2ZX7A

Alpha-l-fucosidase complexed with inhibitor, f10-2c
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 165
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx7A01
4TVUA 3ZSSA 1QNSA 1KFWA 2J8GA 2OSWA 4J3VA 3WQVA 1X6NA 1UG6A 2YDQA 3WBAA 3WF3A 2Y5EA 3CUJA 3DX3A 3LRMA 3II1A 3MV11 3U7VA 2MANA 1ISVA 5TD4A 3NSNA 2CHOA 4YHEA 3GXDA 5M03A 4W5ZA 4DWSA 5BYWA 4B9YA 1KXVA 1M04A 2D0GA 1VB9A 3BLBA 4AEEA 1DP0A 2F2HA 3A4XA 5IXEA 5DO8A 1J12A 3WD3A 1WCGA 3AHZA 4UOZA 3THDA 3BAXA 3CZ8A 4XV0A 3KWXA 5E0CA 4HA4A 2JFEX 2V38A 5D9NA 4DWSB 4UNIA 5EB8A 5BCAA 3NIYA 2UY3A 4Z2LA 3EMZA 3D3AA 2CBVA 3VD3A 2VL4A 4PRWA 1GVIA 1TR1A 4HZ8A 1HJWA 4UQEA 1H41A 3WENA 1UD6A 3VGDA 4PTVA 1H49A 1XH1A 1OGSA 3B9EA 3TP4A 3OLIA 3ECQA 2JEQA 5A8QA 4OOUA 4OBSA 1HWWA 3WH9A 1LWHA 3EDKA 1V02E 1WDSA 2BV9A 1KR0A 1FHDA 4PMNA 3SEPA 3VKKA 3PTMA 4P7QA 1EOKA 3APGA 3NUKA 1FA2A 1GW1A 1QNQA 1VBRA 2ZWYA 2WMKA 5BXRA 4MAVA 2YDRA 4PMVA 3WEOA 4F79A 3CV5A 1GORA 1CPUA 4AMWA 2BHUA 3BCFA 1XHGA 1CLXA 4D71A 3FW6A 4U33A 1UZ1A 1BGAA 1MFUA 4KWUA 1UD2A 3K8LA 2NT1A 1RH9A 3N13A 3VSTA 3I3DA 2A3HA 2WC7A 3GXNA 2VX4A 3IAQA 1B3WA 4LYRA 1I1WA 2WBKA 2CEQA 4TTUA 3N12A 1VRXA 3LMYA 3CUHA 1MW1A 1GOMA 1JYVA 1OD8A 3WNLA 5FCZA 1WE5A 4U3AA 1FFQA 2DT3A 4W85A 1ZU8A 1E40A 5AC5A 3THCA 2VOTA 3KL5A 4MJ4A 4P7NA 4H04A 3ZJKA 2IUZA 1PJ9A 4FLQA 1WKYA 2PWDA 1D7FA 3CZNA 2XGBA 4LQ1A 2E40A 5D9OA 1E0VA 5IHRA 3PZ9A 3PTQA 4OBRA 4MB5A 1E6QM 3WY3A 1AQMA 1BG4A 1V3KA 3AISA 3ALGA 4J3SA 1EQCA 4FNSA 1SZNA 3DYMA 3OIHA 4ZXLA 1HNYA 1QPKA 1UKPA 4FK9A 1NOUA 1K9TA 2WMIA 5D4YA 4XX6A 4D1IA 3ZOAA 2B31A 1KCLA 2ZUVA 3RILA 2WLYA 4CCDA 3VIOA 3BVXA 1E6PA 5C71A 2VZUA 2D20A 4ZXOA 1GQKA 4Z2JA 