2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
molecule keywords Alpha-L-fucosidase, putative
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
1XSJA 1C7TA 1BFNA 4HOWA 2WZEA 5EMYA 4KWUA 4DO4A 3BAKA 2CBUA 4OGZA 1MQQA 5DO8A 3W24A 1TZ7A 4QLLA 3KWXA 4B9ZA 1ISWA 4ZEPA 1ZB5A 1LG1A 5M03A 3BUDA 3S5ZA 1HVQA 4P8WA 3RIKA 1GONA 2XVKA 4ML4A 1RD6A 1B3ZA 3AS0A 2JIWA 1A3HA 3MV11 2WVTA 3MUIA 3N9KA 3LPGA 3SUTA 4JKMA 4DO5A 4DM2A 1XCXA 5ABEA 2V3GA 2ZX9A 1TMQA 4XZWA 3A4WA 3GNOA 4TVDA 1JAKA 3D4YA 2D0FA 3AMKA 1B3VA 1DP0A 1EOKA 3N1AA 4AC1X 4W8AA 3PTMA 4OJYA 2OYLA 1UD4A 3THDA 1CXLA 1KTCA 4Z2HA 3PZMA 3WNPA 3PTQA 5DT7A 3AZSA 2VC9A 2QV4A 2V3DA 3CIVA 4CD6A 3EJRA 1NP0A 3PHAA 4H04A 1E56A 4CN1A 1GVYA 1QW8A 1EDTA 1H3GA 2WBGA 4S3JA 3M7SA 5CPQA 4HMDA 4U31A 1OWQA 2YFOA 1X1NA 3ZMRA 3EJSA 4J3VA 3EJPA 3WDIA 1W9VA 3OZPA 1WP6A 1KBBA 3VNYA 2FH6A 4H8UA 2A3CA 4YN5A 2DT0A 1ODZA 1KCKA 5GNZA 2CPUA 3T0BA 2OYKA 4PYSA 4W93A 3UEQA 2AOSA 4K68A 2FHFA 1HX0A 3EBVA 4CD7A 3ALFA 1HP4A 3WFLA 1LL7A 5HPCA 5A8MA 3QR3A 2BXYA 3LMYA 1ZBVA 1OIFA 5E70A 3D52A 3CZ8A 3ZSTA 3VINA 2CHNA 3A21A 4FNTA 4NX0A 5BXPA 3N04A 2JIEA 1KR1A 2W91A 1BVNP 2XPKA 5A8QA 3LRKA 2QMJA 5D9PA 1WZAA 2F18A 2VRKA 2WVVB 1V6XA 2J78A 2VQTA 2PBGA 2UY5A 4M1RA 2D20A 3KEHA 1V6VA 2JFEX 4IPLA 4AD5A 4U3CA 2G3NA 1EA9C 3CZLA 3RILA 3RDKA 3BMVA 1HKKA 5I23A 1E6QM 4W88A 3GBEA 4CD5A 4S3KA 4DUVA 1KXHA 1OD0A 2OLHA 1E4IA 1JZ8A 3ALGA 3WH7A 1JYNA 3AICA 1K6AA 5E6YA 3WY1A 3K4AA 4P7RA 5IHRA 1CGUA 8CGTA 4ACYA 2BS9A 3A22A 2VT0A 2WNWA 3D5HA 3KLLA 5F7UA 1VBUA 2CNCA 3OGVA 4DWSD 4B9YA 2ZX7A 4KRTA 4HP5A 2F7RA 2EAEA 1HJQA 2JE8A 2BHZA 4ZENA 1VFOA 3GXPA 1E6NA 1JD7A 3VKKA 3IJ8A 5C8BB 4HU0A 2BFGA 5CZKA 4GI9A 2VQUA 2D3NA 3WSUA 3WUFA 2WPGA 3VUPA 1BYCA 3ZR6A 2A3AA 2QLYA 3SCTA 1E40A 1WCGA 4CGTA 1B2YA 4EANA 3VIJA 4F79A 3VD5A 1UZ4A 4J3TA 1B9ZA 1TG7A 2J7DA 3VGBA 5A6AA 3OG2A 2ZUNA 4FLQA 2GFTA 1B0IA 1UOKA 1E70M 1GQJA 1GJWA 2J7HA 2QHAA 1TVPA 1G5AA 5A95A 5DEZA 2PC8A 1O7DC 1T0OA 3CBWA 2O92A 1HP5A 2G3IA 3G6LA 2CCRA 2XFYA 3MV01 5BXRA 2FH8A 3LXCA 1V0MA 3BVXA 1C91A 1DWAM 1GQKA 4OOZA 4P7LA 1FFRA 4XV0A 1B1YA 3LPPA 1AVAA 3W6MA 2VOTA 2WWDA 4AMCA 1XGZA 1HNYA 2X05A 2WSPA 1PZ3A 4AIUA 1UD8A 5IFPA 4WLCA 4LYQA 1H0IA 4NZCA 5GPRA 2EPKX 2XSAA 2WMJA 1V08A 1OT1A 3UR8A 3GNRA 1H09A 1R7OA 2XVNA 3L4TA 1D2KA 4M8UA 2XWDA 1QI0A 3ARXA 3ARZA 2XIBA 3L2LA 3THCA 1NWUA 4NRRA 5CPTA 3VPLA 1G9HA 2D73A 1E4LA 1NWSA 3VX1A 2W66A 5ECUA 1YQ2A 3PZTA 3F5LA 4UFIA 4FLOA 1KWKA 3BC9A 2F8QA 3POCA 2QPSA 5BYWA 5I6SA 5D9NA 4WSJA 3DYOA 3VMNA 2ZIDA 1HJXA 4AYGA 1W91A 3ARVA 4P8VA 1W9DM 3BUBA 2BVDA 2G3JA 2XWEA 1GOIA 2ZXQA 3ZOAA 3SUUA 1C90A 1WAWA 3F5JA 2XIIA 1XHGA 1DEDA 4URIA 4NZFA 1B3WA 5CG0A 3WY2A 3AZRA 1JZ2A 1M01A 4W8BA 5A69A 2DIJA 2E8ZA 2VZVA 3GTNA 1WDPA 4Z2LA 1JNDA 1NQ6A 1R85A 4MNMA 1VEPA 2D22A 3GXDA 2VZOA 5GNYA 4HOZA 1HXJA 2XFRA 2XGIA 3RCNA 3FHQA 3T08A 3MSGA 3VDHA 4UFJA 1QOXA 4CKQA 4UFLA 3WNKA 1C3FA 3VGGA 2QMKA 3HG5A 1KQZA 2V5DA 6CGTA 3ZJ6A 1FH7A 4MNLA 4W86A 3AHXA 4YPJA 3NSMA 2BHUA 5GNXA 1R8LA 1CDGA 3SCPA 2YFNA 4AZIA 1BPLB 3ZR5A 3S2CA 1E15A 1KCLA 3WY3A 3T09A 4CN4A 2DT2A 3GZAA 1KXVA 4GKLA 1QX1A 2WMHA 4D6JA 3U57A 1VF8A 3WEZA 2XM1A 1NOUA 3I3EA 3WN6A 4AZ7A 4UFHA 1GOQA 1V3MA 3SCNA 3KL5A 1S46A 5HDRA 5ABHA 1A47A 2WHJA 2FHBA 4M56A 1E73M 4W8LA 2J77A 4CN6A 4HOXA 4PSPA 3A24A 3SCRA 3E1F1 2IGTA 4EKJA 4QLKA 2X0YA 4UFMA 1UWRA 4M80A 2E0PA 1UKTA 3SCVA 2Y8VA 5AC5A 1Q4NX 3MSDA 1BG9A 3EDKA 2VVNA 4GI8A 3TV8A 5JBFA 1XD0A 1E9LA 1CIUA 3UG4A 1FP8A 2VVSA 4JIEA 3AMCA 2WMKA 3TTOA 3KZSA 4AWEA 1CGWA 3A5VA 3WF2A 2WCSA 2CIPA 4JAWA 1GHSA 3O9NA 1E6PA 1QI5A 1KXTA 4MDOA 5E09A 1EGZA 3DC0A 2VR5A 5FKYA 1MQPA 1CENA 3VD7A 3RM9A 3BGAA 5A6BA 1CYGA 3L4ZA 3MUY1 2CITA 4AD1A 1W1VA 4CU8A 2CESA 3GXNA 1OD8A 3U7VA 3UESA 1V0KA 3CGTA 1UH4A 3VILA 4X0VA 1BHGA 1PZ2A 3PZIA 3EDDA 3DX3A 2ZWZA 3AIWA 1ODUA 4JL2A 1IZKA 4MB3A 3VGDA 3VDAA 4JHZA 1E71M 3II1A 1H1NA 3MUZ1 3FHAA 1TQWA 3IGUA 4MB1A 1E72M 1VB9A 1R75A 3CHCA 2WHMA 5KZ6A 1QI2A 4PMRA 4Q7NA 4PCTA 4JFSA 4OBRA 2NW0A 1MXGA 3EJQA 3K46A 1BGAA 5I79A 3BUQA 1CZ1A 1LWHA 1KR0A 2J7GA 4LYRA 3T0AA 2XFFA 4FNQA 4UOJA 4E8CA 2X2YA 3RJXA 2XN0A 1UR2A 3POHA 3AYSA 3WQWA 1U2YA 1F4AA 4CU6A 3BVUA 3AISA 3OLGA 2W62A 2WC3A 2EEXA 1J9YA 1FH9A 4J7RA 3CMGA 3WH6A 5CQ1A 3IAPA 2WVUA 4H2CA 5CGTA 2DSVA 3U7BA 3AHTA 1ZJAA 1NOWA 3OB8A 3VU2A 4WF7A 2VX4A 1UR8A 4GZJA 1UH3A 2VZSA 5D9OA 4FMVA 4UQCA 3MMDA 4UOZA 3HZ3A 1V02A 1OIMA 1V3HA 4PBGA 4R5EA 3WDJA 1TCMA 3FXYA 5HPOA 1R34A 1W1PA 4RL3A 1NWRA 1QHPA 2PWGA 2E9MA 1JDAA 1IV8A 3L4WA 1UKQA 2W5FA 2Y24A 4GI6A 2WC7A 2W63A 2BY1A 3SCOA 2TAAA 1WB0A 3WUGA 2XVGA 7TAAA 2JF6A 5HOSA 2YL5A 4NXSA 3WH5A 1UKOA 3ZIZA 1IT0A 4NXKA 2JEPA 3GM8A 4D6IA 2GJPA 1HF6A 1WO2A 4QP0A 2VURA 3H54A 1PX8A 1LL6A 1UA3A 1R47A 2XSBA 2YL8A 1F4HA 4LYPA 4AEEA 1PX3A 1QI3A 2BVYA 3W27A 2ZUSA 4AMXA 2DT3A 2GUYA 3SCUA 3IJ7A 2XJ7A 2GDVA 1UKSA 1C8XA 5FIPA 2PWHA 1VFUA 3WL1A 4PCSA 3IJ9A 3F5KA 4V2XA 3GBDA 4MNJA 3SIMA 4W7UA 3LPFA 8A3HA 1KQYA 3WD3A 2VZTA 3GDBA 1OINA 3MKKA 3KLKA 2CERA 2DDXA 3AYRA 3PZGA 5I78A 3L4VA 4TTGA 3VVGA 4TUFA 