUNA 3TA9A 4JHOA 3H54A 3VIJA 1L8NA 1Q6FA 3O6AA 1HKIA 1MXDA 4CCEA 3CBWA 4DM1A 3A3HA 1E5JA 1WZAA 3SCOA 3EDDA 2ZUWA 4BQ3A 4BCEA 4BQ2A 1VJSA 5CSUA 1XGZA 3DHPA 2E8ZA 1OINA 3EDFA 1KQYA 1UD3A 5M17A 3GTNA 4W93A 4KMQA 1TZ7A 5DFAA 2A3HA 1AQMA 2WANA 4PMNA 5CJ5A 4WLCA 3WELA 3OG2A 1E3ZA 3L4UA 1ZBKA 1HP5A 4F9DA 1J0HA 5ABFB 2J7GA 3SCRA 2WWDA 1WDRA 1BSIA 4IPNB 2EPLX 2CPUA 1B3ZA 1HN1A 3M46A 5I77A 3AIVA 4M82A 1SZNA 3CMJA 1C8XA 2YL9A 3F5JA 4A4AA 3MUIA 4YPJA 1NP2A 3AROA 5EB8A 4L4OA 4ACZB 5A6SA 3PZ9A 3AXXA 1LG2A 1PZ2A 3MO4A 3D52A 1TFVA 3FN9A 4U5KA 3I3BA 3LPFA 1EGZA 2UY3A 1H49A 3VGDA 3PZGA 4TX8A 2XFYA 1ZBVA 2V3GA 4PMZA 5CGTA 2DSKA 4HMDA 1K9FA 1CGTA 3VGFA 4JHZA 1EOKA 3AZSA 4OBSA 1W1YA 5C8BB 1H09A 3VIOA 5A6MA 2F61A 1HF6A 4PTMA 1GQJA 1E6XM 2FH6A 7A3HA 5CZKA 4MTVA 5CG0A 1PEZA 2F1AA 1XCWA 1ZBCA 1J0YA 1A3HA 5D9MA 3WH5A 4AIOA 2MANA 1H5VA 3ARTA 2WMIB 3LX9A 2HVMA 3QHOA 1V02A 1MW0A 3A6OA 3CV5A 3BCFA 3UG4A 5BCAA 1JIBA 2PWEA 2PI6A 2EO7A 1VFUA 4NZCA 2O92A 1K6AA 1J9YA 3I3DA 2EXOA 3SUUA 2QLYA 1GZJA 3BLKA 3CO4A 2YIHA 4DM2A 4AD0A 5FIPA 2VR5A 2UY4A 1KGUA 5BYWA 1I1WA 1BQCA 3AS3A 3EJUA 4NSBA 3W25A 2YBTA 1HT6A 4J3WA 1E9LA 3CHFA 1CYGA 4R27A 2X0HA 3PZNA 1QNOA 3EJQA 1M03A 3NSNA 1DWJM 1DTUA 4W5UA 2W5FA 2E9LA 4F79A 3ALGA 1FH7A 2WVSA 2CKSA 3QHMA 4PYSA 4JKMA 3F4VA 4X0NA 2J79A 3VNZA 3UG5A 2QMKA 1M7XA 4ZE5A 1HJVA 4F8XA 1E70M 3AOFA 1G94A 1JZ2A 1HJXA 3MANA 4IPLA 4HOXA 4HZ6A 5D8ZA 2WPGA 3WEMA 1KBKA 4P7LA 4W89A 4HU0A 1UWIA 2JEQA 3WL1A 5CQ1A 4XV0A 3WN6A 2BFGA 1G5AA 3PZIA 1XYZA 4HMEA 3VX0A 2VX4A 3DX4A 4AZBA 2W63A 4H2CA 1HVQA 1E3XA 2X2IA 4CN6A 1W1PA 5HXMA 4FLRA 1W9VA 3K8LA 4P8UA 4DWSD 2YDRA 4UNIA 3T0DA 3CMGA 3ARPA 3K46A 3EJTA 1LJYA 5M5DA 4MAZA 4PUEA 3PZMA 2FH8A 2OW7A 3CUHA 4QCFA 2WMKA 2O9RA 4E4PA 3OIHA 2RGMA 4TXEA 1I75A 4M80A 3PTKA 4KH2A 4KGLA 1FH8A 1A47A 3WMSA 6CGTA 3U7VA 4TVDA 2VOTA 4M8UA 1C7TA 3WNMA 1JL8A 1FFRA 3GNOA 1E0XA 4PMUA 4WJXA 2XGBA 2DQXA 2D1ZA 2F7PA 5GQBA 5I3DA 1E72M 4Z2IA 5BWFA 1EQPA 4GI8A 4UQAA 3RO8A 1HVXA 4PRWA 3IK2A 5A69A 3MSDA 5CLWA 4HU8A 1PAMA 1FA2A 2W92A 5JUVA 2OWCA 4Z2LA 1V3IA 4H8HA 2X09A 1QHZA 3AHYA 3N17A 3O2LA 1UKPA 1OB0A 2BY0A 3GXNA 4BQ5A 1B30A 1VEOA 1WB0A 1UD5A 5D9NA 1TQUA 3CC1A 3S5ZA 4HPGA 2GDUA 4AYGA 4JFWA 1CDGA 3DX3A 1OBAA 2ZUSA 1JXJA 3BVTA 1QNQA 2DPEA 3D50A 4P8XA 4WK9A 2DSWA 4YN5A 1DWHM 4AEEA 2J7FA 2VX5A 1W9BM 1CXKA 1GNXA 2Y2WA 4TX6A 3U7BA 3WUFA 4UOJA 1KXQA 3THDA 1UKOA 2X8RA 2ESCA 1JZ8A 4AZ7A 2J25A 1E1FA 1XH2A 3GXPA 5EFFA 4J7RA 4YHEA 2F8QA 1E15A 4GKLA 3F5LA 4FNUA 5LA0A 1R8LA 1ODUA 2UY5A 5JBEA 4ATWA 1KCLA 3VD4A 1WNOA 3EYPA 3CZLA 5FCZA 4AYSA 3B9DA 3N1AA 3CUFA 1E40A 3PN8A 1Q4NX 1QW8A 5A8QA 5HPCA 3AHVA 3LRMA 1UR2A 3WH6A 3AYRA 5HNNA 3DDGA 1QBBA 4B3KA 4HPHA 1TQVA 2UY2A 2XVNA 5C71A 2JIEA 2VRQA 4UTFA 4NRSA 1UOKA 4L4PA 2PBGA 4JFSA 3VO0A 3W27A 3BSGA 3K8MA 1UWSA 3CZNA 3SCTA 2Z1KA 2CCRA 3T2QA 4ZFMA 3WF0A 2IXVA 1H3GA 3TOPA 1D3CA 1R34A 1E6SM 2WWCA 3M6DA 4CUCA 6A3HA 4AZCB 1V6XA 1V3KA 3BSHA 3VPLA 3CZGA 1QWUA 1ISWA 1K9TA 5GNXA 3IANA 4OGZA 2WBKA 3ECQA 2GVYA 2C0HA 2OWWA 3HMCA 1JNEA 4AISA 1R7OA 1R47A 3FHQA 1WKYA 5BXTA 2W62A 3GXFA 4ATDA 4NXKA 3T0BA 1UKTA 3HG5A 3N18A 4GI9A 1KFWA 1MFVA 1YHTA 2XIIA 1UQZA 1XV8A 3QOKA 1OCQA 3KE0A 1DHKA 3BAJA 4D6JA 1QW9A 7CGTA 2VNCA 5A94A 2VCBA 4OBRA 1CIUA 2BV9A 3CH9A 3WD4A 1QI5A 2GK1B 3RILA 1UA3A 3T09A 3MI6A 3TV8A 5DO8A 3AIWA 3K1DA 4QFUA 1EQCA 1ODZA 1H2JA 2D24A 2J7CA 1BPLB 3ZJKA 1U33A 3DX2A 5EFDA 4LXFA 1SFSA 7TAAA 3PHAA 1E6PA 2GJRA 1W9XA 2YLAA 2G3MA 4DWSB 1XCXA 3I3EA 1V3HA 1J0JA 3VMOA 3VU2A 2F7RA 3VKKA 2YDSA 2VI0A 2EABA 1Z32X 2OW6A 3UG3A 4MDOA 1R75A 2WMGA 1JGIA 1XSKA 4LGXA 5KZ6A 2QMJA 2VZVA 3GBDA 2QPSA 1QI4A 3VGGA 1IV8A 3WF3A 2YOCA 1W91A 2V3EA 1AMYA 2BXZA 4D6CA 6TAAA 1T0OA 1UD2A 1BTCA 5LA2A 3VGHA 4TUFA 4RE4A 5A6BD 5D4YA 4FNPA 1BYDA 4AD5A 1NM9A 5M3WA 1RD6A 1ZJAA 1B3XA 2WHLA 1QPKA 1HL9A 3FAWA 2J74A 1QOXA 1SMAA 3OB8A 1PIFA 1BYBA 3WMCA 2IGTA 1US2A 2WKLA 3WBEA 5I2UA 3FNDA 4P7NA 3TP4A 3ZJ8A 1J10A 1U2YA 1B31A 5E1QA 3N12A 3A21A 2FGZA 4A3HA 2CKRA 1W32A 1MXGA 