3VM7A 1Q6CA 5GNZA 3WF1A 2ZE0A 3NSMA 3SCTA 3W6LA 3PN8A 1VFFA 2DT0A 2WHJA 5I3DA 4HOWA 3AMCA 2IXUA 2Y8KA 3EJRA 2WMIB 3K1DA 1DWGM 1V3JA 1JAEA 4AYGA 2J7HA 3BSGA 1E1FA 3SCRA 1E43A 1TQUA 1PX3A 3WY2A 1TE1A 3AS2A 1WNOA 3PTKA 3ARWA 4J3WA 5DEZA 1JXKA 2OLHA 3AQUA 2V3EA 3BCDA 2XHYA 2OW7A 3WDRA 4LGXA 5M17A 1V3IA 3BUIA 3L4TA 2F7QA 4PEEA 1CGYA 4W89A 4Y7EA 1NQ6A 1UWQA 1E4MM 4P8XA 1Z32X 3BVVA 3SCQA 4AZBA 4S3KA 1QW8A 1WPCA 1UR9A 5EFFA 1J0IA 1ODZA 2BFGA 1V0MA 1CXIA 2YBTA 4GQRA 5M3WA 3W28A 3DHUA 3OLDA 4M80A 1ZS2A 3HU7A 5D8WA 3W82A 1LLOA 3VVGA 3W27A 1TA3A 3SCNA 1WP6A 4PUEA 1GQLA 5IFTA 1U33A 2FDMA 2XFYA 3BVUA 1QW9A 3VIHA 1LJYA 1FHLA 1ISYA 3L4WA 2YL9A 2WMFA 5KZ6A 3N04A 4C7GA 1PPIA 3GNPA 1TA3B 4D6JA 5ABHA 1G0CA 1G5AA 4PTWA 2CCRA 1BSIA 1ISXA 3MMUA 1KBBA 4EAMA 4M1RA 3EDJA 4IM4A 3AIBA 1H09A 3KLKA 2GJXA 4GQQA 1UD4A 2F7OA 1GJWA 2IXVA 3NDYA 4BZYA 3CLWA 2VUYA 4GKLA 4RE4A 2J7DA 1A47A 3K8KA 2W67A 2WCAA 3T0AA 5M5DA 4J3UA 3AXHA 2DSUA 3MMDA 6A3HA 3WIJA 2GJXB 4FNUA 3N11A 3FY1A 4PTMA 4OZOA 4PMZA 1Q6FA 9CGTA 3W26A 1JIBA 1H1NA 4XB3A 1W3KA 3AMDA 2NW0A 4AD5A 3QHOA 1LF1A 3W81A 3KL3A 3U7BA 3VGFA 3GBEA 2WB5A 1C8XA 5FKYA 4ACZA 2WZHA 3GXTA 3BUQA 1KBKA 4DO5A 3WD2A 1ESWA 1JDAA 2C7FA 3L4YA 3HG2A 5GNXA 3IANA 1TFVA 4H7VA 1TCMA 2W63A 2XUCA 3LPFA 4P7RA 1JZ6A 4FMVA 3VNZA 2QLYA 4JL1A 1KXQA 2J4GA 1JNDA 5C70A 2W91A 4FLRA 4JIEA 2VTFA 3BUBA 4NRRA 2W61A 2ZUNA 4TX8A 1RPKA 1CNVA 2J77A 3CHCA 4MNKA 1KTCA 3VO0A 5IFPA 2GUYA 1K6AA 3WQWA 1R86A 1H0IA 2V5DA 4D6IA 2ZXAA 4AZCA 1H4PA 2DH2A 3GYCA 1R33A 3QR3A 1BYAA 4UQCA 4PCSA 5E09A 4ZE5A 4BA0A 1HJVA 1EIBA 1U30A 4HZ6A 2F8QA 4HZ7A 4AD1A 3ARQA 3M6DA 3AHXA 1CXLA 3QHMA 1QNPA 5DMYA 3LPPA 4AD2A 4NX0A 