4ZXOA 1QNQA 2IXVA 1HT6A 4GIAA 3WELA 2VRQA 4B3KA 1VIWA 3CZJA 2BY0A 5IXEA 4PMDA 5EB8A 2HISA 2O9TA 5FL0A 2VTFA 4A4AA 4L4OA 4UQAA 1HIZA 4UR9A 2WB5A 4BS0A 1JZ5A 2BV9A 5BCAA 4NSBA 2ZE0A 5CLTA 3J7HA 1DWIM 4QFUA 3PZQA 4AW7A 2O9RA 4MDPA 5HXMA 4FNPA 2A3HA 3HG2A 4BZYA 1NH6A 2ZUMA 4JCMA 4ZFMA 1I75A 1TUXA 1JG9A 3VSTA 2WLYA 3WD0A 3DECA 1Q6FA 2D3LA 4J27A 3ARQA 4U5IA 4XUYA 1HL9A 2XVPA 3PZOA 5M5DA 1JIBA 1HVXA 4R27A 4WKFA 5BXTA 3WQ8A 5JIWA 2W67A 1NOFA 2G4FA 4HMCA 2CEQA 3VIOA 3UCQA 3NSNA 4TX8A 3TTQA 4M29A 4PN2A 1E4MM 1FH8A 1JNEA 1UQYA 1NP2A 1UR4A 2EABA 1CXIA 1UWSA 2WZIA 3B9AA 1MW1A 1OT2A 2VMFA 1CBGA 2DH3A 4PTXA 2WSKA 3H53A 5AYIA 1ISVA 5M17A 3VIHA 4B16A 2J75A 1VJSA 2WVSA 3K8MA 2WMFA 1QWNA 2OW7A 4QDMA 4XX6A 2VR4A 4J3WA 5LA0A 5TD4A 1C8YA 3ARTA 1TE1A 1W9UA 3FAXA 1QPKA 4AEFA 2ZUTA 4W89A 4W7WA 1N82A 5A6LA 1SFSA 4V28A 1RH9A 5LA2A 1JF5A 1UWQA 2AMGA 2ZXDA 4W5ZA 1EHAA 4QAWA 3PBGA 3ZSSA 5D9MA 1BSIA 3VGHA 1C92A 4M24A 4PEEA 4UQEA 1JL8A 1EQCA 3HMCA 3WNLA 3VMPA 2BY2A 4J3XA 3U5UA 2PB1A 2YLLA 1E5NA 3VIKA 3LX9A 2BHYA 3VSVA 3PZVA 1W9BM 1XH0A 4QCEA 3VGFA 1CWYA 3PZNA 4F9JA 2OWWA 1V3IA 3MMWA 3ARRA 3A3HA 1H41A 4F8XA 1BTCA 1ISZA 1P6WA 2G41A 4AZ6A 5A6MA 1KGXA 2WKGA 2WANA 3CUFA 1KBKA 1BYBA 3F4VA 3KL3A 4JKLA 2NT0A 2W92A 2OW6A 3WD4A 1CGYA 2RGMA 1D3CA 3QGVA 3OBAA 4AZ5A 1JGIA 4UQDA 1I1WA 3N18A 2EADA 3T0DA 1FHDA 3WENA 3M07A 1HJVA 2V5CA 1J01A 1GJUA 4RE4A 4H7VA 1O6IA 1J10A 3WKZA 5I5RA 2JEQA 3W28A 3OIHA 1E6SM 2Y8KA 2GJXA 1K9TA 3SCWA 4AZGA 2ZXBA 1EIBA 1C93A 4MB5A 1VEOA 3WDQA 1SYTA 1GCYA 3BLBA 5IDIA 1E4NA 5M3WA 1K9EA 2IXUA 2UY3A 3WMSA 1SZNA 1CLVA 1ZBKA 3FAWA 4X0NA 2YL6A 4AD3A 1SMAA 4UZSA 2X2HA 3OLDA 4PMNA 3BVWA 4B3LA 1EHNA 2X2IA 5CJ5A 2EACA 3CH9A 4ACZA 1PBGA 2F1AA 1WZLA 5BRPA 1JI1A 3BLPX 3NDYA 1V03A 3CO4A 1QI4A 1ITCA 4GO9A 2XTKA 4Z2KA 3NJ3A 3WQ5A 1UD6A 1FP9A 3AIRA 5A8NA 5A6BD 1W3LA 4A3HA 1HKIA 4QLJA 1X6NA 1E1EA 1CXKA 1H0GA 1FFQA 5A8OA 3AIUA 3LPOA 2W61A 3L4UA 1JDCA 1TQSA 5GQBA 5JIPA 3BH4A 3G6MA 4PMVA 5CGMA 1TQTA 4TTUA 3WQVA 3IK2A 3RMEA 1QHZA 4IISA 4EAMA 4BQ4A 3CUJA 4P7QA 5DFAA 1CTNA 5LYRA 5EFDA 3BMWA 3TTYA 2AAAA 1WKYA 4N42A 3WQ6A 2JALA 1GOMA 4IUGA 4PMOA 9CGTA 4HZ7A 4F9DA 5I3DA 2EPOA 3DHPA 2DQXA 4NF7A 4FF5A 4QCFA 4UTFA 3W53A 4AZCA 3PZ9A 3GXTA 5E6ZA 1HJSA 1NM9A 1DWHM 3BUPA 5A2AA 3WEOA 2WMGA 3WBEA 5E0CA 1CGVA 3AMDA 1MWOA 3UETA 4IM4A 3WBAA 4AD0A 3CMJA 1VAHA 2J25A 3KL0A 3ZT6A 1GQIA 1V3JA 2VX7A 3EMCA 4C7FA 3IAQA 3FY1A 3CHEA 3WNNA 3VD4A 2CYGA 4P7NA 4BCEA 1E6RA 3ARUA 3GXIA 4PSRA 2CETA 2J4GA 2ZOXA 3M6DA 4IPNB 4GXPA 4CD8A 1JF6A 3I3DA 3BUIA 3K4DA 5CPSA 2WM0A 3WF3A 3CTTA 3FNDA 3VMOA 2OWCA 4C7DA 2A3EA 1J0KA 1BLIA 4W87A 1BGGA 2WBKA 1HJWA 4MNKA 3HN3A 4HA1A 1LF1A 4V27A 2PI6A 3PTKA 5E9AA 3LRMA 4AZBA 1U33A 3LXAA 1BG4A 2YL9A 3W38A 1W1YA 2EXOA 1VFMA 2FHCA 2F7PA 1HXKA 1XV8A 1CGTA 1G0CA 1CXEA 1AQMA 3W81A 5E0FA 3AI0A 3BAWA 4BF7A 3N15A 1HWWA 3BAJA 4Z2GA 1M04A 3LRLA 3AFBA 1J12A 1TR1A 4LPCA 5HNNA 2C7FA 3IANA 2Y4SA 1GPFA 2F61A 4J3UA 4WJXA 5CLWA 3SURA 4M81A 4RE2A 4D6HA 3OLIA 3UG3A 1UKPA 1UYQA 4FLRA 1AQHA 3AS1A 1VJZA 2C8NA 3AS3A 4HZ8A 3CZGA 1OGBA 1UUQA 1WE5A 2D1ZA 5FD0A 2E40A 3WUBA 3SEPA 4PUDA 1WPCA 4UQBA 4ATLA 1M7XA 3VIGA 1JZ6A 3TOPA 2WHKA 1LG2A 5D4YA 5D8ZA 2CBJA 4PUEA 1PX4A 1BF2A 2VJXA 5D8WA 1B3YA 3AQUA 4P8XA 1E6ZA 3QHOA 2ESCA 1E43A 3OGRA 3MUAA 3WUEA 4U2ZA 2GJXB 5DMYA 2WMIB 2HVMA 3AIQA 4MAVA 1G1YA 1GOOA 1ZBWA 4WKHA 2DT1A 1V3LA 2GDUA 3DX2A 1R33A 4HTYA 1MXDA 3A4AA 3A47A 3NYDA 4PMQA 4D72A 5A1AA 1RP9A 4M82A 2PBOA 2Z1KA 3BVVA 4KGJA 4D1IA 3RO8A 3SUWA 4ACZB 1E55A 3DDGA 4UZUA 5BWFA 1HTYA 3MI6A 2X09A 3AMLA 5I2UA 4FNUA 2XM2A 1BAGA 1XH2A 7CGTA 1Q6EA 1OB0A 1OBAA 1WZMA 5CSYA 2XG9A 1MW0A 3WD2A 3GYCA 5BRQA 3EDFA 1ZBCA 1W9PA 1QWUA 2YBUA 1W2VA 2CBIA 4ZE5A 3BSHA 4HMEA 2E4TA 4HPHA 3CHFA 1L0PA 3U5YA 4NZJA 2Y5EA 3VIMA 3VOCA 1QHOA 4L4PA 3AXIA 4PTVA 2JF7A 1ECEA 1JXKA 1WZKA 4P7OA 3GH7A 1US2A 1ZS2A 1QVBA 1Q6GA 4TVCA 4YHEA 3BLKA 4FNRA 3AHYA 3K1DA 1GUVA 4UOQA 1E1FA 3DYPA 1M03A 3WH9A 5ABFB 2ZXAA 4AZCB 2ALWA 3WNOA 1EDQA 3K8KA 4CCCA 3TONA 4UCFA 4DO6A 6A3HA 1V0NA 5C71A 3PZUA 2FGZA 1UH2A 6TAAA 1TFVA 2X0HA 5I77A 3VDBA 4UQ9A 1G94A 3WL0A 1PJ9A 4CUCA 2QPUA 5CSUA 1UHVA 3A6OA 1EXPA 3NSXA 2ZX6A 1BYDA 4U5KA 1KXQA 2YA1A 4NI3A 1I1XA 1AMYA 5FL1A 1XYZA 4Z2IA 4MTVA 2WWCA 4JFVA 4E2OA 3MANA 3WF0A 2XN1A 1UR1A 1K9FA 1RP8A 2J7BA 4D6CA 2XGBA 3B9DA 4W5UA 4D6FA 4OBSA 3CUHA 2XYLA 3W0KA 4TOQA 2DGAA 3BCFA 4GZIA 2RGLA 3BAYA 3WFZA 3CZKA 2YDSA 3WQ4A 4AD4A 1KB3A 1JFHA 3MU7A 1EOMA 3N12A 2F7QA 3WF1A 2WCGA 1TVNA 1PIFA 1GNXA 1MFVA 1W2PA 2VZUA 2VI0A 4LX4A 1GHRA 3T2PA 4A3YA 1GZJA 3BAXA 1EDGA 4W84A 3M46A 3DX4A 4D71A 1JFXA 2G8ZA 4JFWA 5A2CA 2GK1A 1UR0A 4BA0A 1JYXA 5DF0A 3CHDA 3K8LA 4ATWA 4BQ3A 3CC1A 1UWUA 1CGXA 2WKLA 1NWTA 2J8GA 2CHOA 2O9OA 1ITXA 1G01A 3RM8A 4DWSC 2J7CA 3VIFA 3H55A 4PMYA 2OWXA 1HN1A 1OCQA 3GXFA 4HU8A 4AZHA 3D51A 3GH5A 4Q22A 4JFTA 4D6GA 1J11A 3HG3A 1E0XA 3TA9A 1KTBA 2DIEA 1VENA 1PIGA 2VO5A 4YHGA 4CD4A 5EFFA 1UWIA 3HU7A 4W7VA 1HJUA 4PTMA 5FCZA 3W82A 2G3MA 1CNVA 1W3KA 2NT1A 1E3XA 4Z2JA 2EPNA 4F66A 3EJTA 3WD1A 3AOFA 1GQLA 