1NWRA 1KWKA 1JYXA 1OGGA 4UR9A 2F1BA 2EBNA 4LYQA 2F7QA 1KXHA 2Y8VA 4P8VA 2WVUA 4H8VA 4OJYA 4H8UA 5E70A 4ML4A 1E43A 1OSEA 1TA3B 4FNSA 5BXPA 1CECA 2VUYA 4AEFA 1V6UA 1LWHA 2VQTA 4W7VA 4UCFA 3K4AA 1S46A 3WY4A 5I78A 1G1YA 1EDTA 4QLLA 4RE2A 5A6AA 3VDCA 1GHRA 3GXMA 3OGRA 5FL1A 1MW3A 3AQUA 3L2MA 5BXRA 1NH6A 3GXDA 4JCMA 1V03A 1W9UA 1CLVA 1C8YA 4PTVA 5CSYA 5GNYA 1ECEA 2WBGA 3AI0A 3UETA 3WDJA 1KQZA 3OLGA 3WF1A 4MB3A 3S6TA 4UQDA 4F9JA 3AMKA 3SCPA 3VSUA 3TTYA 2ZUUA 4FNTA 2XSBA 3W4RA 2BHYA 2OSXA 5CXPA 3AIEA 3TTQA 1UWRA 2ZX8A 3ZSSA 1C90A 2DGAA 2VMFA 2X2YA 1CGXA 4WKAA 2YLLA 1KWGA 3NUKA 3ALFA 1MQRA 2ZXQA 1EXPA 2O9OA 4AZ5A 4KWUA 3D4YA 4LYPA 2CHOA 4PMOA 1E6QM 2CYGA 3GYCA 2DIJA 3ZJ6A 4CU8A 1HP4A 3AHXA 3M07A 1MQQA 3MMWA 2F2HA 3AYSA 1W9PA 4GZEA 2BHZA 3AXHA 5HPOA 2DDXA 3AIQA 3CHEA 1JI1A 4R5EA 3CZSA 3ZJ7A 8A3HA 3WH9A 1E4NA 1C93A 4H04A 4LQ1A 1O7AA 3RCNA 2WKGA 3ZO9A 3W38A 2WCGA 3CZJA 4V2XA 4IUGA 4ZXOA 2WHMA 2J75A 1BGAA 2VC9A 3RDKA 1EDGA 1AQ0A 4AMWA 1FHDA 1LL6A 3AICA 5A8OA 2YKKA 2DT2A 3OLEA 2CESA 2WAGA 3MUAA 3VSVA 4PMQA 1JAEA 5I23A 2VZOA 9CGTA 4JFUA 2GJXA 1WZMA 2CHNA 3M7SA 4FF5A 2J7EA 1EO7A 1CTNA 2FDMA 2YA1A 1DWGM 4HA1A 3WF4A 4AD4A 3PZVA 3MV11 3DC0A 2WZEA 4AZCA 4W86A 4NRRA 3II1A 2ZOXA 2HISA 1EO5A 1KR0A 1EHNA
chains in the Genus database with same CATH superfamily
4QCIB 3MKKA 1XZWA 1HEZB 2BDNL 3TO4C 4K4KA 3ZRCC 4B9ZA 5IHUL 2WMPB 3QZMA 5GJTH 5BS0A 1HOCA 3PWUB 2VEGA 3I74A 4QRTB 3OX8A 2CLIA 3MJ8A 4O2EA 3H21A 1GPOL 2AXFB 2R0KH 2JCCB 2QSCH 3HNVL 2G3JA 2I14A 3D0VA 3A4EA 2R0WL 3BAWA 2P1FA 2V7NA 4Z78A 1P6BA 2GJPA 5HJXA 4CEUC 3HC0A 4WO0A 3FW6A 4PBDA 4D9LH 3W75A 3HE7C 2GYIA 4Z0BL 1DANT 4DHGA 4R9HA 3JWDH 2RFXB 4H83A 3O3RA 4U5IA 4BM7A 1UB3A 1YDPA 2LTQB 3OMAB 2AQQA 1JZ5A 1TMCB 1H9VA 1JPFA 4X7EC 3L5WB 4EPEC 4WQ6A 4XTRC 3T78A 3UO1L 3GLEA 4GNKB 4M5YL 4N2KA 1Y5VA 4WTZA 3RPTA 1DXIA 2HLAB 1I0BA 4E8GA 1IZKA 3O3EB 1SM3L 1IIKA 2WO2B 5I5IA 1KN4H 5GJNA 3VFNA 5I17B 1IBGH 5B4MC 4P61A 1AGEA 1XYLA 3FTWA 4P5MB 5E5CA 2IPWA 1LO2H 3DECA 3UBXA 2TSYA 4IU3B 3UW6A 4PZVA 3VXSD 4F5CA 4NZ4A 1C5DA 2E9WA 3E49A 4MMXB 5AW1B 3WLWD 2Q8AH 3D12B 4A04A 4GAYB 3VM7A 1FNLA 2RBLA 4NZDA 1OX5A 3OQ3B 2WXRA 4WCYH 5CEZH 1W0MA 4GAGH 4P2QA 4IIGA 5FAAA 1K8IA 4PWIA 3TEYA 1GYUA 2QJHA 1O5XA 4E3TA 2BCKB 4YYFA 4L56A 4XVTH 3QYSA 4JNZA 1HSBA 1GOQA 3L2LA 2WLHA 1R1CA 3BW4A 3ESUF 3V5CA 3PWNB 4A7GA 3BUQA 4EI5C 3W7PA 2O5XH 2D0FA 1UCBL 4GFTB 3SN4A 4HUCA 4MLJA 3ZLQC 5I15L 1I8LC 3HMJG 4KK5C 2W9MA 4ELKA 4N0RA 2XJLA 3GSUB 4HPOL 4I7VA 4L8BB 4Z1PA 3HQ1A 2G41A 1NFIB 1JGUH 4M1BA 1PS9A 3AWOA 5DEZA 4Y4KB 3CIXA 2V17H 4YHZL 1M7IA 4JFTA 1E0OB 3LMJH 4HU4A 3RPMA 1EEYB 1ZTMA 2XOTA 3WMPA 2NXZB 2Z1SA 3AZRA 4OLXH 4XZUB 3RZCD 2IAMD 4JKWA 2VELA 2BVWA 5EB9A 4PUUA 3RHWF 3O6FB 2CD0A 2R1YB 5H6HA 4PCYA 2NWSA 1RZKH 1FV1B 2D7TL 5EBMB 2XU9A 1FN4A 2H8PB 4LGSB 2EYSA 3MCMA 3RUGA 5T26A 1USZA 1IT0A 1TYEB 1O94A 3HLKA 3VG9B 5CN2A 2B0SH 1RA0A 1RJCA 2O6DA 3O0RL 1BQGA 4L8CB 4CD4A 1S2AA 4KRPD 3DMMD 5I73B 3EMQA 1DQJB 4YLWA 2GWGA 2EKCA 1JPHA 2ZQ0A 4RAUA 4YTSA 5HGGS 3BIKB 4FJZA 1XB6A 3O0LA 4MJIB 3TAKA 4XNAA 4RKAA 3OAZK 4WHTB 1BBDH 3QQ9D 2DV0A 2HXAA 4QLKA 2L04A 4ZUVB 1GTEA 2D2OA 3HEIB 2QCDA 5EOTB 3A9IA 43CAA 4B3ZA 3DFPA 3NQKA 3WLBA 2VDML 2CO6B 4QHPA 2I57A 2HJLB 1XDMA 4M5TA 4UOQA 4OT7A 4AG4L 3U2SB 1KLFB 4CJ0A 1P5BA 4K3EL 4JY9A 3D3AA 1D8WA 1CF8H 4RMUA 5G1YA 3EZ4A 2X7LB 4ZFOB 5F1IA 4Z8FL 4PH6A 4K0OA 1TZAA 1F05A 1ZEAH 5E6ZA 5CGYC 2GKIA 4ZXLA 3WSQL 2WKJA 3P69A 4ZMWA 2BOFX 3HZYB 3S5OA 4RBPH 4J27A 3EH2A 5T1DH 2N0MA 2D3VA 1T1WA 1SYVA 4JIEA 4DP4X 5MENA 1SZFA 2VENA 2CDEB 2DQUH 3PWVA 4Y2DB 1CLXA 3TVMD 3L3GB 1TQBB 2FX9L 2B1HL 3IMRA 3L68A 2UVEA 3MRNA 4GXVL 5FYJH 3EBAA 5EGRA 1GYLA 4JHAH 3BFOA 3EZJB 4YU1A 5A6LA 3UYPB 3ZDYE 1NCTA 3V18A 1WBXB 2P8LA 4N2EA 3W0WB 3AJXA 2QCHA 3UERA 3DRTA 2ZZ2A 5C0BA 1FWTA 4YZFE 1NANI 3PULA 4IFKA 3R1ZA 3U4BL 3KPPA 1LO4H 1YUHB 3DOSA 1Q6RA 4GKZA 2EUZA 3R4DA 4XX6A 4N9OB 3BDKA 1YEDA 4KETA 4EXAA 2P45B 4P3WA 2VLKB 3E0IA 1UIOA 3EYVA 3LIZH 3GKZA 5IW1A 3ARXA 