3WFZA 3DX2A 4PBGA 1HVXA 3MU7A 4AZCB 4H2CA 2VCBA 3M07A 4CN1A 3LPOA 2XGIA 3F5LA 3PZVA 3GH7A 1W2PA 2WPGA 3PZIA 1B2YA 1BYCA 3LRKA 4BS0A 3T09A 1R87A 3A47A 4AIOA 3KEHA 3A21A 3AS1A 4UTFA 1ODUA 5A3HA 1ZL1A 2AOSA 1UKQA 3BLPX 5CLWA 1UR0A 4UFJA 3MSDA 2X2IA 3K8MA 1W1PA 2EPKX 2G4FA 1BTCA 3RM4A 5HBFA 2AMGA 2YA0A 1KCKA 1CDGA 4BQ5A 1F4AA 3UG5A 2FH6A 2ZX5A 3BVWA 4CGTA 1W9DM 2W4XA 4CVWA 2J74A 1C92A 3UG4A 3JUGA 1WZMA 3AIUA 1L0PA 3ZR6A 1VEMA 4A3YA 4P7OA 1OCQA 2WHMA 2DSVA 5I6SA 4FNPA 5AC4A 3K46A 1Q4NX 4CD5A 3CPUA 3VDAA 3CTTA 3WNPA 3SCPA 5ABEA 3DHPA 4D6GA 4TVDA 2OW6A 4GZIA 2JE8A 4JFUA 3VUPA 5I5RA 2BVDA 4TX6A 3BAYA 1XGZA 1HL9A 2WC3A 1Q6EA 4NI3A 1JI2A 1JL8A 1JZ4A 4HPGA 4WLCA 4PMDA 3TA9A 2ZX9A 1UQZA 4W84A 4ZFMA 2WBGA 2CBIA 4TXEA 4BQ3A 1VEOA 5HPCA 4UR9A 3ARXA 3WUGA 4EK7A 1SMAA 1BAGA 1JDDA 3BSHA 3AZRA 4CU6A 4EANA 3DDGA 3B9AA 3MUY1 2BY0A 4TOQA 4UQBA 5A8MA 3VX0A 5GPRA 3U57A 1B90A 3WDIA 2PWEA 1UH3A 4NXSA 4PYSA 1O7DC 3WMSA 4CD8A 2WXDM 3QOMA 3D51A 2DEPA 3AJ7A 2X1IA 5HOSA 3ARZA 3D4ZA 4XUYA 4ATLA 8CGTA 1J10A 2CHNA 2XVGA 4KGLA 4CN4A 4U3CA 1MYRA 4JCMA 1V0NA 2WSKA 2XPKA 1ITCA 2V5CA 2VURA 2A3AA 4J3TA 3WH8A 1HKKA 1UWTA 1W9PA 1R46A 1J9YA 5D8ZA 2G3NA 1UQYA 5E6YA 3WY1A 1J18A 2QF8A 3WH5A 1WDPA 3WUEA 1EDTA 2XVKA 4DUVA 4UFMA 1JI1A 3UR7A 2ALWA 5BROA 3T2OA 3ZR5A 2WZIA 4AISA 4AZ5A 1SR0A 4MTVA 4J7RA 4YHGA 1XYFA 1MW3A 2XIBA 3A24A 1VFMA 3VD4A 1QI0A 4HPHA 2QHAA 2ZX8A 5AYIA 3O2LA 1J0HA 3MSGA 3A4AA 2GK1A 3CZJA 1ZBWA 1CGXA 2XN1A 3ARYA 3SCVA 2VR5A 3WNMA 1S46A 3VGEA 2PC8A 1SYTA 3AMKA 4W86A 3W53A 4E4PA 1HF6A 3VIGA 1GOQA 4KRTA 3RM9A 3KE0A 4D6DA 1QBBA 1HXJA 2GK1B 4N42A 2EPNA 1E3ZA 1OM0A 3SURA 1DWAM 3PZQA 1WAWA 1W3LA 4FF5A 