2XHYA 1UWTA 2E9BA 3AHVA 3EDJA 5LA1A 1KGUA 3CV5A 2VCCA 1JDDA 3AHZA 4OOUA 2BNJA 2BXZA 2DSWA 3AZTA 3GNPA 1DHKA 4D6EA 3ECQA 4CU7A 4U3AA 3VDCA 1UD5A 1B30A 3OZOA 1R86A 3VM7A 2VL4A 1HL8A 5FOOA 1BQCA 3AXHA 4D6DA 1LL4A 4CVUA 3ARWA 2DPEA 2WCAA 1XH1A 1Y7VA 4MJ2A 1JD9A 4LGXA 2VNCA 3MMUA 3ZT5A 1CLXA 4D1JA 2YDQA 1JYVA 2ZUVA 4UFKA 3PN8A 2J8FA 3B8SA 3W4RA 3CZEA 3WH8A 3AIBA 5JBDA 5A94A 3ZJ8A 4TXEA 1BVZA 2YJQA 3EMZA 2ZICA 1OM0A 3BAIA 2NSXA 3VO0A 3S6TA 4TVUA 1M53A 5EBAA 2PWDA 1E0VA 3RPMA 2Z1SA 4E4PA 1UD3A 3QHMA 3AIVA 2ZWYA 3AJ7A 2MANA 1DWGM 1UZ1A 3VTRA 2J79A 3W37A 2FE0A 5AY7A 3WIJA 3VIIA 3DX0A 3UR7A 4BQ2A 1OSEA 3NUKA 2D0HA 4J28A 1C8QA 4JL1A 2V3EA 3OLEA 1MW3A 2YA0A 3JUGA 2WK2A 1JI2A 1XSKA 1TQUA 3FW6A 1OGSA 1WNOA 2FDMA 2FGLA 1VBRA 1PEZA 5I24A 1KGWA 3DDFA 1FHLA 3VD3A 2PF0A 4TX6A 2Y2WA 4DM1A 3D4ZA 1FA2A 1R46A 1VEMA 3AS2A 4HZ6A 4PTWA 3I3BA 4Y7EA 4X9YA 1GORA 4WKAA 1J0ZA 3DHUA 3QHNA 4ZXLA 3W26A 3L2MA 1D7FA 4KRUA 4CCDA 2E8YA 3NDZA 3B9EA 2WMIA 1Q6DA 4N0RA 1E6XM 3EJUA 2EPMX 3BCDA 3VSUA 2GJRA 1AQ0A 3CUGA 3T2QA 1QNOA 2XUCA 5A6KA 2ZUWA 1W32A 5C70A 4JFUA 5A8PA 4ZE4A 2C0HA 2E9LA 1V6YA 2VCAA 2V38A 5CXPA 2YA2A 2CKSA 3SCQA 2WAGA 3N11A 5JUVA 5IFTA 3VM5A 3CLWA 1VRXA 2VRJA 1R87A 2D0GA 4H8HA 1XCWA 4U2YA 2O9PA 1UA7A 2DEPA 1YHTA 3GH4A 4H41A 2OSWA 1ZU8A 4UNIA 3L4XA 2BY3A 3WMBA 1GOWA 1TA3A 3BVTA 1ISYA 3SCSA 1GOKA 3KE0A 4AY1A 1HKJA 1V3KA 2XVLA 2J7FA 2WC4A 3OGSA 4WK9A 1LWJA 3D50A 1UQZA 3ARPA 4KGLA 2BVTA 3BXWA 2D2OA 2QF8A 1H2JA 1WDRA 5BROA 1OGGA 5A6SA 1C7SA 2YKKA 2J47A 4OZOA 2GK1B 1MFUA 2D23A 5KEZA 3ZO9A 3SUVA 1Q6CA 4H8VA 2DSUA 4XZBA 5ABFA 1E0WA 4GINA 3ARSA 3RM4A 4W85A 3VD9A 3MS8A 4KMQA 1DWFM 1UASA 2UY2A 4DWSA 4HA3A 2F7OA 1UR9A 1H11A 4HA4A 3VIPA 3ZJ7A 3OA5A 4LXFA 1O7AA 1ISXA 3ZT7A 3CZNA 1IZJA 4MADA 1EO7A 3VGEA 1TQVA 4C7GA 2EBNA 4E8DA 1W3HA 2X1IA 3HG4A 3VNZA 2F1BA 4FK9A 3GXMA 4DUXA 1MVYA 2X2JA 1KFWA 5A3HA 2PWFA 4AD2A 2YBTA 1QNPA 3L4YA 1MQRA 4GZEA 3DYMA 3AIEA 4HPGA 1XSIA 3WDHA 5A2BA 2WZHA 1J0IA 1QW9A 5DT5A 4CCEA 2VCBA 5BXSA 2OSXA 4WSKA 1JXJA 4LQ1A 4AXNA 4FNSA 2DSKA 1B31A 3WNMA 2Q8XA 1V6UA 2V3FA 3WEMA 3WF4A 2YIHA 4XB3A 1B3XA 5ABGA 3AMGA 2UWFA 3LXBA 1GVIA 2EJ1A 3ZQ9A 5HBFA 5JBEA 4DUWA 2UY4A 2IUZA 2ZX5A 4OKDA 3QOMA 4WIWA 4CVWA 1W3JA 2DH2A 1Z32X 1EH9A 4MB4A 1JZ7A 4RE3A 1V02E 1J0YA 4AYSA 3FN9A 1H5VA 2W4XA 1QBAA 1XRVA 4OIFA 2FYVA 1WDSA 3S5YA 1DTUA 2YLAA 2J74A 1XYFA 1R7AA 3RJYA 4NRSA 1LJYA 1XC6A 2X8RA 3W29A 1ZJBA 3ARYA 1PAMA 4MJ4A 1H49A 2YOCA 2EO7A 3CZSA 1MYRA 3QOKA 1V6WA 4AISA 3W6LA 1CXHA 1SMDA 4AIEA 2J62A 3O6AA 4JZ5A 3TTSA 4EE9A 2CBVA 1QNRA 4MAZA 1EO5A 2WHLA 3N17A 3ZM8A 1LLOA 2DSZA 2ZUUA 1PS3A 1HKMA 4PMUA 4MPKA 4GQRA 5AYBA 4GPNA 3UG5A 4PRWA 2J7EA 3D3AA 1ZL1A 1BYAA 2VX6A 1X6LA 1VFFA 4J3SA 2EPLX 2VX5A 2WVVA 1US3A 2WYSA 3ZJKA 1ESWA 3HJEA 4JHOA 1W9XA 2VUYA 2F2HA 4KH2A 1LQ0A 5AC4A 3W25A 2A3BA 1JYWA 4AMWA 2GVYA 1L8NA 1EQPA 1WDQA 4BQ5A 3MO4A 1E3ZA 1E5JA 1KWGA 1UG6A 1JZ4A 2D24A 1J0JA 1V0LA 1RPKA 1K9DA 3WDPP 2WXDM 3NCOA 2CXGA 1B90A 1SR0A 3APGA 7A3HA 3SUSA 1QNSA 3CUIA 4FLSA 4PMXA 1CECA 5A6JA 2B31A 1J0HA 2PWEA 1QBBA 1CXFA 3DX1A 1XD1A 3O2LA 4PMZA 2YDRA 3NIYA 4JCLA 2OSYA 4AIOA 5E1QA 1JAEA 1TA3B 2EQDA 3A4XA 3BSGA 2CKRA 2GSJA 2E3ZA 3A23A 1PPIA 1U30A 4EK7A 2OYMA 5IHSA 3VX0A 3TP4A 1UD2A 3AXXA 3EYPA 1NARA 4JKKA 2XN2A 3WDRA 3T2OA 3UERA 1CEOA 1W1TA 4P8UA 1GW1A 1FOBA 4GQQA 3WMCA 3EDEA 2WW5A 1DWJM 1H4PA 5I0DA 3CPUA 4B15A 4U33A 1CPUA 4ATDA 1JZ3A 1MW2A 4DWSB 3N13A 4GO8A 1J18A 3WY4A 3AROA 2WLZA 2ZX8A 3EMQA 4OUEA
chains in the Genus database with same CATH superfamily
4S1SL 3HRZB 2V2CA 3CVCA 3JYBA 2FTPA 2UWEE 3QP3A 4WO4B 1RIUL 2PA6A 1IBZA 3TQ0A 3MGTB 1KT2B 2W27A 4X7FC 2BNQA 1HVQA 4N20A 1OTSD 8FABA 1IVTA 2XG5A 4M5YH 4RGMB 3NSFA 3STCA 4PL1A 2A6NA 2JQXA 1UCBH 1PXGA 5AOZA 1NFPA 3MB9A 1NGWB 4Z23A 4K15A 3SDAD 4ZMQA 4YQXL 3G7TA 3MPGA 4NNPH 1EBHA 5B7ZA 1QPXA 4GKNB 4YHNA 1QRNE 3TTEA 3JZUA 4JPIA 3TC6A 5T91A 5I71B 2FVKA 1MCIA 2ZP9A 2ARJQ 2V9UA 4K3EL 4JY6B 2MUCA 4W9ZA 4LBEA 3SGKA 3U30C 3QZBA 2BVPB 1XI3A 4TQHA 4YN5A 6XIMA 1I8KB 4U6YA 3UEQA 3B8UA 1E5CA 2R27A 1N9PA 1HP4A 5CFAA 3SBWA 2C4FU 4JB9L 4XVSL 3WQCA 3QUYB 1KLFB 2G30A 5D9PA 2Q1EA 4F2BA 3KRUA 1V6XA 1X7QA 5IHLB 2UY5A 2Q02A 3V5OA 5L8KB 1NLBH 1TF4A 4LOUD 1MFEL 1QSFB 4DUVA 4NO3A 4OQTL 3LQAH 4ZFZB 2V2TA 4BFKA 4MMXB 4QKXB 4YHKH 3ZVVA 2X38A 4GMTL 8CGTA 4ACYA 4L9LA 2CNYA 4PUBL 5E1HB 5F9OH 5F7UA 1DE5A 5HQLA 5TK2A 2PR4H 4B9YA 2OMWB 1HJQA 2VLME 2DW6A 4YMPA 1DJGA 1N59B 5G4MA 3WSUA 3QWRA 1NFDF 3ZR6A 5FO8A 5IEKB 3PSVA 2V2XB 3C9NB 1SZRA 3AAZB 3LH2H 2D31A 5C0CA 5HHNB 1GKQA 2DKUA 2IANA 2XA8L 4L9DA 1E4KA 1TVPA 5IFHH 1RHFA 5DEZA 5ECVA 5T1MA 4AFYA 1WKFA 3UGRA 3NZPA 3ZHLA 1RV8A 1G4RA 2HQAA 1PQZA 1B1YA 3W6MA 3ILQD 1S7TA 4IDLA 3SN4A 2BNQB 4MOZA 2X05A 3JVFC 8FABB 4HT3A 2FWUA 3S3BB 5JPNC 1WFNA 1ASPA 1BJ8A 4FL4B 3E49A 2ABBA 3L4TA 4KI5D 3KXFB 3ASOB 4LGSB 4LEFA 2DZSA 2PS2A 3MYPA 1MJUL 2ZSWB 2PLJA 5C9RA 4YHNB 1DN0B 4XX1E 3LS5L 4HCRA 2XOTA 4W4OA 3ARDD 5F1IB 1I3UA 4LBEB 1GVSA 4G7YL 5IW1A 1XISA 5IFAL 1M01A 1CX9A 3PB0A 2RUSA 4U6YB 1EJ7L 1VBHA 4TQTA 3OB0H 