4NAFA 1LDPL 1TVBB 3MNMA 1VLIA 5CMAB 1LRQA 3BI9X 3NPXA 5E6RB 1BQHG 4AGOA 5EIQA 5H94B 4X61A 3J07A 3WQVA 5JPMB 4G5AA 5DZ9A 5A3IC 1PKMA 2XVGA 4XBSA 4WU5B 2K3HA 6REQB 1MCOL 4OGQC 3WO4B 4HT1L 3D3VA 4FXKB 2Q86A 1A4LA 1WX0A 3GAKA 2FWLB 3BZFA 3VK5A 1NBVH 2H26B 5FF7A 3UMTA 1K4DA 1FP9A 4LLMA 1EPFA 3P5YA 2GIMA 4ZUTA 5JDJA 2QPEB 3CQIA 5JOPD 5HJ3B 3CXHK 4NXSA 1UT1A 4HKZA 2ZWLT 3UTOA 3BZ4A 4FXSA 4QAIA 1NGQL 1UC6A 4JR9H 5EF0A 3SFWA 5TD4A 3QZWA 2HSAA 2OJPA 3R11A 3MYZA 5DJ6A 1C9SA 3MSGA 1VIZA 1H7OA 4FKHA 4OCXH 1VC4A 1C92A 1A1MB 2G60H 5C0RH 4G1MB 5I1CL 4O51B 5D5MA 2J8UE 1I2RA 1XLDA 2R94A 3M0MA 2XIQA 2DSVA 4HJ0C 4KHTH 1YEYA 3PZQA 3V0JA 3WMBA 2EVHA 3NTYA 4O0KA 3WJLA 3H7RA 4U1SB 2XTKA 4EXKA 3GW3A 1TJMA 3CFNA 1SXCA 1IEIA 2BVPA 4PJ7E 4LCUA 3OKDA 5C0CE 4PJXE 3G3MA 1F18A 3PYCA 2GSJA 4HPYL 1BG4A 9RUBA 1M57B 3IDGB 3MJWA 4D2JA 2YL6A 4NFDA 3VM5A 2VH5L 1GG0A 2POZA 1A1NB 5HBBA 3PAVA 1KGXA 3P0WA 4NHUA 3VSTA 5JLZA 4CNPA 1VGAA 2HRPL 1TJIL 3LKPA 2OXGA 3OBAA 1U8OB 1LE9A 5E5UB 2DQWA 4XMLH 3D25B 5D2XA 4UTAA 5TE4H 2C9QA 3C09B 5D7IB 3QO0A 2EZ0C 3N4AA 4L37B 2DW5A 3G04A 3QCTH 4JLRA 1OF2A 4LRNL 3LTPA 1QVOA 3SGKA 3K13A 3CV6A 1R9XA 4WUUE 3QP3A 3FJ4A 2JJUA 1NPNA 1E9OA 4JPVL 5FA5A 4M8VA 1RUML 4OJDH 4JDTH 4S1DC 2P76A 5J11B 1BZEA 2ZRZA 2GITB 3WS3B 3G6JF 3ZR4A 2K70A 1QA9B 1BA9A 5D1XA 4BEUA 4OQTA 4KX8A 1J12A 3NFNA 2EXTA 2F54A 1Y5XA 4X6DA 3LZOA 2ALWA 4KVCH 4EZLA 4QBXA 1WTGT 3WFAA 1AYRA 1RZGB 3MP4A 4WW1A 4K5OA 5I0XA 2OZTA 2BNJA 1HYSC 3BIAX 4N2CA 1HH9B 4LHUG 1CLZL 3ARGB 5F0PB 5ITFB 4MWAA 4KUZH 1XICA 4OD1L 5I82A 4JIPA 3H3BC 4UOW0 3TBSB 1TDQA 1BVZA 1EX0A 3D05A 3SIKA 3WX7A 5IIEA 3TYCA 1TF4A 1LP9F 3VRLE 2ZCKH 1EJXC 1MUCA 3CV1A 1PG7L 2WB5A 2X4UA 2VZUA 2V2XB 3KLKA 2BDQA 1NSNH 3CN0A 5HATA 4AH2A 2AAAA 3A6BL 3RKDC 3L1FA 1FVCA 3QUYA 1DSWA 1TZHB 5DYOB 2JVUA 4OUOA 4Y9OA 4JFVA 5KBMA 2EDLA 2NY4B 1EUTA 3CUIA 4L8SB 4QRFA 2Q8LA 4ERSH 2Z91B 4P04A 1JBJA 1A4JB 4LL1A 2PXYD 2VC2H 4M4RB 3N6JA 3VDBA 4KZDH 4HA3A 3W28A 3ALPA 2GSHA 1FNSH 1BZQK 1IE7C 2D73A 2CRMA 2DZXA 3CVHL 2QGHA 2G75B 3R89A 2Y1YA 4UZGA 1M3UA 4GABA 4MS6A 3FZUC 5IQMA 1JN6B 3AACA 4OLYL 4KFZC 3BVDB 2NQ5A 1EJUC 4BFIB 4R4BB 3WFLA 3UTTA 2DQGL 2A9MH 4XPTH 2J4GA 4MCZB 1XYBA 1Q6EA 4PCKA 1M71B 5ACZA 2N7BA 4L6OA 3SFKA 4WO4B 4L05A 4KPHL 2H1XA 3T0CA 1CQKA 4EO5A 4UT7H 2VZSA 5DMJB 3GIVA 4HBKA 5E0QA 3V7AE 2A9NH 1MF2H 4E9YA 2ZUNA 3O6AA 1HKIA 5M2FX 4ZTEA 3DVFA 4KEMA 1F3DJ 2VLRA 3ABMB 2ZZ7A 2YMXH 1UD3A 3H7UA 3NVTA 1XLCA 2A3HA 4KQ4L 3X3FH 3DIPA 1CD1B 1GSMA 4C4BA 2QQKH 5FF0A 1J0HA 5EMMA 4Q7DA 3R4RA 1T22B 1MVFA 1CD9B 2ICEA 5FOJA 3OKOB 2YL9A 4HVXA 1JCTA 4GSUA 4RFOL 3Q1SH 3AUJA 3MRIA 5A6SA 4R96B 5GJMA 3GSNL 4KIEA 5K69A 1IL1A 4GSDL 2UXFA 1P7HL 2R9HD 3VGFA 2Y5SA 1BZ8A 1JNHA 3FQTA 3GVWA 1VCGA 2F1AA 4DZ8A 4WI3A 1AQFA 4YE0A 1HKLL 5C0CD 1TB3A 2HVMA 3E0WA 2AV7B 3HPFA 3QH3B 2UUDK 4JKPH 3QHFL 2QR6A 4U6VL 3S9ZA 3T42A 1I7TA 5ALBL 5I2IB 4AXWA 5J6HB 1PY0A 3IDIA 3QMTA 2IPKA 4B9JA 3D6NA 4DRSA 1CYGA 1QTYT 3B04A 4XWOD 1QNOA 4S0HA 3KGTA 1DVZA 3M16A 3B7TA 3PWLA 4JGUA 3Q1EA 4NJJA 1K85A 3BGMA 2OSLB 5TK4A 2CALA 3RWGA 4JQIA 3QQ4B 4ZMVA 3SGDH 1HJXA 5K9JL 4WUUD 4FP8L 2ZAIA 5D2NA 2XWJB 4RX4D 4NQEA 1TPUA 3NJGA 3HE6B 3QQ0A 1Z9SA 2Z6JA 4KF1A 1H3PH 4GISA 1ZSHA 3T0DA 1Q6QA 1A7BA 4ZW5A 4EZJA 2O9RA 1BEYL 2YGQA 3QV9A 4F2BA 5AVZB 3M86A 5LIKX 1J8HA 1ZSDA 5CJOH 1C7TA 3HGRA 3LRHA 3WFCL 1DVFB 4I9TA 2GAZB 1E72M 3NP4A 4YDIH 4MGXA 3ECUA 4NYUA 4AQ8A 3S8GB 3C08H 5FM5M 5AC6A 4FO4A 1EBHA 1DIKA 3WLHA 4NQQA 1UD5A 2KPWA 2GDUA 3A3YB 1P4LA 4LBEA 5J8LA 2APWA 3N2MA 1ADOA 2QQLH 2OMBA 5CH9A 2HX7A 3D50A 1O0VA 4KJWC 3L1EA 3O4LB 1UQSA 2NTFB 1YPZE 3T0EB 5HUPA 2P80D 3G6DL 1ILSA 4P23C 4K3DL 3LV5A 3MRMA 5FS5A 3FBKA 1NDTA 4YHNB 5KYWB 3L6FA 3OKLB 1UXWB 1GGTA 4GKLA 2HFGL 2UY5A 1FAIL 4XXDB 3EYPA 3CZLA 4Q8BA 5FCZA 2CR3A 5D7EA 1WA1X 2PPFA 3AHVA 3LQLA 1BOGA 3BP4A 2H0FA 4MXQD 2VRQA 1K8YA 3FTZA 1M7PA 1UVQA 4KKLC 3MCOA 2N59A 5CD3B 1E1CA 4V1DA 5GS0H 1GYWA 3SCTA 4DJDA 4IJCA 3GBNH 4PHZA 4ZFMA 4JHUA 3KRSA 5I6XB 2JMRA 3EYUL 3BSHA 3WTSA 3LZFL 