4ATDA 4UFIA 3L4VA 3HG4A 2WVVA 1XRVA 2O9OA 3W0KA 1R75A 5HXMA 2XWDA 3HJEA 3WL1A 2WCSA 3S2CA 4K68A 1J0KA 2YA1A 3ZT5A 1F4HA 4AWEA 3A6OA 3DYPA 2EBNA 4IPNB 2WVVB 4AYSA 3BC9A 1DEDA 1UHVA 1CGWA 3T2PA 5CSUA 2G41A 2GVYA 3GTNA 3A22A 5CGTA 3FHQA 1QOXA 2EACA 1TQSA 2EABA 1EO7A 3G6LA 4AY1A 3HZ3A 2YIHA 2DSKA 5D9MA 5A6BA 1KXTA 3BGAA 3AHVA 5BRPA 4DUXA 1JD9A 5CPQA 2J7FA 3S5YA 1E6NA 3RCNA 4AD0A 1ZB5A 3PZNA 4CD7A 1EA9C 4J27A 3E1F1 3RPMA 4AW7A 4EKJA 1M7XA 2GDUA 1KQYA 3CHFA 3K4AA 5GQBA 1EHAA 1W1YA 3CUFA 1TZ7A 2E0PA 3CZKA 4W93A 3ZSTA 3RM8A 4ML4A 2XJ7A 3L4ZA 2WHKA 3OLEA 2ZX6A 2WW5A 3LXAA 3WELA 1WB0A 1E0XA 2D0FA 2EAEA 4QDMA 2YLLA 1JZ7A 1TVPA 3KLLA 4U5KA 2X09A 1V6YA 4HOXA 1UH2A 1QI4A 3FAXA 1E4IA 3WY4A 1Q6DA 5LA2A 5DT7A 3WD1A 2X2HA 3AYSA 1B31A 4GXPA 2OWWA 1DWHM 4U31A 1QVBA 3RJXA 2O9RA 1GQJA 1K9DA 1JYXA 1VF8A 5CJ5A 4HA3A 1LG1A 4OIFA 1QI2A 3VU2A 1QNRA 1GJUA 1XCXA 2XFFA 3GM8A 3AIWA 3W29A 3A4WA 4QCEA 2NT0A 3QGVA 3VDHA 1MW0A 1LG2A 2Z1SA 1CENA 2EXOA 4AD4A 1R7AA 4AZIA 2XN2A 1HX0A 3U5UA 3VIFA 3K4DA 4UQAA 1EH9A 2ZOXA 3LXCA 1ITXA 4CKQA 5D9PA 2D24A 1HTYA 4X0VA 4E8DA 1ZJBA 2E8YA 1HP5A 3PBGA 3EBVA 5CGMA 2OSYA 2CYGA 3AIRA 4JCLA 1BVNP 5E0FA 3EYPA 5DF0A 4MNLA 1V6VA 1BPLB 1W91A 3CZEA 4DWSC 4GO9A 3KZSA 1OWQA 2GSJA 2VRQA 4X0NA 4PSPA 3HN3A 4W8LA 1WDRA 3OGVA 1NWTA 4EE9A 2WC4A 1UR1A 3RMEA 1CXFA 5F7UA 1JD7A 3VIPA 2F1AA 5JUVA 4UZUA 1IZKA 1CBGA 4ACYA 3RDKA 1J0YA 1E70M 1QWNA 2C8NA 1L8NA 2VC9A 1BHGA 3CMGA 1HKJA 5CZKA 3SUSA 4D6CA 4MNJA 5A6MA 5EFDA 1DWJM 5I78A 3WNKA 5C8BB 3OLGA 4IPLA 1HJSA 1AMYA 1V3LA 4BQ4A 2IGTA 2YL8A 3WF4A 1B3YA 2ZIDA 5E9AA 2X2YA 2DSWA 1OBAA 3NCOA 3CMJA 2QPUA 3CGTA 4P8WA 3AROA 3TTSA 3OB8A 4W5UA 3TTQA 4FLSA 