2BLEA 3C5XA 2XGIA 4PJBF 3VI4A 2IKGA 5I74C 3QE5A 2E77A 2XYBA 4AEHH 2TRSA 3ERPA 1CBVH 6FABH 5LJYH 5I15H 2A0NA 4YX2H 1X7QB 4A6YL 3D2UA 1R17A 1GZQA 4WY0F 7ODCA 3WLPA 4GG6E 4NO3B 5E51A 4M6AA 2V2TB 4GI4A 3NQMA 4WHBA 1Z5HA 3GLAA 1XB3A 2WHJA 4L9LB 4X9SA 4U1LA 3ZW3A 3WFAA 1IKFL 4QRRA 4XVTH 3MNWA 2E7LA 4GBDA 5D2LA 2YZ1A 3Q9QA 5TPWH 4MGGA 1QSZA 4NX5A 1H3WM 4G8GD 4JAWA 3RA7L 4LFYA 2VLKD 5C0CB 2IMNA 1IM9A 2DLHA 5CJNA 3B8TA 5JDJA 2UBPC 2IANB 4CU8A 4MDRA 3GXNA 3LN4A 5T1MB 4G7RB 3FV9A 2YK1H 2CGZA 2EKSA 2B8OT 1T20A 3ESPA 1BM3L 5ALCH 1PQZB 3BO9A 5FEBA 1S7TB 4NERA 4DN4L 3NACH 4UIMA 3QO1B 4YO0A 1AG1O 4P2QD 4KEUA 4RGNB 4UOJA 3KTXA 5F3BA 4DJDD 4GYFA 1ZLSL 2ANUA 4Q6KA 3QFDA 2MQ0A 1VZHA 2XIOA 3M7OA 1NICA 4MRCA 1YCSA 4D2JA 1UP0A 7FABH 3OB8A 4LOVA 3ZE1E 3CNYA 4GZJA 2JB5L 5CZXD 4P8QA 1F02I 3W9DA 2O6PA 1B0RA 1UZ6F 2LVEA 5IW1B 5IREA 5EF1A 3EOBB 1WB0A 3KJ4B 4RK8A 1BXAA 3DPBA 3UBFA 4EIUA 1YC8A 5I73C 4GT0A 2JEPA 3GHBH 3HI6H 3VI4B 5HI5C 1WO2A 5B7YA 3TVMD 4UC5A 4QG6A 1YXYA 3KVLA 4YSAA 1I45A 3SCUA 5EORL 4MVBD 3A4DA 5T3XH 3QXTA 2PWHA 4GUIA 1GZQB 3BUTA 1OFOA 2EIJB 3TN6A 4TUUA 3R8BB 3Q0HA 5AZ1A 1OE3A 3R7QA 4HQQH 3ALPA 4EUPG 4G6AC 1VKFA 4C47A 4U49A 4MFDA 3C0SA 2Q86B 3HB3C 4QRRB 2XTSA 3WTYA 4L4OA 3MNWB 2X40A 3NEEA 5D2LB 3BPCA 3QZPA 3FVDA 1FWCC 4IRJC 2WLYA 3WD0A 2EO1A 2WMPA 3N06B 4G6MH 4WKFA 3KDPB 3LZOA 4JG9A 6XIAA 1A9EA 3G5ZA 2UUDH 1IM9B 3LZRA 1P0SE 2J2ZA 1ZXKA 3DO3A 1IT9L 1MJ8H 1TOXA 3FJTA 3LN4B 3NCEB 2DWDA 2WQAA 3EZ8A 2BVOA 1MW1A 4WTZG 2EKSB 1LT8A 5SWZE 4WO4C 1N8ZA 5CBBA 4H2AA 1EHLL 3MXWL 2WMFA 2OW7A 4MKVA 3B0UX 4UIMB 4V1DD 3O0RL 6PCYA 4OI8A 1URIA 5BMWA 4J39A 3GNMH 4YO0B 4XN2A 4XSLA 4C6BA 4KRPD 2HN7B 5D6DA 4W89A 4NP4L 4FR1A 4MS8C 5F3BB 2EF9A 2AMGA 2ZXDA 2V6AA 4KQ4L 3HUJE 3QFDB 4OZHE 4UQEA 1JL8A 5FK9B 2W80C 2DMHA 2Y7NA 3HMCA 1OCBA 3GZKA 2YLLA 3RN6A 4L8BA 4UTWA 3QRBA 3BWUF 1DN2A 4EI6A 1P6WA 3W9DB 4ZQMA 1B0RB 2C79A 4HVBA 2H8ZA 1HE7A 3MY9A 4F2FA 4IKIA 3DPBB 2C6QA 4RNIA 1QW7A 3W0WE 2OELA 4HCFA 3BH8A 3SFKA 5F7HA 2BDNH 5DJDA 2VXTH 4PJXF 2GIXA 1GOHA 1OTTC 3SDXF 1KG0A 5EEVA 2CMRH 1JK8A 1E6SM 2Y8KA 2ZXBA 3I6TA 4J5VA 3ITTA 1VEOA 1XH3B 4ZQPA 1OGAD 3S3CB 3IXAA 1NBVH 1PZUB 2X87A 3JXAA 1NFGA 1RV6X 3CFCL 2X44D 1ND0A 3BIKB 1PY9A 3P8IA 1PBGA 1S8DA 4LVDA 1ERNA 3QMRA 3PS6A 1VFBA 3MV8D 5A6BD 1RIVL 1HKIA 2VXSL 1FFQA 3BPCB 2WZPD 2FYMA 3GK8H 2NVDA 5E8EB 3DKHA 1PZAA 2KDYA 4PBXA 1U3HD 3NPSC 1T2QH 2WMPB 1FDZA 5AVXB 2QV2A 3P6LA 1B0WA 2PU0A 1A9EB 3SBQA 3G5ZB 4FF5A 2J2ZB 4AZCA 1Y5XA 2P52A 1Y18A 4YVNA 3BUPA 2DWDB 2BVOB 4N0YH 2FLRT 3AMDA 1N8ZB 3KYKH 1UYWL 4MMZA 3NQDA 3K0YA 3TNOA 4IK6A 5BPPA 5AD0A 3VXSE 1HHGB 3V5HA 1QWHA 4FL4C 2LHAA 4C7DA 3OJDA 3FUEA 1T83C 1BLIA 4LLYA 4DWHA 5CZVL 1LP9E 1ZVSA 5K9JL 4X99A 4G1NA 3RRAA 3MJ9A 3AB0C 1A1OA 1XGYL 4L8BB 4JTCA 1G0CA 2WCPA 1AQMA 3P5YA 2H9AB 4B95C 3ATYA 4EI6B 1UACL 1J12A 3MLRL 5I7GA 4HNTA 2NNCA 2M2DA 2H2SD 2UZPA 3SGKC 5TE4L 2HH0L 3MNZA 1EO8H 1TV2A 3W9EA 3O1NA 2AMXA 2X1PA 1AANA 3C2AH 4HHLA 1XYAA 1DO6A 5I17A 2FB3A 3BH8B 5C6TH 3OWEA 3S96A 5C9JA 2PSNA 4WFGD 5DJDB 4KHTH 4HN8A 5I1CH 2QPXA 2D2CC 5IVZA 1VPOL 4CJ0A 1KG0B 3LDBB 1RA5A 3LQAC 1JK8B 3GG0A 3EEZA 4H88H 3ATBA 4IOFC 3CVDA 3MWAA 3IXAB 3UJFA 4Z7OF 1ZRUA 4LVFA 3L9EA 1S8DB 2R9HC 1QO3A 4DF2A 3REQA 4OCXL 1EWHA 1GTEA 1P6AB 1VFBB 4GUJA 5HHPB 4PVBA 3N41B 3PREA 4HMEA 2E4TA 2X4PA 2Z1XA 5DDHA 1W1A1 3NQVA 3PXHA 1E51A 2HUHA 3NCCB 1ZLDA 3QC3A 1ECEA 3HAEA 1EFQA 1D5XA 4B27A 3FZUD 4PRIE 1AZUA 4DH2A 4AH2A 4MUPA 3O4OB 4AZCB 3KHJA 1GEQA 1B4JH 1Y18B 4OBTA 5FF4A 3HAEH 3GMQA 2DQTL 3TS8A 5EA0H 1EX5A 4CUCA 1TJ2A 2NY3B 3F04A 4C90A 4BSVA 4MMZB 1UC4A 1PZ1A 5KVFH 2NY5H 4PJHB 3BKJH 1JSYA 1E8ZA 1XQLA 1TG8A 2PDUA 3AJXA 1TSHA 2DYPD 3ULVL 3OJDB 4RGNC 2XX1A 3N42F 4LLYB 2FNBA 3L5HA 5FM5M 4YK4B 4NQCE 4J5NA 4J6IA 4TNFA 1Z0NA 1ZVSB 1F1DA 4Y1AA 4X99B 1XZWA 2ACUA 5REQA 4DJFA 3IBEA 1A1OB 5JHDE 4JRLA 3FN3A 1RZKH 3V52L 1Q85A 1UR0A 2ORBL 4U1HA 2XKSA 1NDMA 3MFGB 3MNZB 4HHWA 4IRZL 3W9EB 1J6OA 2J7CA 4ZMWA 5I17B 3KBHE 3RVUD 4MAUH 1JOIA 2CZFA 3V75A 2IPGA 2IQDA 3P0YL 2DIEA 3S96B 5C9JB 5ACMA 3P1VA 5IVZB 2QADD 1A0CA 2P88A 3EDJA 2BP1A 3O63A 2HG5B 1SEBA 1SZEA 5DXXA 4JO4H 4KBPA 3NM1A 5DD0H 3K1KC 1OD9A 3HPXA 1BMWA 3VDCA 3USZA 3VW3L 3IXTA 3LB6C 3W71A 4FTVE 2JGYA 3CV6A 3ZT5A 1YDOA 5D5ME 4LBAA 1QO3B 3PN8A 3REQB 4C5YA 2BFVH 1BVZA 5IJCC 1ACXA 1BQHA 1MPAH 1O12A 4APQA 2MSPA 2E7LC 3P9WB 4ZQTA 1UD3A 2X4PB 4OW6A 4GO6B 5DDHB 5CR8A 2HRWA 2AABH 1D5XB 1M05B 4PRNA 1OFAA 1F7BA 4AH2B 3TLQA 3ZE2B 5H94B 3T07A 1MW3A 3SPVB 3GJEA 3LQLA 4NOBA 1RH8A 1PEZA 3RAOA 3DI1A 1MSSA 4A35A 1R46A 3GMQB 4MHHI 1T1XB 2B7PA 3BJSA 4KRUA 2YXXA 1MCOL 3O6ML 4BSVB 2FLIA 3NCYS 2GJRA 2WGXA 3D9AH 2CLEA 3O81A 4EIGB 3IIZA 1SVDA 4OV4A 1UM4L 3GY1A 4R4BA 1S9YA 4BELD 3L95A 4M19A 2NNXA 2VZ3A 1PYMA 2VRJA 4NWUH 4YVVA 3BPWA 1A6VH 1CL7I 1OAQL 4GQZA 5CF3A 4M3PA 3L4XA 4F9PC 1BJMA 5REQB 1BQSA 3QHZL 3RQ3A 2VM9A 1X38A 5J06A 3UYPB 3BXWA 1GEHA 4PGZA 2QQNL 2CLZA 3CHQA 4U1HB 5KEZA 4FPSA 5DLMH 4DN1A 4L6HA 2UZIH 3DMMA 4XZBA 1NDMB 5ABFA 1QRQA 5EZLB 3FDWA 3OEXA 4HA4A 4KNSA 2QVTA 3QORC 3CZNA 4C6JA 