1ZLPA 3ECQA 2B7NA 1FC1A 3MHGA 2YUXA 1R7OA 1R47A 5AFAA 3QDMA 5E2WL 4NQSB 3HG5A 3N18A 1DCEA 2BB0A 1L7IH 1UJ3B 3F7QA 7CGTA 4Y9CA 4DPBX 3C60A 1CMOA 2BV9A 3QVAA 2PCEA 1QI5A 3EWXA 4RXFA 1EJOH 3MI6A 5FKAA 3AIWA 1R19A 5GGSA 2FJKA 4L61A 2NY7L 4KX7A 5FAGA 4JYFA 3ZJKA 2PRHA 4QHMA 3QWQB 3I50L 3OC8A 4J3OF 3PGDA 1XCXA 2RKXA 1S9KC 3SCMC 2EJAA 3M64A 1KULA 4IDLA 3DXAA 3G6AB 1B0GB 3IKKA 2IPTL 2FVNA 3V5HA 4HIPA 3PE9A 2ON3A 4PJHB 2YOCA 1KD0A 2OT0A 4D0CA 4A7QA 5I8CB 3VGHA 2LVCA 4XHJC 3VNIA 1XSOA 3PNRB 3VXSB 4OTXH 1QPKA 2CLEA 4AM0Q 3ZW3A 1PIFA 1MNZA 2YXXA 3NG3A 5A7EA 1CJYA 1KM2A 4YDLB 2H8XA 3G08A 1HEJC 3EO0B 1MXGA 5KN5B 1KEMH 5BU9A 3RR4A 1RHCA 1OSEA 1ROWA 3OJGA 4HIHA 4W7VA 1TJ2A 4E2DA 1JMXA 1CICC 3ULAB 3EGJA 1EDTA 4QLLA 4XWUA 4G3YL 3W0WE 4HEPA 1BXCA 4JDBA 4WKZA 3RY4A 3LJ3A 4L8DA 2X1UA 5C7XL 5DANA 2K6ZA 5KITA 1JCXA 4FIRA 4QGYA 3B3IB 4DNHA 1ECEA 2R1KA 3IIZA 2Z9TA 4MB3A 2P1YA 4UQDA 3RVVC 2WBWB 3VUSA 3H3PL 2ZUUA 3MBEC 4N0UB 4MASA 4UM8B 2V37A 4HUNB 3NZSA 3X1BA 2X2YA 1JK9A 1CGXA 4OV5A 2GFBB 2R56L 5GRVL 1E27B 1MQRA 1WXZA 3M8OL 4NP9A 2O61A 3T6QC 3ELFA 1L9TA 1Q63A 3ZE2E 1A3WA 2JI2A 2HCZX 3O2VL 1U6AL 3QBUA 4A6GA 1RPQA 1AZ1A 3TH4T 1AA1B 1XQ4A 1EHKB 4ERGA 1EFQA 3P60A 2GSEA 4FMFA 2VN3A 3TJEL 4V2XA 2IAMB 2LU4A 5DQ9B 2CO3A 3WOVA 5REQA 3VSVA 1AO7A 1YNTA 1WQ5A 1XIEA 4Y9AA 2DQFB 2C9XA 1WLHA 3PB2A 3NDZE 1NBZB 3ME0B 1EO7A 2G4JA 5GGVH 3US0A 3RPIA 1IE4A 3BP7B 2J24A 3L3HA 5JVLA 5DQDL 3LZPA 3U9WA 4YSAA 2WXPA 1C08A 4CVWA 1WBHA 4RGNE 5K9OB 1JNNH 3BN3B 1EWDA 3OPUA 4YEEA 5AHLA 3DMMB 3T1FB 1U8MB 2AJXH 1DEEB 1VIWA 1MI5B 2YD9A 3NZ8B 4BSWB 4PN2A 3UTQA 4Y19B 4KKCC 2XV6B 2HTLD 5EH1A 4HFUH 4UQ3A 3WDHA 1YTDA 5K3VA 1URLA 4RAVA 1WFMA 5CBAA 1A9BA 5E6ID 3APTA 4HWEH 5CR1A 3ARSA 3MCLH 4NQCA 3SDDA 2ROYA 3DI2B 3EAKA 2ESVA 1POKA 3QHZH 2UZYA 1OKEA 4ROPA 4X9IA 1RULL 3VWKD 3GMPB 2P26A 5D2LA 4XCNB 3R7RA 2X0YA 4J5NA 4PI2A 3RWIB 1A4AA 2X89D 3BDYL 5EBLA 4XWGH 3V6ZB 4WU7A 1BFNA 2DTSA 4TL4A 1Q72L 43C9B 4N8CL 2WLZA 5GJSL 2TSAA 3THUA 5IREA 4RW5A 2DT1A 1PD0A 2Q8XA 3TA6A 3TZNA 3ISWA 3LHYA 3MCNA 4U4IA 3E0FA 4O1BA 3HRZC 2RDTA 1W3NA 2PSNA 3R79A 4LIQE 3KP0A 3ZDXE 4LPUA 5B80A 4HZAA 1E7VA 5BW7C 3PBVA 2F53E 3T2OA 5D7IE 2HMIC 3L9BA 5AC7A 3BH8A 4IP4A 5KVFH 1JWMB 1P1ZA 3EB3A 2A6DB 1FBIH 5DBUA 3MBXL 2BC4A 5I0VA 2X87A 2QV2A 1ETA1 3VD5A 5F89A 3PUEA 1BFVL 4N2MA 1BF5A 2FE0A 1TZ9A 3UZXA 5HULA 3AB0B 5L88L 2J62A 5IQNA 4QOKA 4U0QB 3USZA 3V5KB 2HT2D 4PTDA 4UNLA 4Q9QH 4PODA 2Q6WA 3ORJA 3FULA 3P9LB 2ZPKH 1F74A 4AD1A 3IRDA 4NDMA 4E9QA 2ISDA 2D3LA 3H9HB 3FY1A 4H3DA 3Q01A 3D0AA 1WC7A 2D22A 3QNZB 3I02A 3JUGA 2EDRA 4Q22A 3EXTA 3IU3B 5IHSA 1VRXA 3IWUA 2BVEA 4Y2DD 1YN6A 3WUWG 3E0GA 3FT0A 4OZIA 2A6KB 3DI0A 4PRTA 1Z5HA 4JZNA 1QFEA 2B08A 1A7QL 3VXNB 4OQVA 1DQQB 2KQNA 3W0WD 4APQA 5JOEA 5HJYA 3KPNB 4Q3MA 5KJRH 4Y2WA 4WUKH 4XN5A 1TWIA 5JW5A 3HLAB 3C2EA 3QRGL 2WYSA 1TO4A 5IJVA 4QT5B 3OR7A 4LBUA 3RNKB 4HB7A 4XIAA 3MLTB 3O41B 1GVFA 2V5KA 4W9KC 4TULL 5IWLA 1OP9A 1VAHA 2Z4GA 1P4UA 2C9AA 3VKDA 2XFXB 4PD4J 1G4MA 3B0PA 3JWNH 4LBSA 2KZBA 4PLOB 2KDYA 3ARDD 4IIEA 1MCEA 5LXGH 3WS6A 3NJXA 4KKQA 4PY8I 1FFTB 4HUUB 4CGTA 1F7BA 4A8LA 5CJXC 1EYEA 3EOAA 3RBSA 4KWOA 4GYKA 4LUTA 1E8YA 5CBJA 2K7QA 5CGQA 5KUMA 3NMEA 7PAZA 2PW2B 5ICYB 2H6OA 3M0HA 3QCUL 4MNKA 5CKGA 2ZTBA 2OI9B 4WFFE 1YEGH 5F7DB 2V5LA 3UTZA 2DQTL 2E9BA 3V6OC 5CHNA 3ECWA 1IEVA 1CL7I 2Y23A 4QYOA 4RGND 1A0DA 3R8HA 1EZLA 1MELA 2BSTB 4I5BB 3Q5OA 3UJSA 1E7UA 1CPUA 3CLMA 2QF8A 1W3JA 3NIDF 4N3TA 1VPOL 2G8ZA 4G7RB 1VJZA 3MJMA 5K9KA 1U3HB 4WVXA 3D0CA 4IOIA 4AY0A 4XQ6A 1I7UA 5AKVA 4Y8AA 3HI5H 1GVYA 3TEUA 3E5BA 1DFBH 3DX9A 3C2AH 4PJEE 4XO7A 1S7WA 2MNJB 4I2XA 3CFJA 2X4TA 2NQHA 3FB7B 3NIGE 1N70A 1IGTA 1X6UA 5HQMA 4WWKD 4MJ4A 1JGDA 3W87A 4FQJH 1FVDB 4X99B 1T5WA 1M2VB 3TIMA 4F7KA 2UY7B 1TR7A 3FA4A 1PCXA 3QVQA 3IGFA 1JV5B 4GEIA 2VOMA 1P0BA 3N43F 7PCYA 1C29A 1IRAY 3PZUA 1PLAA 2YCLB 4POZC 3GZAA 4MJ6A 2ZXWB 4DWHA 1UOVA 1KB9K 4HS3B 5IBTL 5HNUA 2VDLH 3U48A 1B2WH 2F53D 3MUJA 2CFFA 2ZKWA 2AK4E 3EOLA 1YDOA 4N0FB 3W23A 