2FGZA 4Z2IA 3HG3A 2CIPA 5A8PA 1TMQA 3LRLA 3OZPA 5A69A 5A6AA 4B3LA 1CGTA 1GOWA 2J7CA 2V3FA 4UCFA 2PWFA 1QX1A 4H41A 1UD8A 4W7WA 4QCFA 5A6JA 1JF6A 3VSVA 1BVZA 3N17A 3IGUA 4AC1X 3EMCA 3SCWA 2F1BA 3MO4A 2FHFA 5I77A 1WZLA 1E72M 1BYDA 1Y7VA 2A3EA 2UY4A 1VFUA 2XVLA 2PF0A 4B3KA 4Z2KA 4W7VA 4CD6A 1A3HA 5DFAA 2VRJA 3WD4A 4MPKA 4AMXA 5I79A 2GJRA 7A3HA 1V08A 4DO4A 4F66A 2FYVA 2XM2A 5LYRA 3AHYA 3MKKA 4Z2GA 4OKDA 3CUIA 4IUGA 4ZE4A 2FH8A 4GPNA 1CLVA 3H54A 3OG2A 2OSXA 4HOZA 1V0LA 1HKMA 1MQQA 3WMBA 3AS0A 3DX1A 1E6XM 2YFOA 3EMQA 5IHSA 3A5VA 2DIJA 4PMOA 3GXIA 4DWSD 1BFNA 3I3BA 4GI9A 3SCSA 4H8HA 4PTXA 3VX1A 1V3MA 4A3HA 3G6MA 1R8LA 1PIGA 2QPSA 2ZUWA 3MANA 3CH9A 1FH7A 2PWGA 3IAPA 3ARSA 3AMLA 1J11A 1I75A 3TONA 1CEOA 1E1EA 2XG9A 4PMYA 2VVNA 3BAJA 2W62A 3I3EA 3CBWA 1CZ1A 1HJQA 1J0JA 4F9JA 7TAAA 4U2YA 1EGZA 1E5JA 1EQPA 1WDQA 2J75A 4R27A 4V28A 1UR4A 4FLOA 2Y8VA 4DM2A 2A3CA 4GI8A 3LXBA 3UERA 1E55A 3SCOA 1D2KA 2VRKA 2EEXA 2JALA 4DO6A 3O6AA 1QWUA 3DYOA 4AMCA 4NZJA 3DDFA 4P8VA 4WF7A 2XFRA 2BHZA 1C8YA 1TUXA 1M53A 1QHZA 1NM9A 2VZOA 1XSKA 3TTYA 3PZOA 2PBGA 1GOOA 4LYQA 4BF7A 2D0HA 1K9FA 3VMOA 5FL1A 5AYBA 1O7AA 4MNMA 3FNDA 2F7PA 2J7GA 3ARPA 1UWSA 2UY2A 1SFSA 2JIEA 4CU7A 5A6KA 2WMGA 5JBDA 1V0KA 4HMEA 1R47A 1JAKA 4QP0A 2PI6A 3WUBA 3T08A 3B8SA 5E6ZA 1UOKA 4JKLA 1UWUA 2EADA 3L2LA 3WF2A 2VO5A 1LL7A 3WH6A 4IISA 1U2YA 2EO7A 2EPOA 4RE3A 1XSIA 5ABGA 4NZFA 3EDEA 4E2OA 3VOCA 3GXMA 1W3JA 3T0DA 2EJ1A 1VBUA 2BY3A 4UFLA 4A4AA 1SMDA 3D5HA 2W66A 4M82A 1HT6A 1GNXA 1PEZA 1Q6GA 4CCCA 2J8FA 4DUWA 1FH9A 3WNOA 1M01A 3IJ9A 2QMJA 3WBEA 2BHYA 1E73M 2VZTA 4HMCA 2VX7A 3PZMA 2VX6A 1C91A 4V2XA 4AEFA 2VZSA 3WDQA 4C7FA 2J62A 2WMHA 