4N7QA 3UO1L 3ITCA 4B9PA 2EBNA 4G7VL 1VKXA 2F1BA 3ZDZF 3PBMA 1X5YA 4PC8A 4NAJA 4KBXA 4OD1L 4H7CA 3ZIMA 3WDHA 4MBOA 3RO6A 2OLAA 3P3SA 1SEBB 2MOGA 4ZMTA 1NLDH 1I3RA 3IXTB 1WS8A 3WEMA 1PTDA 1TTPA 1J1PH 4QEEA 2UWFA 3LXBA 4ZB0A 2EJ1A 3KBEA 3ZQ9A 1J1XL 1ADDA 3FEMA 3X1BA 3QPKA 2FZBA 2Q6ZA 1BQHB 4APQB 2R4SH 3PB2A 2J74A 2AKZA 2NW3A 5IBUB 4FKKA 2DQCL 4JDTH 4PRNB 1S2CA 4LSUH 4MJMA 2O5YH 3M0IA 4F8LA 5BVPL 2DORA 3DX5A 3GJEB 3O6AA 3KMDA 3QJAA 1J5TA 5J1AB 2DSZA 3B7YA 1QLRA 4UM9D 3P67A 2PE4A 4EIBA 1BX2B 2Q71A 1BOYA 4ZFGL 2XQ0A 35C8H 1LK2A 3HBPA 2CJUH 5EPDA 3N3MA 5BOOA 2Y2TA 4PB4A 3W7DA 3WKPA 2GVYA 5ADOL 4FXTA 4I0PC 2M26A 4GAAA 4R4BB 1S9YB 4NUPA 5D09A 3L95B 3NCOA 3RX8A 5C92A 4OUUA 1KTKE 2WLIA 5DJ2A 4WI9A 1KFAL 2V5TA 2IH9A 4PMZA 4GS7C 1QKZL 3SO3B 4RNRA 3BSGA 2V81A 2ZJSH 1W1B1 4EK7A 4QHLA 3TC7A 2XZCH 3ETBF 1JJKA 2VHLA 1GAFH 5JOPE 4JKKA 2CLZB 3UZEA 2DEWX 4GQQA 1TFPA 1OVZA 3DMMB 4N6RB 2WQUA 5IVXE 1RURL 4ZZFA 5T1KD 6PTDA 3AROA 3EMQA 4Y4HD 1U8JA 3TK7A 4MJ5A 1QNVA 5AOUA 4DPCX 1W37A 4R8WH 1XG4A 2YBRA 4G6JH 1TZ7A 5DK0A 2AXWA 2G2RA 1LO2L 4HHHA 1ZB5A 5DRXA 3S5ZA 5EOTA 2CRZA 3LDBC 4XP5L 3X2QB 3TEVA 4LEQA 4FE9A 4R53A 3LY6A 4RRPM 4S23A 2ADGA 1QZNA 1I3RB 4ES8A 1ZHBA 3CK0H 4LRIC 5SV3A 4OLXH 5ISZE 3WTTA 3GT6A 4Q9QL 4IIQA 4X3ZA 3DIPA 4MUZA 4H5SA 3FTYA 1KLUB 4ZOBA 2YD8A 2G5BA 5H6HA 4S3CA 1A21A 3V7AG 4P9ML 4FKHA 2I5YL 2NW3B 5J9PA 4N24A 2VC2L 1DBJL 2OOGA 5DRCA 3FT3A 3NA8A 1X1NA 2K9FB 3MDJA 3S1UA 5BZWB 3L6FA 1ODZA 5M1TA 3O4OC 3C60A 3GC3A 3T0BA 4X5PA 1D5BA 1PKQA 3VINA 3IMWA 4P5RA 4JREB 3APMA 4NEHB 1FWAC 4ZOCA 2JVUA 1WIOA 4JY8A 2VQTA 4PB3A 3ZTCC 3O3BA 3CMOH 3VFRA 1JCVA 4J2QA 4JPSA 1TPUA 1W5MA 2BSRA 3CUXA 2Y7EA 3VGAB 5ICZB 4DGIH 3KPLB 5E6YA 4OUUB 5CPMA 2WLIB 1OC6A 3E2VA 2YSSB 1PZ5A 5DJ2B 4HKBA 1URZA 1F2XK 3VFOB 4WGVB 5JHMA 4HJSA 2ZQ0A 2BHZA 4RNRB 4Z7NF 3EOYG 1EDHA 4QHLB 2J71A 2YGQA 4CBZA 1OP3H 4KUZH 3WXWL 4AQ1A 3OHIA 4UANA 3BV4A 1ML0A 4H6QA 1GZ1A 3NTCL 4ONHA 4F58L 1TG7A 4PLOB 3OG2A 3QPXH 1FN4A 3BKML 1MFDH 2J7HA 1FO0H 3K6IA 1U8JB 3WYZA 3OSVA 4MJ5B 1U8PA 2XFYA 2YCLB 5BXRA 5DN1A 2YBRB 3UU0A 1AZVA 4UILH 2G2RB 1G7UA 5DRXB 3LPPA 3A6BH 1AVAA 2Y89A 4YHZH 4I89A 3VC6A 3CO8A 2HFTA 1ZLUK 2ADGB 1H09A 5IB4A 4E9LA 1Q3NA 1W3NA 3ARXA 5JW4M 3TU6A 5E2TH 4FF7A 4BCYA 1T7ZA 4Y4FD 3UTSD 1BVWA 4H5SB 4UFIA 5LGJB 2G5BB 4YWGL 3NEHA 3VXUA 2ZIDA 4AYGA 1CDYA 4GYPC 1O66A 1JVNA 3AUVA 5AW2B 4OM0H 5J9PB 2OTWA 2Y22A 5HHME 2ZXQA 1FWRA 4WGWB 3SQSA 1EBPA 3FT3B 2XIIA 2O5ZL 3SGJC 4NZFA 1B3WA 1W0VB 3ONBA 3L6FB 4AGOA 1SFTA 2BOFX 3C60B 4MX7B 4Q6IC 3NTYA 2LV4A 4UUJA 4CKQA 4RNFA 5AB1A 1D5BB 1PKQB 2NY5C 6CGTA 4RSVA 2QSTA 5FF2A 4CNIA 4AQAA 5D02A 4H9XA 2RHGA 3VFRB 4KXZI 2XFWA 1EERB 2VEGA 3DJTA 2BSRB 4DJED 4GKLA 3U57A 1XEDA 5CN2A 1RZMA 5EOCJ 3WL9A 5HNUA 3DHMA 5BW6A 4BEUA 1E73M 4YTRA 1PZ5B 3CQ0A 4ODHH 5XIMA 4MLJA 3G3DA 1RZKC 4AYDC 4FALA 2K4AA 4HUMB 4PFHA 3DHJA 4DJFC 2CFFA 1FP8A 1PG7X 3A5VA 4NVTA 2C9RA 2Y5SA 4AQ1B 1B5TA 2ZRZA 3PF3A 4R3SA 3GPSA 2QQLL 1FG2A 1GJPA 4KPHH 4ONHB 1IAII 3U9WA 5IVOA 3DEQA 4HT1H 3TIDA 1OD8A 3FU3A 1JPGB 2OKTA 2A4EA 2ZG2A 1IQ8A 3QJSB 2PP7A 1RJZB 5ICUA 1NAL1 1IZKA 3VGDA 5ADPH 3ZVHA 3UCCA 3O05A 4EUPA 3CHXA 4HUWB 2RD0A 4D8OA 1ASQA 4HIEA 3NXLA 1R75A 3RWEB 3H4HA 3AALA 4Z0XA 5JPNA 1X5FA 1SNRA 1PKMA 1TKKA 5AYUH 1E7VA 1EJRC 2GQAA 3F7PC 3V95A 1FJ1A 3BT2H 5IB4B 4P07A 3RJXA 3POHA 4EUPH 3WQWA 1DBMH 3UWVA 2PXYC 4AAJA 1KJVA 2WC3A 1HINH 1TPB1 4J7RA 1NWOA 3NL5A 4UCGA 5CQ1A 4H0IA 4FZEL 3VXUB 3VG0L 1L3NA 1UR8A 4APQC 3P02A 3QK0A 1RMFL 2OTWB 1G9EA 1HQRA 4WTZA 4LPWA 2FTWA 5FF7A 3GRIA 3EXLA 1GY2A 2TAAA 2XZZA 4D0BB 4F2ME 4OZFG 1V7YA 2EXWC 2BTMA 1MFCL 4UUJB 4AQZA 2GJPA 5AVYB 4J4KA 1UA3A 5GZNC 4KVNL 2V7NA 5JOFB 2QVHA 1O7VA 2XBDA 3EX3A 1I2NA 3HC3H 4CNIB 1I7UA 4AQAB 3OGOE 3RX5A 3WL1A 3IJ9A 3O41B 5EC2A 1XGDA 1DVXA 2C34A 4DGYH 4WEEA 5GGVH 4O2CA 5C07E 1FL5B 5HDOA 3KCOA 3VQ2C 3WL9B 2H8XA 1FORH 3CH0A 2ITDA 4S2BA 5FM8A 5E2UH 2AQSA 4B3KA 5DHDA 4KZEH 1I85C 2N56A 4P06A 2B59B 4FJ6A 4M1CD 1JDEA 1H0DA 4GW4B 4MJZA 4BR1A 3IACA 5DZPA 3AWEA 2Z31D 5CLTA 1YNKL 3S1VA 3TPUA 4WJKB 3SGUA 3JWDL 1UWFA 4PHZA 3ORWA 4B5TA 4YS1A 3UJEA 2Q8AL 3EGSB 4OCSL 4R3SB 5CSZB 3V0AC 5JIWA 2V82A 3TZVD 2AGTA 2XTJB 4I7UA 1NP2A 1T0PB 3TIDB 4XAFA 4OCWH 5L88H 2VMFA 3HQPA 3CDFA 3BPOC 5L7XH 3N9GH 4KKCD 1QUMA 1ISVA 3ZVHB 4HJ1A 4EUPB 2X1QA 3M4HA 1MY5A 1L7TL 5JDSB 4HIEB 2YYTA 1RSYA 5EKYA 1FVPA 5DUPL 1N0XH 3OJMB 4YWIA 4Z0XB 5JPNB 4DYKA 1ML1A 1FJ1B 2QJGA 5IROD 5AZEL 1LZOA 1B9KA 2XY2A 3K0WA 1JGUL 4PEEA 1KJVB 3V4UL 3WO3B 1PNDA 2ITCA 4F33A 5AKQA 15C8L 4G6KL 5HULA 2XI9A 4K8RD 1PD1A 1QA9A 4PJFE 1UXSA 3RYMA 1W9BM 4IF2A 3PC0A 3PZNA 3VA8A 4QTIH 2OZ4L 3F7LA 1TJ1A 2K8MA 1OCWL 2WKGA 4TL4A 1HQRB 1Q8JA 2HT2D 2NXZD 4HUVA 2W07A 2NQZA 4AQ8A 3JT0A 2W92A 2X1WL 2XWRA 7XIMA 4XX5A 4ELMF 1PY4A 3QV9A 4G71B 1YYML 5FJJA 5JQ9A 3TIEB 4L3CB 1EZLA 4C4UA 3W3BA 4FXSA 3UY7A 3KAAA 2DQGH 3CH8A 4JJ5A 5T5FL 2KH2B 4UAHA 1YA5A 1GGUA 4XVUC 4BH8A 5I74B 2V7NB 2V8ZA 1O9ZA 1NDVA 4JREC 1T3FA 1I7UB 4EF9A 4GXVL 2Q3OA 5D8JL 4MB5A 1KV3A 4QD2E 5EC2B 1SZNA 4C91A 2AQ1A 1A3QA 2NWSA 1SMAA 