2C9VA 3KL3A 1KJVA 1V27A 1W72B 1JCNA 4X8CA 5DJXB 1IGIL 1QR4A 3WY3A 1Q8JA 4RE3A 1UWTA 2VE6B 1YYMH 3BW2A 1XP3A 3ZTDC 1WFNA 3WXVH 1MO0A 5AW9B 2CDGA 2XPKA 4TPRH 2IADA 3TONA 1F0LA 5U4NA 1NCWL 3ZTEA 5INDA 4JHWH 4LVDA 1KYOJ 3W7QA 1I7RA 4P5KB 3SGJA 4R0LC 3BUPA 3EDJA 3VIMA 4M19A 1CXFA 1AR2A 2DIKA 2CO1A 1OGSA 1I8JA 2DM7A 3S8FB 1KIRA 4MFEA 3GJEA 2EYTB 3LG3A 1IGYB 1XZ0A 4PUWA 3UX9B 1AI1L 4JCLA 2H9AB 4QS5A 3DYMA 4NWTH 1XT5A 5GZND 2PXYB 1LL1A 1NAMH 3NRFA 4FQ2H 4TOQA 1TQCC 1I85C 4ECLA 4QKXB 2FSEA 1SLVA 4I8YA 3P9WB 4N6RB 3WBWA 2A7NA 3BW9B 3MRQB 5C7VA 4YHKH 3T0EE 1O9WA 4GGHA 3U2ZA 3JYCA 1LEKA 4K5NA 3BJSA 5CUSH 3A4DA 3O9WA 3BWAA 5DFWH 3UDWC 4CNOA 2P5WE 1R7AA 4PV8A 2F58L 4TUJB 5D6CA 1SUHA 1LWRA 1MRDL 2WIIB 3LK6A 4I18B 3KM1A 4JVWA 3Q8CA 2LLNA 5HVHC 2BY3A 4X2PA 2TODA 5DS2A 4LSBA 4JMNA 4XKYA 2GTZB 2XH7A 1DWFM 4G83A 3W3OA 1TWZA 4RPPA 2EDDA 1MIEL 1QPOA 1T1YB 5D9PA 2QJNA 2XZAH 2ZOLA 3S3PA 5B8CA 4UT9H 3ULUE 4ZL1A 3VYOA 3PBGA 1QFOA 3QORC 2B3RA 1S9YA 4UMAA 2J8UB 2FX8H 1R87A 4GIOA 1O7DC 1MLBB 1IAMA 2DZTA 1W2VA 5I6SA 4MKMA 2JK5A 4WFFD 1ZXQA 2O1AA 4WZHA 3BVXA 2ZUYA 2G9HA 3BQUD 5BU6A 1T3FB 2JTDA 2YFOA 1KCUH 3WTUA 1W72H 2CZEA 3P2VA 4PJ7B 1TV2A 4HWZB 1CFNB 3NCXA 2FO4A 2NNAA 4NT6A 5C0CB 4PJXB 3U0PA 4M6UA 4K8RL 1W2KT 2B2XL 4OKVA 3KXFA 4PJHE 3KUMA 3QJAA 1MHCA 1ZLVH 5L2KE 4DEUA 1JZHA 4CU7A 2XZCL 5BV7L 4HIJA 1USQA 1NVMA 3QWOB 2XNAA 4R53A 2HG0A 4AHQA 4MAYD 2RH9A 1PG7X 2XN2A 3W24A 2YAQA 4WUUB 1V6YA 2R2HA 5F3BA 2VVSA 1WTLA 4WK4B 1FHNA 5SWZA 1S9XA 1KJMA 1MFEH 1KCKA 1PLBA 4C6KA 1T1XB 4F58L 3EYOA 4OGYH 3C5SB 5C54A 2VDQL 3EIFA 1Q7ZA 4G5DA 3E6FA 2DQHL 4ANKA 4PW3A 3N41F 4K73A 4OSUL 5JW3L 1D2PA 2FAUA 1P84K 3PWJA 1XL9A 2B8OT 2J57A 1J05B 3SODB 2YAFA 4C56B 3OJ2C 4F7CA 5DMMA 4PL2A 3O2WL 5FFOA 1ZCCA 4JKKA 3IS0X 1XIIA 3UAJD 15C8H 1F11B 4ORMA 3GMMA 3TC3A 4HLJA 1OX4B 3NNTA 2X10A 2HYMA 2C79A 4JICA 3TNNB 4FABH 4WJ5B 4TQHA 4JTDA 3W7OA 3PHOA 2WWOA 4RV8A 1YBQA 1OADA 4G70B 5JUEH 4MLIA 3ZQ9A 4OVVA 4GNVA 2BCMA 3IETA 2E27H 1RHHA 1GK8A 5ABGA 4A38A 1NA8A 4MLRA 1N6VA 3JU2A 4Z7WE 1PPIA 2WINA 1DVFD 3MLWL 4DO5A 4JFPA 4D6HA 1RJYB 1C8VA 2UWFA 3DX0A 1IGCH 4MY8A 2IO5A 2GEQA 4NHCH 4CCEA 4HHWA 3FXGA 1OP5K 1WOBA 3DKHA 1VESA 3QDJE 2DU2A 4BQ2A 1KNWA 3WXWH 1OINA 5FI8A 1K5NA 4CQCA 1MI5E 2X40A 5HHVH 5J06A 5C0JA 5DVOA 3MTXA 2EDTA 2OU4A 3L5IA 4QRSB 3T0ED 5I77A 2H3KA 1OPOA 2KMWA 3DCPA 4OF6A 4AH7A 5ID1B 1X1ZA 2IDCA 4FXGC 4MXVE 1JWUB 4GLEA 4UF7C 1G69A 1AGBA 1P4IH 3LI0A 4PGBB 2P5WD 2FWOB 1OAXL 3KPSB 2HK1A 2XQBL 4X7SL 5SV4A 5CGTA 1WA0X 1K9FA 2H32B 1CGTA 3W71A 2OZ4H 5JXQA 3RX2A 3ZTNL 4W9LC 4C6IA 2V5JA 1M3IA 3B7RL 3DFHA 2ATKB 4NQVB 4XVUC 4ZJ9A 5DWPA 3B9KD 3US1A 1P5VA 5DQPA 1J1PH 3D07A 3HFFA 4F0SA 4QXTB 2PI6A 3VXGA 4E5XG 3GSRA 1GKEA 4O8AA 2NSQA 1GWJA 3MXVH 4YVPA 1RK1B 1XH3B 2CRZA 3MYJB 1PLGH 5F7EL 1KYUA 1I1WA 3N9GL 5E8OA 1NY1A 2C19A 1E6OH 3ULUD 3MC0A 3OBEA 3MRDA 1CK0L 4I3RL 3CVDA 5F9OL 2Y5TB 1KFJA 5F72S 1FH7A 2AQRA 2CXEA 1C5CL 3HPLA 1FFPA 1HJVA 3LM7A 3RWDB 4P4RB 4MA7H 1MAMH 2X4NB 5E8PB 4XV0A 4RZCA 2A2QT 3MRBA 4J8RA 3H6JA 1F00I 4K7PH 4OJAA 4LASL 2WHVA 2Y07L 4IIQB 4NQDA 3ARPA 2YSTA 3FEMA 2FH8A 4WXZA 3QIBD 1NF7A 4FNLL 4EN3C 5L2KD 4TVDA 2L4OA 1RCYA 4PLKC 3CSYA 3K2UH 4G1NA 2CHZA 4ZMXA 1J6OA 2QKIC 5BVPH 4Z2IA 4S1FA 2A77H 4LSPL 2X4PB 2YARA 2ZCLH 5CLWA 5KS9E 2LAAA 4WJ8A 2W92A 3DPBB 2GIXA 2MCPH 5EYWA 3IDJA 2FYYB 4HPGA 3TYGL 2FPVA 1Q1PA 4ZTOL 4ZMNA 3AXMA 4EI5D 4DUOA 2EC8A 4H1LG 4TSAL 5EC1A 1W1IE 3CBKB 1ME8A 4I89A 4DBUA 2EE6A 3I9IA 4AL8H 3UBHA 1E4XI 1TVDA 1F61A 1DBKL 4U6XA 1JPDX 3UT0A 5AVWB 3CFKB 3CUFA 3B6SB 4H4NA 1ONEA 5E4OA 3NFUA 1A6WL 2BIHA 4RFNC 4UDUB 5GRJL 3H0TA 3NCJH 1UOKA 1JWSA 5H2BA 4AAJA 5ESAA 2MJWA 4FL4C 3BSGA 4LVAA 5T5FA 2F5AL 1VD6A 4LVHC 1QYGL 1JZGA 3NGFA 2H32H 2AXGB 4FG4A 2BVOB 1KPVB 3ZUCA 2OLDA 3M6DA 1YPZB 4IJTA 4B97A 5DK2A 3F7JA 3P62A 3QQXA 1OF0A 2ZZ4A 3MRLB 1WKYA 5E6IB 1ZE3H 4US6A 2OMZA 2OS7A 3GDKA 1A14L 2E6JA 3N4FA 3QIUC 3IJIA 3R2GA 4MZRA 3VXME 3VWKB 3GTIA 4FQLH 4MRCA 3TS8A 1ZXKA 3F12A 1IXQA 4N2IA 2EDYA 1FNFA 