1UKTA 1VIWA 1BYBA 2GDVA 2J47A 4JHOA 5ECUA 3EJUA 3N18A 2WZEA 3VIIA 1B3ZA 4AZGA 3U5YA 2GJPA 1R34A 1G9HA 1NH6A 1JF5A 1US2A 1JDCA 4BCEA 2WCGA 1XCWA 2WM0A 4PN2A 2RGMA 1NP2A 1OGBA 3FXYA 4UFHA 2D1ZA 1OD0A 2VQUA 3GBDA 2VI0A 2WANA 5A94A 5E1QA 1PZ3A 3EJSA 1B3VA 2QMKA 2WVSA 4W7UA 2JF7A 3GH5A 3ZJ6A 4Q7NA 2WVUA 3POCA 4X9YA 2DIEA 1C93A 5CXPA 3LPGA 4F8XA 4KMQA 2G3IA 4ZENA 4W8BA 3SUTA 1HKIA 2OYMA 4MADA 1ISWA 1OIMA 1V03A 1GOIA 3W37A 2JF6A 4GZEA 5HNNA 4OOZA 4HMDA 1UA3A 2CETA 2PWHA 1AQ0A 1O6IA 3EJQA 4B15A 4J3XA 4GZJA 3PZGA 3VSUA 2G3MA 2ZUUA 1W3HA 3EDFA 1E4LA 2J79A 4U5IA 1UD5A 2J25A 2OYKA 3WQ5A 5GNYA 4AXNA 3GXPA 1BQCA 1EDQA 3BH4A 4UQ9A 4UOJA 1PZ2A 3VNYA 2X2JA 4QAWA 3N9KA 3CZSA 3S5ZA 1ISZA 3WDJA 5E70A 5BWFA 2BVYA 4GI6A 1J0ZA 4PMRA 3VGHA 4CCEA 3ARTA 1M03A 2G3JA 3OA5A 5ABFA 3CO4A 2WNWA 1UASA 1UR8A 3AMGA 3BAIA 4CD4A 5LA1A 4KH2A 2C0HA 4H8VA 1G1YA 4TTGA 1VJZA 1C3FA 1XC6A 3GH4A 1I1XA 2YA2A 4MAZA 3UG3A 3W25A 3VINA 1GHSA 2ZXBA 3D52A 2XIIA 4W87A 3CZGA 1EDGA 3AZSA 3HMCA 3ZO9A 5ABFB 2DT1A 1V6WA 1X1NA 2ZXDA 4MDPA 3GZAA 3AYRA 1RP9A 1LL4A 2F7RA 3VPLA 1WZAA 2WSPA 3ZT7A 3VD7A 3CZLA 1YHTA 2WHLA 3AZTA 3POHA 3AXXA 2D2OA 1MFVA 2CBJA 4J28A 2E4TA 1BF2A 2YJQA 1MQRA 5IDIA 4JL2A 4Z2HA 3UESA 3CHEA 4E8CA 3SUWA 2OWXA 1B1YA 3ZMRA 3ZM8A 5A8OA 4JAWA 2FGLA 3MUIA 2O92A 2X0HA 4MDOA 3ZIZA 4M29A 2D3LA 3MI6A 1DTUA 3M46A 3SIMA 2XTKA 1KGWA 3W4RA 4UFKA 2BS9A 2YLAA 1G94A 3AHTA 3N1AA 1H2JA 1XD0A 2WKLA 2WWDA 3DC0A 3OBAA 1IZJA 4CN6A 3NJ3A 1GUVA 4QLJA 4PMXA 1UYQA 3BVTA 1R7OA 5JIPA 1LQ0A 2Y4SA 2ZUMA 1T0OA 1TQWA 2YBUA 1FH8A 3WQ8A 1KGXA 4L4OA 2AAAA 1UD3A 2DT2A 2BY1A 1TVNA 4WIWA 1CXHA 1C90A 3SUUA 2DH3A 1MWOA 2ZICA 4GINA 4YPJA 1OSEA 2VZVA 