2BX7A 2TYSA 2X2HA 4O2CB 4B3LA 1X4YA 4WW2C 2ITDB 3CO4A 3STEA 5KSAC 3EX6A 1TTBA 3WQ5A 3ZBMA 4J1UB 3AIRA 4M62H 4B41A 4KZ0A 5CCJA 1OEPA 1LO0H 4G5DA 1JDCA 1TQSA 5GQBA 3WCYA 3G6MA 3UXKA 3TPUB 3D87B 4QDPA 3GUTA 5TQLA 3WQVA 4A7TA 1U83A 4IRJA 3IGXA 5FIEA 1OYCA 4P7QA 5GJTH 2IGFH 2JALA 1WCBA 4DLMA 3QW4B 3DHPA 1CQYA 4E41A 3GXTA 2BIQA 3OA3A 3B4YA 2V2HA 1SEQL 5JLZA 2DW7A 2WNXA 3GQFA 2FSDA 3J2PA 3IAQA 1ZGLM 3ET9F 2WWMC 3V5KA 1QSEE 4PD4K 4HSAC 3K4DA 4INFA 4PJ9A 5JW4N 1R3IH 3MVTA 5T26A 5CC5A 3TJXA 4XNXH 4P46A 2WBKA 2Y07L 3S9DB 1BWWA 1DQTA 2FJGA 3LRMA 1WX0A 4F33B 4S3EA 4IIQC 1QA9B 5BUPA 1UXSB 1KB5A 2GSHA 5FYLE 1Z89A 4JFED 4OIBA 1K8YA 2VENA 1DYZA 3BG9A 1FLRH 5INCA 3GDCA 1ZT4B 5HNNA 3WS3A 3RX3A 3V9EA 3TN0A 5I8KH 3AU2A 4HUVB 2W07B 2BLFA 1MIMH 4UQIM 1CYXA 4R26H 2XV3A 3NJKA 3FB6A 4BWTA 4JG1L 4ZQKA 4JX6A 2E40A 1TZOA 2VN6A 4JJ5B 2Y2YA 2AQTA 4BH8B 3T3MF 2JKNA 2RAMA 2DKSA 3B40A 1E6ZA 1T3FB 3FT1A 3MXVH 1E43A 2V9RA 3TYGL 2HVMA 2PPDA 1GOOA 2TRYA 4DI9A 2XFXA 3QO0A 3DBPA 4WKHA 3VFCA 2HLEB 3PNRB 3WFBH 5KBMA 4I85A 2NWRA 4KU1A 4B5XA 3PDGA 1B57A 1Q7ZA 1RZ7H 3G6DH 3LN3A 1JK9A 3HB3B 2C9SA 2IH1B 5J1TC 5BJTA 1AO7E 3RVTD 3S9ZA 1OSPH 1F3TA 5BZZA 3VOCA 2V8MA 3GUTB 4X9IA 3V0UA 4FI8A 4IRJB 2KQMA 3NURA 4WUUE 3CFKA 3TQVA 1T22B 5AKTA 3GH7A 1WA1X 3NABH 4AQ1C 1A0DA 1WCBB 3NPWA 1KCUH 1FP5A 4UV4L 2ALWA 4E41B 5EMLA 1EDQA 3BLLA 5H8MA 1NC2A 3F65A 3UZWA 2E9GA 3VDBA 4LVOC 1L9RA 3BKYH 2EKGA 3GKWL 1XR2A 1EZUA 3WTSA 5F96L 2F38A 3O8XD 4NZRL 2EVJA 2CD0A 2NXIA 1XLHA 1AMYA 2ZSVA 3B8WA 4PJ9B 4Q6YA 4OCRH 3UZXA 2VFDA 3QULA 1GYMA 3NZSA 1T83A 1ASOA 4YIWA 3UPRA 3BGJA 2FJGB 4TSBL 1NCCH 1KB5B 3BZFB 3MLSL 1QOPA 4H8WH 1TVNA 3DENA 2VR6A 1UZHA 3M17B 4KXBA 4N0CC 5TE7H 4IBSA 1I9CB 4WI2A 5INCB 1FPTH 2RDWA 2GDQA 3BN9D 2Z29A 3TN0B 5A3ID 1TYEB 3VSQA 2BASA 4ATWA 4IX0A 4BQ3A 5FDWA 3HBGA 4LDOB 3FB6B 3UBPC 1KPUA 1HN1A 4ZQKB 3NDZE 4H20L 5F71A 2ADAA 1VENA 4M3JA 2VO5A 4BZ1A 3G22A 3QRFM 2BWIA 1JBJA 3B06A 2A0LD 2VCOA 3N6YA 1A02N 3WD1A 4P5KA 3E5PA 2H45A 1XX1A 1UWTA 3AHVA 1XUUA 3FU5A 2OP4H 5E94A 3CSBA 1ZV2A 3QO0B 3U4KA 2XZQH 2BNJA 4BZ1H 5B4MC 3VXMA 1GPOH 2MWCA 3OZOA 4DX3A 3D39A 1XYCA 1BQCA 3BV7A 1NMAH 1Y7VA 1TT6A 3DC8A 4NP7A 4EZKA 1ZKAA 4ZS6D 2FX9H 3P82A 4DBEA 1P69B 3WH8A 3CQPA 2OAAA 2IPUG 4XTIA 1JK9B 4Y89A 3OP2A 5G1TA 5F7EL 2G60L 4AQOA 5BJTB 2FCBA 3QHMA 1NDWA 1N6QH 4N25A 1CTOA 5DFVD 1D7CA 2QEJA 3NPSB 3LM3A 5A43C 3CFKB 3GD1C 2CW6A 3ZHFA 2D0HA 3UGVA 2LAAA 1YNQA 4IQLA 5KYWA 2KL6A 4I9AA 2XTJC 1G4SA 2FDMA 5LDUA 4U4BA 4JPQA 2YXVA 1J0ZA 4OGQC 3L0GA 1AC0A 2TSBA 1WRFA 5HSFA 2FK9A 3QEGH 4BWWA 3JTTA 3URQA 1W32A 2ZSVB 2XG5B 4K0OA 3PHQA 4L1LA 1AA1B 5CEZD 2TRHA 3QULB 4MMYA 4UV7H 3VXRD 2WSQA 5CGYD 3S48A 3EGXA 1RUML 3LK6A 3WMBA 1KBWA 4KI5E 3RF9A 1TJIL 2ED9A 3AB0B 1MFAH 1LWJA 4X9GA 1P4BH 1W6WA 3ALWA 1KMGA 2DD8H 3OAZH 4JPIB 3RLHA 1ZT1A 3BP7A 2KLSA 3O6DA 4IJBA 2YKKA 4NUQA 5GRJH 2A5HA 4F1ZA 3PAUA 1BQLL 1DJHA 1TZ9A 2OQHA 4HCLA 4X6CA 1ISXA 1OF8A 3VQMA 1GIGL 4AVKA 1XKJA 3UGEA 4PLKD 1HCFX 4P5KB 5I5JA 2R8SH 1Z9AA 1DE6A 1F8TL 1OFDA 4YS4A 3SKNA 2VH5H 4CCEA 2PDXA 5KYXA 3P11H 4HXBL 1K3ZA 3UJIL 4Z7UF 4H2HA 3VXMB 2EC9T 5ILTH 1DXIA 3D39B 4L1TA 3LCYA 1V6UA 4WEBH 3KEDA 3QR0A 3ZLGA 4F8QA 4PCYA 3EB3A 2NTSP 1JZ7A 3ZFHA 2FWSA 2PP9A 4EPEC 1I7TA 2AKMA 3KPSA 1XBVA 2HVOA 3OJGA 5DJXA 1DTUA 1NSJA 2BB0A 5JHBA 2Y9RT 1R7AA 3KVKA 3W29A 3S35H 4JM4H 5FO8B 2ICEA 4KROC 3CZSA 4XKMA 4L4JA 4Z08A 4ZQRA 1YDPA 4G8GE 2D31B 5KYWB 1TPDA 1F5ZA 2DQEH 3T1GA 2VLKE 3B03A 2C91A 1KIPA 5DVLA 1VDGA 1HKMA 3M0KA 2OCCB 1WUEA 5T3ZH 1N8IA 1XVSA 1DQML 3T4CA 5EWIH 2DP3A 2XIDA 2FTAA 5I1HH 3LCFA 1A14L 1F1GA 1KWGA 2JELH 3PHQB 4MMYB 3L5IA 3U1SH 1B90A 2CXGA 1Z69A 4P2QE 2Q3XA 1XD1A 2V17L 4BINA 4NO2A 3EGXB 2WV8A 4F9PA 2GI0A 4M93B 4IU3A 4HGWA 4ZMAT 2L5HA 1N12A 1XKYA 1ZT1B 4YE4H 5DJ0A 4N28A 1XAKA 1T4KA 1NARA 3P0GB 1A22B 2F19H 4P8UA 4FABH 3RU6A 2E7MA 3A9IA 2CE6A 1MCCA 1FOBA 2PDHA 4NQEA 1VGEH 3W7QA 4DKDC 1TDQA 5FPIA 5DS2A 4AQ8C 1LQAA 3T42A 4V2CB 1J18A 3WY4A 4L1SA 3NJIA 4X6CB 4QOKD 5FO9A 1QT1A 1QFWM 3QORA 3UFYA 4PULA 4JN1H 2ZZ2A 3L12A 4UMGA 4IKLA 4H25A 4QROA 5C0EA 5BMFL 5HHXL 4P8WA 1IC4L 4UBDC 1EA0A 2GVJA 3SKNB 5KYXB 3MUIA 3D2UB 1XCXA 4RSYA 2X9ZA 3V4LA 1F6LL 2XWTA 5JMOC 3BHBA 3PXJA 4EF3A 2DZUA 1I4NA 1Z3GH 2JI2A 1SM3H 3M8OL 3A5FA 5I19L 3P3TA 1UD4A 3SSZA 1TUPA 3BLFA 4U1LB 3T7VA 4IYKA 1I7TB 1YEGH 3MBWA 4C55A 2BZDA 1PWMA 4R4FL 3RJDA 4OJDH 1NP0A 2PMQA 1QPOA 2Z7WA 1J86A 5DJXB 3VXQA 4Y9FA 4FZ8H 1DVFC 3VFGL 4KQNA 1HJCA 3MRBA 1K2DA 3KS0H 1OLLA 2ZG3A 4FC3E 3WFDL 3ZDXF 1YDPB 4QG9A 2XQYK 4H00A 1LO3L 4M3KB 5T5NG 2IDUA 3EBVA 1OK0A 1KIPB 1A64A 3HMXA 1XXDC 4CQBA 1S5TA 3RU8X 4PMFA 1TVHA 1T20B 2ZZ5A 4HIIA 4PD4J 2O4QA 4YHLH 1F3DJ 2VFEA 2XKNA 1KTDA 3VOJA 3UBXI 4M1RA 3LD8C 3KEHA 3CZLA 3EOLA 1AJ7H 4G72B 3UNTA 1HOCA 3HMXH 4I0PA 3M41A 4PJ9C 3QI9C 4P61A 4V1DE 3WH7A 4AITA 3MP5A 3UXDA 2CHZA 1OT4A 3RIFK 4K38A 4GAYA 4FFVC 4GSXA 1HFUA 3W1XA 4P46C 4NO2B 4DWSD 3ZYZA 3EEGA 4IU3B 4HGWB 3LMJL 3H26A 1YY9D 5CZKA 3I9GL 3DBSA 5DJ0B 2D3NA 3GI9L 1T4KB 5E6UB 1TJXA 3CBKB 4NQEB 4CGTA 4RGOH 3TN0C 2VE6A 