2P0IA 5L4JA 3QDJD 1KCBA 3F05A 4P5TC 4UMGA 1NF0A 3RA7H 4WUIA 2AJ3A 2GJRA 3B0YA 3I3EA 1DL7H 4DK5A 1MI5D 1Y1DA 3LOTA 3UZQB 3VKKA 2Y61A 4QKTA 1Z32X 3KYAA 4Y19D 3QPEA 4XSMA 2BRRH 3W2UA 3F5WA 1DBMH 1IC7L 1BF8A 4OUUB 2ZP0T 2FQGA 3FH5A 4F33A 2Z31A 2K1MA 4TLKA 2DMCA 1XLJA 1NDMA 2G0WA 2VC5A 3GX9A 3UOAB 3DVIA 2XG5A 4YHIB 2J6EH 5B1BB 2MPAH 4O52A 5E1QA 3GSXA 3ZTJG 2BMBA 3RFZC 1JYXA 4Y2LA 5C0AA 1INEL 4NZ3A 1POJA 3GMLB 3BZDA 4OF5A 4OJYA 1F1DA 5LIWX 3K4AA 4NUQA 5DBTA 6ALDA 3VFTA 4BHYA 1W9UA 2FJFA 1LO5A 1XR9A 3CAKA 2RJHA 3LY6A 2CU9A 5DJZB 4BFEA 1Q9KB 5F97E 3H70A 1JRHH 1QRNE 3QUML 2H7WA 5CCJA 2WNXA 1SNRA 3QKEA 4LAQH 3WBXA 1W0VA 4YAQB 4Z08A 4DWDA 2OGJA 4PR5A 2C6QA 4Z17A 1NFDF 1OVZA 4P3DA 1X4ZA 3V0HA 5DQJA 3LA4A 1WD8A 2G0LA 5HD8C 3U6RA 1JGEA 1OLLA 1U8IA 3LNGA 4NL1A 3L48A 4LAUA 3I7RA 4AQEB 3IXAA 4BWLA 3MTWA 2CO4A 1EIXA 1KTKE 4HX1A 4LDEB 3HQOA 2OFJA 2OCZA 1WHPA 4FZ8L 2Y7QB 1SGKA 4AWUA 4TSCL 5IP4A 4QIRA 4FF5A 3GSWA 1EFXA 3V0FA 4X6CA 5ILTL 4X4YB 2XKNB 4OM0H 4NRRA 3WHE1 2MHAA 4XVSH 3FFDA 1XGDA 4PMEA 1EJ6A 1G9MH 4NC0B 3SCNA 4ILSA 4CSTA 3ZE2B 1MJJB 2XICA 4P2YA 1SEBB 4MMZC 4BWWA 2ZX6A 1Z5LA 3ARDB 4KX9A 4J1UA 1JZIA 5ECJE 4K3HA 2D23A 1I53A 3ZKND 5LG6A 5DYFA 2R0LH 4LSUH 4KCUA 5DD6A 3TASA 4EUPB 3LQZA 2J72A 1KM4A 2XYLA 3KMDA 2DL2A 2E4FA 1BW8A 5D8JH 1F56A 1AMXA 1UR1A 4B15A 5DK0B 4FZIA 2B1AL 3QJVB 1OEPA 4GH3A 4KI5E 3EBVA 3V4VB 3UZJA 5AZ0A 1FLRL 3S34L 1C9WA 1X4YA 4HA4A 1BG1A 4RGNB 3ZUNC 3CHDA 1U8PB 1B1YA 3WKZA 2VM9A 2G3NA 1ZHNA 4R7NB 1NSJA 1YXDA 2CJSA 2GHWB 3CMOH 4D7PA 4QDGA 4YNYA 2MEJB 4QO1B 4YHLL 2FKPA 4DGVL 4IX2A 4L1SA 2WZ6A 1T1ZA 3WDIA 1ZY9A 1M04A 5I8OH 4A7SA 1EP1A 3F03K 4LLAA 1F6AA 3URNA 3SYAA 4WWKB 4Z7AA 4MA8H 2NR6A 3S2LA 3VXMD 2WXIA 5IB3B 3N4EA 5F1NA 5AOKA 3GJFA 1INDH 4NKMA 4HUVB 2XZQL 1ZA3A 3CWHA 1WJ3A 4AYFA 2DMHA 3U4EB 5T8GA 3CSPA 1U3HD 4PPTA 4XD5A 3FCUB 3FLUA 1BEUA 1ZHLB 1IEAB 1XCQA 3HN3A 2VL5A 3KDMB 3UG8A 2DQCL 4U6HA 3Q44A 4EKJA 2WY3B 4HHAA 3ZDXB 1JHTA 4CD5A 1F73A 2F53B 1RI8A 2AFNA 1KTLA 4MMWA 3IBOA 3NA8A 3STCA 3DFTA 4KRTA 5LBVA 4WW2B 2HAZA 4S1DD 4QSFA 1DJIA 5GSRA 1PGRB 3HG2A 2WJDA 1TCRA 3LRKA 3TZVC 3WQ6A 5CZTA 4HYVA 5L9FA 3KLAA 1CWVA 1R3KB 4X5QA 3ARWA 3JV4B 5F2GA 3KOXA 3EWWA 5IF0B 2BPBA 1U8KB 3MZNA 3IGLA 1SHWA 3SDAA 1UUMA 3H2EA 5IKCA 2AP2A 2O93L 1Z42A 4PJ5A 3S5SA 1U95B 4FC3E 4H9MA 4LLQB 5LN4A 3W37A 3BEWA 2BVQA 4FFZA 1QT1A 1QRND 1LHZA 5E4EC 4JRYA 4C56E 1TMHA 3WSUA 1H5BC 1GPFA 2VTFA 2D4FA 3QG7H 4HTYA 1WAAF 4U1LA 1KDIA 2VFHA 2BNQE 3SQOH 4PVNA 4ADGA 2HFEB 3MMUA 3S8WA 4RISH 1W80A 3EX2A 1B6UA 3D47A 4PB9L 3V4VH 5BRBA 3VWJA 1S7VA 5DHEA 3RKDD 5XIMA 3LBMA 4CVZA 1K9EA 4XNMA 3QARA 3COTA 3EGDB 1YQVH 3S2AA 3GVVA 3ARRA 5KVEE 5FKYA 5F3HA 3UA3A 1KTRL 1F8TH 2A74C 4FE9A 3SJVE 5DHYA 3I75B 2CIIB 2OX5A 1BVLB 1X7IA 4HOWA 4P2OC 3JV5A 3WQWA 1JYWA 1TV7A 4AM0A 5HI5C 2P5EA 4RMBA 2ZRUA 5DC9B 3K91A 3FQWB 4M5ZL 1QWHA 2H90A 4S1QL 4YK4B 1QHQA 2AOSA 2YL5A 3EF7A 4J35A 2E56A 1AD4A 3FZUD 5D2VA 4JUTA 1T5XA 3D4GA 3U4KA 3GMRB 4DQAA 2CRYA 2DF3A 2Z35B 3E8VA 3LUTA 3VXUB 1V6TA 3QYNA 3FFCA 4X63A 2EINB 4I0PA 1PFCA 3HNTL 4HCFA 4WDTA 5AW0B 4FFYH 5JHDE 3CO8A 5HPMB 4HKPA 1AIFB 3Q65A 2DICA 1SHMA 4X4ME 2J2ZB 1V7NL 1JHLL 2I5QA 3C2SA 1VSCA 4K8RC 4H9YA 3KPSE 4X9GA 1JFQL 2VCCA 4C90A 2VO5A 3DYOA 3LSOB 4JFEA 4KI5D 1FWAC 2YAOA 4LIQH 1IT9H 2CC0A 2RA1A 3G5ZB 5FW8A 3KPMB 1MUMA 4PTNA 3BQUB 4JOMA 4ML9A 4RNRA 3OHXA 5BV7C 5I0DA 5GRXG 1Y18B 1OARH 3VDHA 2VMDA 3QBTB 5E1AA 5KYYA 4RIRB 4K2UL 3LNHA 2JIWA 2J88H 1O60A 4HG4J 2AV1B 3T77A 3HPZA 3QTGA 5BZDA 5I71B 3VA6A 3K1GA 1XKJA 4HU3A 1DXFA 4IMKC 5F7HA 1REIA 3SM0A 2DVXA 3SBRA 5F7UA 4PJEB 4YDJA 4JM4H 3MAWA 4PVMA 4O1AA 1RIUH 5IMLA 4P4KA 2B9AA 3UPWA 4ODHH 2FBJL 3L23A 3NIGB 4BK5A 2FB4L 2WNWA 4UTWC 3GY1A 4PREB 2V5BA 5EZOH 2FMNA 5AY7A 1BM7A 4MAYB 4KO7A 5I18H 3J7HA 3GS4A 1TUXA 2YC1B 4M1CC 4F0MA 4MVBC 1RZPA 4XVJL 1YY8B 3DTXA 5TF0A 3LKOA 5ID0B 4KMLB 1ICTA 3F7VA 4WKFA 5HUOA 3IM1A 1FWBC 3NQMA 3S35L 2VM8A 4JTQA 3VH8A 2ZZ3A 4XZIA 1H1YA 2EHHA 3HGJA 1AHWB 2F19L 4FZEH 1JF5A 4NJKA 3LEVH 