4QR7A 2A7BA 1OANA 1DBKL 1KFJA 3ECWA 1GJWA 5FO9B 3QORB 3IDJA 1JUKA 3SPGA 3CX5J 2CWNA 3SCMD 5HYJD 1MG2C 3V6OE 4A05A 1KY7A 3PWAA 5GS1C 2PDBA 1X1OA 4WLCA 3OF6A 4D9RD 5CC7A 2AJUL 4JKPH 4Z1CA 2BHFA 2PGRA 5GGUA 4WENB 3IGLA 3NL6A 5B39G 3NA9L 4LRIA 3WE6A 2XWTB 2ENJA 1MI3A 3W76A 3BHBB 3ZVIA 1OGAE 3WHE0 1G9HA 2BP8A 4O9HL 5DURD 4YEEA 1EJOH 2W9EH 2QPSA 3MBWB 1UIOA 4PJ5A 1FBIL 5E5LA 5D72L 2H3DA 1RPUA 3MV8E 3VXQB 1EZVY 1TREA 5F8RC 2APBA 3MRBB 1K2DB 1WAAA 2E8ZA 3FUNA 1INDH 5D7HA 1YC7A 4BEIA 5C2UB 4V33A 4LAUA 2PTTA 2I7OA 1N5YL 2DTSA 3DARA 4XHJD 1TVHB 3F7RA 1GGIH 2XKNB 4PJCA 1KTDB 1MRDH 4I3SL 2OT1A 3QW3A 1KTJA 2KI6A 1HOCB 3CXDH 4I0PB 4ZAKC 4AQLA 3B2PA 3B9OA 4PW4A 2BINA 3TLRA 1BFOA 4H8WC 4GAYB 1HC1A 4CN6A 1D2OA 3A24A 4A8NA 4GS7B 2IPWA 1JGVH 5C0RL 4DZIA 2YXWA 4U0RB 4AV4A 3GFZA 1ME8A 4OZFA 1LJMA 2WMKA 5BW7C 3TTOA 2EVIA 4GLRI 1HZYA 4PBFA 5DQDL 3CV1A 4HHPA 2Y23A 1E3FA 2VE6B 5FKYA 1MQPA 3EFFA 1Q72H 3Q2DA 5I1EL 4OZFH 2NY0B 2EINB 2CESA 4JZNA 4LKCA 1V0KA 1U8IA 3TYDA 5LUMA 3FQRA 1MCPH 3IDJB 3DX3A 3IUHA 3MUZ1 5FAJA 2B1AL 4WFGE 2GQHA 2FQFA 3IGUA 2WHMA 5KZ6A 1JUEA 1VESA 3JV5A 2VGIA 1RZJL 1LWHA 4KEMA 4GRLA 2YS4A 2C9UA 5GGUB 5E93A 3GHSA 2FBJH 1ZLVH 2DIAA 2VABA 4A66A 1S6NA 1ND0B 1P4CA 2BP8B 2B7OA 3B9NA 1L6WA 6ALDA 3WEXA 1S7XA 1KV7A 1MNSA 1PKOA 4GYPA 4UQCA 3LCIA 4CDGC 1THAA 5BNXD 1BQGA 2P42B 2GTWA 4UT6L 3SGJA 3L4WA 3F12A 5BS0A 4KY1H 4F92B 1TZGH 1N68A 3CL6A 1IT0A 4Q6IA 1J8HA 4PJGA 4XWGL 4YGAB 3PDOA 5KJ7E 3FT9A 1LL6A 4JHMA 5K9QI 4G70B 3G6JE 3G6AA 4AMXA 2QAFA 3CXHK 4JR9L 4I8DA 4PJCB 5K69A 4EXBA 1FWSA 5H35A 4CQAA 2P48B 5GRUH 4FFYL 1CE6A 5AD0B 1IAKA 2ZYIA 1IC0A 3H12A 4L5FH 4XBKA 2A9ML 3BAEH 5E00A 1TZ8A 3V5HB 4AY0A 1BFOB 4V11A 3E0WA 32C2A 2QQQA 1HKWA 4F2UA 1V7NL 4Y7MA 2ATAA 1GCFA 3BPLC 2ZE0A 3PZQA 4S1RL 4C6IA 1IE4A 4M93C 2XACC 4OZFB 4EO5A 4Z3GA 1JG9A 2EKJA 4P5TC 3ZUCA 4X22A 2PP8A 5LBSL 4XUYA 3VXOA 2IKHA 3IPBA 5I1GH 4TX8A 3EFFB 2JKSA 4L4VD 2X3BA 3UTOA 4LKCB 5LHFA 1OZTG 1T5WA 1U8IB 4EIZC 1AC6A 2ZCKH 4M02A 4X5LA 1YN6A 4DO7A 4MNQA 1I2RA 4OH2A 5F1KC 1MCLA 3FQYA 1QHQA 5CCZA 1TLKA 3IGKA 3CDCA 1S3KH 5JORA 3G18A 3FAXA 4IDJL 1SJVA 5KUMA 2ISVA 4LBSA 2PPAA 1A4KA 2VABB 2OU4A 5D9MA 3TCXA 2PXYA 4LLVA 4HUKB 4TSAL 4MCZA 3FSTA 5G5DA 3WIHA 1MIEH 2EIKB 4RAVA 3AWNA 5E2VL 3VSVA 4O14A 5KSBF 3WEXB 1S7XB 3A3HA 4ZB5A 3RMJA 1Q5MA 1OM3L 2K78A 1ISZA 1NCNA 4J3OG 2NQDA 1JV2A 4EZJA 3QBTB 2V30A 1DQXA 3WIHH 3HAEB 3WK0A 2RGMA 1U36A 2AL2A 2CLMA 2ICEC 1IWBA 4AZ5A 1TWIA 4Q6IB 4PJGB 4Q8WA 1E4XI 3PDOB 4KK9D 3T4AA 3E6HA 4B6ZA 5GZNA 3D0AA 3G6AB 1XG3A 5SWSD 3UZJA 3MJYA 4FHKA 4LC8A 3FTUA 1FNGA 2Q8LA 3PBVA 1U8CA 1CE6B 4NZUL 1IAKB 3ID7A 3QSKB 4LZKA 4NHCL 4G8FA 1TMLA 1U1JA 3OLDA 2FPVA 5EUOA 5E00B 4Y9GA 1G69A 1LVEA 1L9OA 5F1SA 3FQWA 3SKMA 1BEYH 32C2B 4E36A 1OAZH 1I85A 2XTKA 4Z2KA 1XBXA 5BV7H 3V0GA 1E1EA 4Y1AB 3QUZA 3CFEA 3VTMA 5JW3H 4DLFA 1Z9NA 3BH4A 4ODVL 1I0DA 2X1RA 4IWWA 2HSIA 3VXOB 1WKYA 4N42A 3TROA 2G97A 1SQMA 5LBGA 3CVIH 3N9RA 3LN9A 1T5WB 1E8YA 3FA3A 4MHBA 1YN6B 3O6LL 1VAHA 3QIWC 3PHSA 3ZDYB 3VD4A 4GY1A 4XAWL 2CYGA 2WN3A 3THQA 1E6RA 1E67A 3GXIA 4WDUA 5JR1H 3TC3A 4UR7A 1N3NA 1OPGH 1OTUD 4IOSD 3F7VA 4CNNA 5JORB 1MRAA 1CG9A 3T81A 3ZK0A 4P2OC 1HKLH 1A4KB 2W9DL 1DKWA 3HN3A 2P10A 2H3BA 2PXYB 4LLVB 3PTKA 4WZHA 4IS6A 1OAXH 3LXAA 3WLOA 5HWJA 2XBZA 3D85A 5KS9F 4RAVB 4LGRB 1HXKA 3NPUA 1CXEA 4I6VA 4CL7A 2ZZ4A 4G1MA 4LUIA 1FWGC 2P26A 2O55A 4LLUA 3ELFA 3QXBA 2W0LA 1NWPA 3KLHC 3C3UA 1JV2B 3VRLE 1GGOA 5IWLC 3MSYA 4GY4A 4D6HA 3F7KA 1UYQA 1AQHA 2ZPKL 2AL2B 5IMLA 5GJSL 1R3SA 3C0LA 1AFSA 5DJCA 1PY0A 4XKYA 2CLPA 4IBUA 3E6HB 3EYOA 2Q6WA 3AQUA 3ZHKA 3UNDA 1DJNA 4U4IA 3T0XA 5CKGA 1FNGB 4S0TD 3DVIA 3ETSA 3DX2A 2OGJA 3NYDA 5A1AA 4G8FB 5EUOB 5GS0C 1HXYA 1XC4A 2GQ3A 4WW2A 5HI3C 3FQWB 5BWFA 4H3DA 2WO2B 3AT9A 4Y2DD 4PWEA 5I1IL 1LXMA 2GPZA 5KSAA 3HR5A 1LOQA 2HLAA 2X9WA 1QWUA 3GSOA 4PP1D 4QWWD 2JKWA 5KTEL 3T9PA 3EH4B 3MUHL 4U0RC 3KBPA 3OKOA 2DJLA 5ECGA 3CC5A 1IM3D 1AH0A 3VVWA 1UJQA 1J5IA 2I9TA 4WRLA 3TH2T 2X0UA 5ABFB 4E42A 4XPHH 3K8KA 3PR2A 3PHOA 2JXMA 5HNRA 1FBAA 1KSRA 1WA0X 1MRFL 1YEEL 2NY0C 3AQYA 1VJIA 1TEGA 5I77A 1RUQH 3LH8A 3L5LA 2G0KA 3V9FA 2CUAA 2QPUA 3L9BA 1OSYA 3BPOB 3D3VD 3AVEA 5CEWA 1VKXB 1EIXA 2GITA 2E9WA 4DBSA 2FEDC 1N3NB 4KMTH 1CR9L 4AG0A 2GOKA 4NO0A 5EN2A 1ADSA 1CG9B 3ZKSD 1Q9KA 4N2AA 1YPZF 4K94L 5EOQL 5F7KC 4DBDA 4XPGH 2Z1VA 4HJEA 2PLCA 2FZMA 4IS6B 4QXIA 3K71A 3P61A 4XMLH 1NCAL 3H2NA 5LNEA 5DZLA 4G1MB 2PRMA 1MFVA 4LLUB 2F54A 3T2PA 1GZJA 1MKFA 1OY3B 3BP4A 5T9BG 3R11A 4JFWA 2DIKA 2XDFA 5LNUA 1RQHA 3MV7A 3IV3A 1XHHA 3CHDA 5HD8D 1X8FA 2IPJA 5IMLB 3NCJH 4R9HA 3MT1A 1NCBL 4LPUA 4N22A 1NANI 1OCQA 5DJCB 4XKYB 4J4PD 4H6RA 4ZUUA 1E90A 1XW8A 2F2KA 1OAUL 3ABSA 3WLIA 3EYOB 4X4ME 1QLRB 4WW1A 5KOMC 2Q6WB 2EDQA 3ZZ1A 2GL5A 3CAKA 4TLSA 3G1VA 1ZHNA 3AOFA 2ZYFA 5EU9A 3N6QA 1LK2B 1IMHC 2WXHA 2DSWA 4AY8A 1UD5A 1R86A 1CFSA 3T6WA 1OX6A 1P1XA 1XH1A 1HXYB 4MJ2A 4WW2B 3W1QA 5DWUH 2XWXA 4K23L 1JYVA 3MLZH 4GNVA 5KSAB 4DBWA 1GTFA 1SYVA 4CQ8A 3HR5B 4TXEA 2HLAB 4ZNEA 3GSOB 3S6TA 4NJJA 2GGJA 1DWGM 5CGBA 1N70A 3EHBD 