2OJEA 4HGWB 4OCSL 3KEHA 3BARA 4NZTL 5HGDA 2NNRA 1VPQA 2AK4B 4FOKA 2RIKA 1A6UH 2IH9A 2ZX9A 3MNDA 4LHQB 1Y07A 1GR7A 1HL4A 1DORA 2JLLA 3K4WA 4WFHE 3HG0A 4ELME 5LB1A 1M5WA 3OVRA 5FYKE 2W5PA 1NDGA 5L6YL 4AGNA 3GS7A 1OXYA 1WDSA 3CX5K 5LLIC 3FXYA 4LSSL 1OOAA 2AQ1A 4KY1H 3LH2H 3SQBB 3FV9A 3W1QA 4RMQA 5J13C 4NX0A 4ZMPA 3VXPB 1TT6A 1WFIA 3OD3A 2ENPA 1GGIH 5AW7B 5JR1H 3QDAA 3ESOA 3VTTA 4HW6A 5LAXB 2ALRA 3GH7A 4C56D 3BOLA 1IC4H 2F18A 2BNQD 5C0FA 2A3LA 4GJ1A 1ZGLP 4R26L 3V10A 1ZLSH 4QXWA 3QUZA 4W87A 1IZCA 2UZIL 3KYOB 2NVDA 3AXIA 4U3AA 1OQOA 2JFEX 4E41E 2PDNA 4P23D 2HH0L 1IM3D 4PBVC 3FOKA 3U2OA 3KRUA 4KZEL 2YPVA 4JVUA 5IHZB 5I24A 4L1LA 1LD9B 4OD3L 2DUXA 3TNOA 3TJIA 3SJVD 4XMPH 3U46B 3BUYB 2C7FA 3O15A 4LBRA 1INQA 2P5WB 4DJEC 3UGRA 3E74A 2WVTA 4F8PA 1KXTA 4QHKJ 5LUMA 4R9OA 2FATL 3CZKA 1Q0YL 5CJNA 6FABL 4EPDC 4PJ9A 3VJ6A 4U1IA 4OB5H 5AHEA 5ICZA 4LP4A 1DUYB 5E6SB 12E8H 4XC1H 3W7LA 4LUSB 2Y4SA 1UD8A 3B9KB 3DGCR 4WGXA 3PWUA 4QRTA 2Z3FA 3ABQA 1FH9A 2PP3A 3TEVA 3AIUA 5HYJE 1VYRA 3FJNA 4JS7A 1JVOA 4HKXB 3V9CA 2BNUA 5KSAA 3G0UA 3NA9H 3LY0A 5JHDD 1C3FA 1OG0A 4HUWB 3MXWH 5HYQB 1ZGLA 4PJIF 4B7IA 2YXWA 1TITA 3X3GL 2DM2A 3J8F7 3KPSD 1WZLA 1V93A 3FCSB 3QXDB 4CBZA 2INFA 2H6UA 1U3NA 4OGXH 3VGBA 3FYOA 2XZZA 2WQVA 4WEMB 2BP3A 3WFZA 3L5WA 4UFLA 4TMPA 1SMDA 1HAWA 1JF1B 1GQIA 1TX0A 1J0ZA 5EOQH 2J1XA 4UTCA 1NP0A 1LLAA 3GRWH 5C2UB 3AFBA 2A79A 3QQWA 2WTPA 2C3VA 4AGMA 1IILE 3QIBB 1HI6B 5I17A 3UXIA 4H8WH 4IRJC 4GYPC 3MFGB 5L2KB 5F88B 3T2PA 3GSQB 2Q0ZX 2PR4H 3K7UA 5FLUA 1ACCA 2WP3T 1WDQA 3PJSB 5G4NA 4JQ2A 4OCWL 3H7BB 3SUWA 1P1XA 2E3ZA 4E0CA 4GAYA 3WEOA 2VN7A 2PNDA 5CP7A 3B03A 2ZOWA 3MUY1 5H1WA 2WYTA 1NCBH 1UWUA 1L3WA 3J2PA 3DO4A 2H3DA 4AFYA 1X4XA 3ELQA 5CILH 2XUCA 2DQEL 4M6MH 1LCOA 4EI5B 5BOFA 3RVVD 4ALAL 4RDQF 4RRPM 1YNKH 4Z7IA 2NMSA 4X98A 2UZXB 5FUZH 1MH5B 3UVAA 2FMOA 1NMAH 1WBZA 4DYJA 4F3HA 1YA5A 5E1GA 4JYDA 3ETBJ 4FX8A 4YWGL 2AMXA 4FERA 4L1GA 3MGAA 3KWVA 2QEJA 4GA8A 3K30A 2X4RA 1UWAA 4EVZA 1AXIB 1PD1A 3UXAA 2OP4H 4L8BA 2NX1A 2E6FA 4WFHD 1EC9A 3P1VA 4XP5L 4QRNA 4LAZA 2WPBA 2FQIA 4Z5RB 2PE4A 5FYKD 4PLNC 1K7FA 5DD1L 2DDQH 2LLEA 1SBSL 4B60A 4ANWA 3SCRA 3JSSA 4KJQD 4WHDA 1U8HB 1UBSA 1SZNA 4H9TA 4HK7A 4XZUA 1C8XA 1D7CA 3G9AB 2GGGA 3MUIA 3WTXA 5C9UA 4AZ8B 4W6XB 3V6OE 2ASHA 1QNVA 2WLIB 3G18A 4Z7WB 5CCKH 5DRWB 3UXLA 1ZBVA 1JMZA 2JKTM 4Q0XH 3GI8L 4DBWA 3ULUH 4RW3A 4QWWC 2IQ9H 1SJXA 5E7BA 2F61A 4BXSV 2NY5L 1RD5A 4G1EB 1OIOA 2ORBH 2KLRA 3OQEA 3WK2A 1A3HA 3QDJB 1UEMA 1DJQA 4NT0A 1ZRQA 4KKCD 4RMVA 5AB3A 5TAOA 3JWOL 2CSPA 1Q1JL 1KGJA 4C47A 1A0CA 4Q4IA 4L8CA 5DCBA 4E41D 2VXUH 3V52H 3BLKA 4B2DD 4I77H 1XFPA 4F92B 3CLEL 4YGVA 1EAPA 3W25A 1DDHA 1F8MA 3BIKA 4MJIA 4PGLA 1WCBB 1A3RL 4YO0B 2XWTB 2FB3A 1I1AC 2I69A 3UCDA 4X0NA 2R59A 1MRCL 2RMNA 3GTFA 4U3XA 5D96C 3TK7A 4FQHB 3AQZA 4KU1A 2CO6A 3HR6A 2QSVA 2HJLA 5AFDA 4WI7A 4WHCA 4CA4A 2HKHH 3NJLA 5D2WA 1SJDA 5HXMA 2JQZA 1KLFA 4DH2A 3SO3C 1T03H 4N20A 2VO8A 5D1QC 4AYID 3TT3H 2RGMA 4X60A 5HYJD 5ALCH 2X30A 2P7TB 1W3IA 3IGXA 3D2UB 1VPYA 4XPAH 4JY6B 5D70H 1A6VH 2XBDA 5AVTB 5G4WA 5GQBA 1MRAA 4YHPB 5A69A 3HZYA 3MSDA 1TZIB 2DWSA 3N3MA 1EBGA 5JUVA 1OB0A 1HZHL 2CKBL 3UTSA 2CDEA 5AAWC 3D1MC 3W7HA 1DJHA 1UACL 5T9BG 4Z6AT 5I19L 2YWZA 2VDKL 1UCWA 1IMHC 4J3OC 3L3GA 2XG4B 4A29A 2QJJA 4KOCA 4LP8A 3KBPA 2AKRB 3REVA 3TJXA 4AZ7A 2A4AA 3QJQB 4D2NA 4LEOB 1NCAL 2CK0H 3UYPA 5KETA 4A68A 3D30A 4DBDA 1L0XA 1PY4A 1U8LA 4B9GA 4U7SA 4L4TE 3T8LA 4GXFA 4F9PC 1E40A 2NDGA 4GG6A 1KACB 1CTMA 1ZCOA 2W0FA 3ERXA 2WNZA 3AYRA 4NZUL 5KS9B 5KBLA 2EXSA 2ADGB 1N10A 2TSBA 4R7XA 2QQ6A 4WAFA 2LVEA 4F9LA 1EC8A 4AV0A 1RVKA 3HQPA 3WF0A 2C1IA 3T6VA 4BZ2H 5I5JA 4LPVA 2QF7A 4NIRA 2BP8A 1FJ1B 1S2TA 4JQAA 1DLHB 4Y8EA 5H94A 2XZ7A 2R1XB 1MVUB 3QDGA 1PZCA 5CS7A 1DQDH 4KTEL 4BFKA 4H40A 4MX7B 4WU5A 1ADQL 5I76B 6REQA 3GB7B 4GRWF 5BZAA 4FXKA 2J56A 3LCXA 2NRDA 2HJPA 3SI9A 1I6NA 4F2MB 4TQEH 2V5TA 2H26A 1U33A 3DX2A 5EFDA 4N2OA 4FOJA 3W9DB 4Y96A 1E6PA 3GI9L 2HK0A 3VFPB 4GY0A 1XBDA 2NXHA 3VU2A 3VXUE 3E80A 4H7ZA 3T4YB 1OYAA 1U1JA 2D9CA 5HGHB 3RB7A 1AMYA 4DFIA 6TAAA 4N6QA 1T0OA 1U8QB 3V0AC 1A1MA 4FR1A 2AK1L 1RPXA 3OG3A 1SMAA 2BGSA 5GGRY 1U2YA 4ZPTB 1A4MA 3VXMB 3IFNL 1IBHA 1XGUB 2WVUA 1HEHC 5IJCC 4U1SA 1W5NA 4G6AC 3CX2A 3ASWA 4XMUA 5CC7A 1Q0XH 1G1YA 1S5MA 4E9WA 4GX8A 2M2DA 3VDCA 1GHRA 3BO8A 5I1EH 4UILL 4Y8FA 5T91A 5CSYA 3EA1A 3X12B 2FO1A 3TR2A 3WGVB 3L13A 4A8NA 4EACA 5KSBE 4Z95H 4ASTA 1I3GL 4YHOH 4ADJA 1DN0B 3NJIA 4NZRL 3BKML 4Q6IA 5B22A 5BMFH 1F5WA 2ZXQA 3D25A 4ABVA 3M7OA 4IU2B 2O9OA 3FQRB 1SJBA 5FGBA 4L4JA 4V15A 3SDXF 4DF9A 2CLZB 3K5SA 1Q3NA 4KJYB 3MMWA 2F2HA 1NUGA 1EMTL 4AF0A 3AVEA 2J66A 4LCWB 4X5RA 3LCFA 3ZO9A 4PJBE 1YMHB 2J75A 3FRPG 1NEZG 3AICA 1E5BA 2JWYA 3LGDA 3OLEA 3D7PA 3N1PC 3VB8A 1KXVC 2WSQA 1ZHBA 4JO2L 2JIXA 1Q5MA 3NIFF 2XSXA 3WFDL 1G5GA 4DP0X 1Q9LB 2CPCA 4TV3A 3E38A 5AG9A 4M51A 1RZGA 2VDGA 3WF4A 2YXFA 3DC0A 1QRNB 4AZCA 1KR0A 4XAZA 5ITFA 3KYMA 1UH4A 4UU9A 2A1WH 3N13A 1KIUB 3F6LA 3X1FA 3QDHA 3IMSA 4CC4A 4Y9FA 1JXFA 2JELH 1BMWA 5A16B 1PZ5A 1I9JH 1WWCA 1IGMH 1AQKH 4F15C 1BXUA 1GQKA 1IEXA 1DLFL 2V2XA 1X5AA 4MWFB 4BQBA 3GIZL 1IFRA 3EMZA 3KBHE 4XPGH 4L5FL 1YRRA 4EWND 3CCHB 4Z2KA 1PBGA 5EU5B 2D0GA 2L0DA 5DJCA 4L4TD 2BY2A 3QZLA 5DYOA 3KAOA 1LWJA 4HCHA 4XP1H 1XD0A 2HVJA 4Q6KA 4C6LA 4IH3A 2WYIA 5KYUB 1Q6GA 2Z91A 3IGAB 1A4JA 2DLFH 1NFKA 2OQYA 4M4RA 1F3EA 5I8KL 5IMMB 1HE8A 1HIML 5T5NF 3LBOA 1NOWA 3LXCA 3NCOA 4Y4FC 4DXXA 1ACZA 2MCMA 2XTLA 1QK2A 2WKOA 3NTCH 4G1KA 4QXIA 1JN6A 4ETYA 3EDKA 1DKWA 1OIMA 4BFIA 1ONQB 4PWHA 4MCZA 3VTAA 4AJVA 2IWKA 2DWTA 3GNML 1M71A 1Z9PA 1LO0L 5TDPB 5L2JB 3C87A 4WO4A 3PZOA 4M56A 1NLDL 3KPLA 2LGNA 3UEZA 2PTTB 5FEPA 1NMBH 3APGA 1W3LA 1A5FL 4UT6L 2PO6C 5CSGA 5FF6B 3WMQA 2XI9A 3TFCA 4LCCC 3SBWA 4OFYD 1M1XA 3HAEB 3QIWA 4AT6A 4DGYH 3PP3H 3TUUA 3KD4A 3VXUD 1L6YA 5GS1C 1WICA 5HA7A 3QORD 3NSXA 1CD1A 1W9DM 1QBAA 2OQLA 4BK8A 1R2RA 3UWWA 6XIMA 3LB0A 4FTVE 3LNPA 3QY7A 2X6AA 1GOHA 3U5YA 4V11A 2WJ7A 3MLRH 4R96A 3FSVA 4OR1A 4KEZA 3GS0A 5B1JC 1FWHC 4YFDB 4PJGF 2LABA 4UAHA 3B83A 2N4IA 4ZQOA 3F4CA 4WOQA 1YEFH 1Z5YD 2OODA 3CXOA 4CNIB 3B4UA 4L18A 2Z1XA 4NOFA 1Q9OB 2F74B 4IMDA 1TTUA 1WP6A 2QGYA 4ISVB 5H37H 2NW0A 3AG4B 4FQ1H 5G5DB 1UWFA 5KSVB 2GBTA 4TN9A 1TV5A 5I2IA 2QQNL 4NO0B 5J6HA 1ZP4A 2AABH 1US0A 4LDCA 4TL5A 2OCJA 3SBQA 1R5VA 3B43A 1Z8AA 1A66A 2E40A 3ZL1A 4QNPF 4R8WH 2AF2A 1VHNA 3QEQE 4OZHE 4WEBL 4I13B 4LPTA 5MP6L 1OD8A 5AYUH 4EOWH 4G11A 4KZ0A 4ZAKC 2MSPA 5LHFA 4H44C 3QMRA 1Y65A 3KLLA 3ZTCC 2XWJA 4LLWB 2Z8SA 3L3JB 1S9VB 1EXGA 3FU0A 1UWXH 3HE6A 3IYLW 5MEOB 1MEHA 5DFTA 4LEQA 1TJHL 4GQGA 1ZT4B 3FH8A 2EVFA 4YVXA 4IQEA 1R5WB 2WTRA 3ZZLA 2F6UA 2AVGA 1DDTA 3QQDB 5LNVA 2YXVA 4FI6A 2AK4D 3BP5B 3TIDB 1PNCA 2GAZA 3VFOB 2PWHA 1YE6A 4JGDA 4HN4A 2BNQB 3KDNA 2NSMA 3MUHL 1N7MH 1D5IH 1RV8A 1SJHA 2Y7SA 5EMYA 4Q52A 1DIOA 2P88A 2IXUA 2EEBA 5BOZG 4MQXD 4LJ3A 3NG5A 1PKQB 3NSJA 2A3EA 4MYXA 4P23B 2A3AA 1IM3B 4XO6A 2NX5A 4M43H 3HAEH 3M88A 2NTFA 1GA2A 4N2HA 3AISA 3SJVB 4C4KO 4CVXB 1UXWA 2AQTA 4WSKA 2EUXA 3HI1A 1H7PA 2J78A 1S7QA 3DFQA 1OC5A 4XXDA 3IWVA 3G0SA 2B15A 1FWXA 1VYSX 3LZQA 4Z2JA 4JIHA 1ML1A 3ARBC 2X0VA 2CBIA 1I60A 1LBLA 4QTGA 1OCWH 3MOBL 3PCYA 5IVXE 3B8SA 2FL5B 4J4PC 2R24A 1RZ8A 4G6JH 5DZOA 3EYSL 5CD3A 1TJRA 2KZWA 4ZODA 1EVUA 1PYMA 1UXLA 4MJ5B 4OZOA 3D0LB 4EIZC 4AGLA 3EX3A 4GZ7A 2UWEB 3KCJA 4D71A 5JHDB 3VOCA 4PS8A 3GMNB 4YDMA 1FDYA 2A73B 4AK1A 2Z92B 1DVTA 5IR1B 3ZU8A 9PCYA 3TO4D 3OL2A 3O6LL 1KTBA 4NQSA 3N0AA 3S8HA 5J1TC 3TKFA 4JY5H 1HJSA 4HJGB 1OGTB 3P2TA 3BE1H 3S35X 1CBVH 2BW4A 1S3TC 3WD1A 1UFGA 2Q3RA 2P8CA 4OLUL 3G1VA 5E8EB 4A7TA 3F6JA 5FGSA 1GS6X 4JZ5A 2WVVB 3KXQA 4JL2A 3HE7D 1EAQA 5AG8A 2NT1A 3GPEA 4Z3GA 3I65A 1O1HA 1TJ0A 1Q94B 4HJJL 2CXKA 4FTVD 1V5JA 5I8CA 1GHFL 5IFHL 4ALAC 1JAKA 3HURA 2W65B 3GIPA 4XTRD 4E2OA 1MRFH 2OZ8A 2J47A 4PUBH 2CHDA 1OK4A 1SXSA 4LAJH 5DF0A 2GGHA 1CICB 4MZ8A 3EO0A 2F2KA 3WKPA 5B4MD 2IXQB 5KN5A 1XC6A 1IJNA 1PMYA 2Z1WA 1OK8A 3V5DB 3MBEB 3LV3A 2DLTA 1DJYA 4ZQTA 2BDNH 3O8XC 1ILUA 5IHUH 4HH8A 1GCYA 4TNFA 4XXWC 2WMFA 1G0YR