4ZTPL 1FO0A 3CC5B 4OFVA 1RIHL 2O6EA 3KBWA 1OAKL 2I9TB 2ZWLT 1AGFA 2PGWA 4N6EA 2QCNA 3CFUA 4PI2A 4E42B 2JXMB 3PDDA 1FHLA 4GOAA 3CN4A 4B2DA 1VEMA 1OARL 2FJSA 3LIZL 1S4IA 1GORA 2GEQA 3BVJA 5DK0B 4IK7A 3V0VA 2R69L 2WMIA 4H19A 2GITB 4C59B 4RRPG 2YLKA 5EOTB 2YDAA 4K3JL 4R7XA 4HJJL 4LCIL 4NO0B 5EN2B 5K9OA 4EQ3A 4XMKH 1V6YA 1Q9KB 2V38A 4IIDA 4GRLC 4B0MB 3SCQA 3WTUA 3VM5A 5B3SB 1GTNA 1L2QA 1ZHBB 3UBHA 4Y5XA 4KMLB 1AI1H 1MAMH 4CGUB 5C7XL 3V5DA 4RX0A 5HBBA 1NBYA 4IIQB 1HTIA 3K71B 3BVTA 3SCSA 1GOKA 3G1FA 5EHFA 4GQGA 1FGNH 3MCMA 3UTSE 3OGCA 2F54B 3LVEA 4JN7A 3BP4B 3RDJA 3MV7B 3T8QA 2WYHA 3M0MA 1SGJA 4LVNC 4TSCL 2B0MA 2DZTA 3VWJD 4YDIL 4O4VA 4HA3A 5DZAA 4M6OL 3QEQA 2Q7AA 3JZ7A 4XGZA 4NWTH 4XCYA 3U7WH 1DL3A 4ZUUB 2QCHA 2VDKL 1AQ8A 3M1BA 3CXHJ 3HKZA 3RKDC 3UCDA 2NZ9D 2MCPH 3NGFA 1MVYA 3BPNC 3THUA 4H8PA 3F6LA 4XNUH 4PS4L 4C6EA 3SN0A 3O3BB 5I1LA 1IGIH 4ALDA 1Q9WA 4LSSH 4X8JA 2OV0A 1CFSB 5U7SA 2PCFA 4U1JA 3QCTL 1JDFA 4ERIA 2DBJA 4NPKA 2R29A 4N1CA 4D7BA 3FSZA 1SYVB 3SDCC 2VSDA 2WD0A 4RE3A 4HKBB 2B5IC 2Y7MA 4HDIA 2GVLA 3AG2B 1D9KC 1NQBA 2ODOA 1SRDA 2YLAA 3UWZA 3UJTH 2R29H 1XB6A 5EZOL 1FO0B 2QDHA 2YOCA 3LEYH 4F24A 1M9SA 2DQIH 3HPAA 2XHNA 4EAEA 4HNNA 4QHRA 1KEGH 1FN4B 4MLSA 3TKFA 1XFPA 1LLOA 3HE6D 4PCKA 4R34A 4PJAA 1UT9A 3BKCL 4LVOB 4JY5H 1U8PB 3HPLA 3V0VB 1WOAA 2EPLX 4IKNA 2IOOA 1S5IH 1I8JA 3I50L 5FYKH 3IDUA 5K9OB 3MO4A 4NKIL 1TITA 4LAQH 1A4JA 3QPQD 1PD6A 5ESAA 1SR0A 2GUOA 4FLSA 2OK0H 4N2HA 4Z18A 3RK8A 4YSRA 3V5DB 2YDRA 3BZDA 4R5VA 5C09A 2YZRA 4K7YA 3A4XA 1RLCL 4MY9A 5EU3A 1OZMA 3OGCB 3V4VH 3KOWA 1BMZA 4PLNC 2G37A 4OQVA 2XN2A 3WDRA 3T2OA 2RDUA 1FWNA 1O6TA 2SODB 1N55A 2YCEA 3TM6A 2J8OA 2OQYA 3N13A 1AUSL 3QEQB 4OUEA 4OLUH 5TE6L 4HZMA 4XGZB 4XCYB 3QFEA 4Q97A 1XIWA 1MQQA 3M1BB 4OSUH 1J88A 3KWXA 3HBQA 3HCVA 3T4AC 5ID0A 2JV6A 3U2ZA 6REQA 3GDMA 1AACA 3W1RA 4FQIL 4TQEL 4UB0H 4DCQA 2YGPA 5KYUA 5I1LB 3IV8A 1Q9WB 2ZX9A 4G5ZH 4X8JB 4NU7A 5BV7C 4LS1A 1DQVA 2R0KH 2PCFB 4GUGA 4TVDA 4U1JB 5D7IA 1QG3A 3PJWA 5GSRA 2ZNXA 4WWKA 2ZAIA 4HETA 1IKNA 3PZMA 2QV4A 2V3DA 3R8GA 4ZPVA 4HDIB 3QUZC 3NJLA 3DESA 4MKMA 1EDTA 4XISA 3S2NA 4HMDA 3ZMRA 1V8HA 5B7MA 3G2GA 5JU6A 3FQ2A 5EZIL 3GTXA 1FG2B 1L7IH 2JCCA 2WO3B 3IMBA 4DY1A 2OKMA 4AXWA 3ALFA 4JM2D 5A8MA 3IFLH 4PJAB 3A21A 5B39A 3HPLB 4HCDA 1FNLA 3K4WA 4KQ0A 2PBGA 2VWEE 3K3QA 4NO5A 4QRAA 3C0QA 3C52A 4PJDF 3FU6A 1A4JB 4MDIA 5ESAB 1SUHA 4OM1H 2GUOB 2RCSL 4KKBD 4L56A 1XT5A 3MUJA 2ZOKA 4S2SA 3QDGA 1VBUA 2CNCA 3OGVA 2MTAA 7PTDA 4ZS7H 1F76A 1XCTA 3O6KL 4HPYL 3VI3A 3SGEH 1O9WA 1EBGA 4XAPA 1BYCA 1FRBA 2A3AA 1IIGA 2HFGH 2BRRL 1Y0EA 1HHJA 3EO9L 2WSRA 4J3TA 3N2BA 4GQ9L 4YSEA 3C86A 2CAKA 4FLQA 2ZBTA 4RZBA 1UOKA 3MRMA 1W8EA 3ZN6A 1O7DC 2Y7SA 3BIAX 3AACA 1XIWB 3BVXA 3HCVB 2B1HL 3E96A 1DWAM 5ID0B 1RSFA 2OZNA 3ULVD 6REQB 5IFPA 4A2HA 4OCYL 4DCQB 4GC3A 3ECVA 1UCWA 5FYJH 1F8IA 3UR8A 2ZXCA 1QZ1A 1RU9L 1UWEL 4P4KA 4X4KA 2IQ9H 2IF7A 2XIBA 1Q7QA 4XNYL 4XBSA 4KKLC 4MY1A 5AB9A 2HKFL 2Z8VC 3ATEA 5GSRB 2W66A 4MQXD 1TETH 4KIEA 1Z9SA 1WFIA 1H0DB 4ZPVB 3QQ4A 5LB1A 5BYWA 4UTTC 4RAHA 1PDKA 1RHHA 3UBGA 3IS0X 5DD1H 1DVFA 3MLWH 1X7TA 1WICA 1J05A 3RUGF 4G6FB 4KROB 1NQ6A 3R4IA 2JCCB 4ODSH 4TQIA 1UR3M 5FSDC 4Y16D 4AXWB 4IBZA 2P0OA 3VGGA 3HG5A 4X6DA 1H6TA 2PPEA 3ZJ6A 4ORMA 4Z17A 4WXYA 5B39B 1VRSA 1K7EA 3W86A 4ZUSA 2FWLB 5DVMA 3WY3A 4NKQB 4KV5F 1SJCA 1E4JA 1BECA 3QI9A 4CLMA 4MDIB 3MA9L 4PRPD 3HQNA 4AZ7A 1TTFA 3P2TA 1XMWA 2X6BA 4PSPA 5AVRB 3HMWH 2ZOKB 4HWEL 4S2SB 5JQIB 4KHXH 4AMKL 2IGTA 4L1GA 3JWOL 1MUJA 2ITCB 1F13A 5A2KH 1XCTB 3ARGD 4HQVA 3RP1A 1BG9A 2EXTA 3VI3B 3TV8A 1PG7H 4AL8L 3ITVA 4AWEA 4JFEE 4HJTA 5L9DH 3GKFA 3A6CH 1RAKA 4I9TA 1HHKA 3GHEH 1HHJB 5DC2A 3EWDA 4KDVA 1HE8A 1KM4A 2CITA 4JDZA 4N2IA 2YPLD 3MRMB 5KMYA 2P3YA 1DCEA 1PZ2A 1ICTA 2Z1PA 4MB3A 1KCSL 5C9UA 1OEZW 1E71M 1AE6L 1K8IA 1UJPA 2E25A 5GS1A 3KBMA 4NBZB 1XF2A 3EBIA 4Q7NA 4JFSA 2K6YA 1EMTH 3CVHL 2Q0ZX 4GRWE 4AT6A 1SZGA 1O5KA 5K59E 4P4KB 2L04A 2P46B 1MCDA 1S2VA 1GA2A 5GGVY 3SJVD 2WYIA 3WIIL 4XR8C 4ZO7A 5ALBL 2X1XR 4FNLH 3WH6A 5IM51 1HZHH 1Z9SB 4NQDA 3QQ4B 4JDVA 1NOWA 5I0YA 2F0CA 1RHHB 4A7UA 2I9UA 5CGQA 2AJSL 4DOHB 1WKDA 1DVFB 2YARA 3PNWA 2IADA 2DDQL 2PRHA 4X98A 1J05B 4K2UH 1T2JA 3SCOA 3AT0A 1LO5A 3WH5A 3GW3A 1AZNA 3M47A 1ZTXL 1HF6A 1CLYH 4R3UA 4EZMA 1RUAL 1F3JA 1ZEAH 3HJ0A 4X6DB 2FO8A 3NEVA 3IMSA 2L4OA 2EYRA 5JLZB 4K7PL 1PJWA 4WKXA 1D9EA 3B8VA 5CJOH 4W68A 1A8JH 4ZUSB 4ZFOL 3LD8B 4PCSA 4IJRA 4OGYH 3V5KB 4NM8L 2Z25A 1OINA 5KN5A 4ZAKA 4M7JH 3AYRA 3PZGA 3H2WA 3QI9B 4G59C 3L4VA 1H7NA 3LZFL 4JO3L 5T1DH 1FYTD 4B96A 4P46B 4Y5XC 4NP9A 1VP5A 2CHRA 3T5WA 3MHGA 1MUJB 2PF8A 1R2TA 2BV9A 4O4YH 2MOQA 4PLJC 3CPLA 5ABZA 1H3VA 3CIXA 2H90A 1EEQA 4FNPA 3KCLA 1CFVH 2XXCB 1AL8A 4I7VA 5BW7A 4J3OH 4BGLA 5CAKA 4WI0A 3V0TA 5CC6A 3WS3B 1HHKB 4MA8L 2X6CA 2VKZG 3B0XA 4LC6A 4FQ1H 4JDZB 3E0FA 1UR4A 3KPPA 1XLEA 2DL9A 3BYYA 3CVBA 3S5OA 1UT1A 1HGYA 1OGTA 1H9VA 2WVSA 1K8IB 4QDMA 5GS1B 3LZPA 3WLSA 1TFHA 1XF2B 3UTQA 3SDOA 3B34A 1N2RA 3GHUA 4DYJA 3ARTA 2QVNA 1LDPL 4PRHA 3FVMA 4TULH 2XFXB 2Y0FA 2PPFA 4AT6B 3F62A