2D23A 3A23A 2YL6A 2V3DA 1MQPA 2XM1A 4KGJA 1E56A 1RP8A 3VGBA 4WJXA 1EXPA 1ZJAA 1D3CA 3NYDA 1VAHA 1CXEA 3AFBA 1PAMA 2A3BA 1NOFA 3VILA 4JFVA 2BY2A 1JGIA 1AVAA 3HG5A 3QHNA 2YDSA 4TUFA 1HXKA 3RO8A 2EPMX 5I2UA 1OT1A 4UQDA 3VDBA 2ZXQA 3ZT6A 3VDCA 5JIWA 2V3GA 2BNJA 3KL0A 2NSXA 2F18A 2FE0A 1E5NA 1E6RA 5CG0A 1TQTA 4NRSA 4MB1A 1ECEA 4D6FA 4PMQA 1PX4A 1OT2A 2YOCA 4D72A 1QHPA 2HVMA 3OGSA 4WKHA 1JZ3A 3TTOA 3ARUA 3MUZ1 2J7EA 4XZWA 4N0RA 3MV01 3WEZA 1CGVA 4HU8A 4LX4A 4PMUA 1K9EA 1TQVA 1AQHA 4PCTA 2DDXA 2UY5A 4OGZA 1GHRA 4M56A 1XYZA 4AIUA 3ARVA 1H5VA 1WZKA 1KQZA 1FOBA 4JFWA 2CKRA 2GFTA 3T2QA 1QHOA 2W92A 1VEPA 2Y24A 3H55A 3L4UA 2VJXA 1J01A 1VJSA 2X8RA 2UWFA 1UR2A 3D4YA 2FHCA 3GXFA 1E6ZA 1W1TA 2VX5A 3VIJA 3SCUA 3DX0A 1XH2A 1ZBCA 4UOQA 3AOFA 1W2VA 1E71M 1V6XA 5FOOA 4M8UA 3MMWA 4D6HA 1OIFA 1B3XA 2VT0A 4XZBA 4PUDA 1GZJA 2XSBA 4AD3A 4C7DA 5FD0A 1CGUA 2F61A 2DPEA 4H8UA 2TAAA 4RE2A 1LWJA 2WLZA 3WH7A 5FL0A 4KRUA 1G01A 5I24A 3VMPA 3WFLA 3H53A 1GCYA 1E9LA 3WF0A 1JXJA 1H3GA 5BRQA 3M7SA 2VR4A 1FFRA 3OGRA 1MVYA 2WVTA 4OUEA 4CU8A 4CVUA 4OJYA 1HVQA 1H0GA 1FP9A 2PB1A 2HISA 2WAGA 2DQXA 1UZ4A 3FAWA 1E6SM 2D73A 1GQIA 4PSRA 4HTYA 2CNCA 3WNNA 3WUFA 4WSJA 2D22A 2ESCA 1BLIA 5A2CA 3J7HA 3AICA 3IK2A 2ZUTA 4W8AA 5CPTA 4AZ7A 1CTNA 1GPFA 1C8QA 5HDRA 4HU0A 1NWUA 2RGLA 1HP4A 1JZ5A 3FHAA 3WQ6A 4CUCA 2VMFA 1MXGA 1R85A 2J7BA 4FNQA 4M81A 3IJ7A 1W32A 1W9BM 4BQ2A 2WK2A 3W38A 1EOMA 4D6EA 3UR8A 1NP0A 2Y2WA 4F9DA 1ZBKA 1UWIA 2XVPA 4YN5A 3VIMA 1NWSA 1V02A 5CSYA 5I0DA 2E8ZA 1NOWA 4GIAA 3SUVA 5A2BA 4WSKA 3BLKA 2E9LA 3PZTA 1KR1A 1OGGA 5JBFA 3ZQ9A 2YL5A 1YQ2A 3AIQA 2ZWZA 1B30A 4Q22A 5DT5A 4QLLA 4U2ZA 3CC1A 1IT0A 1HN1A 2VCCA 1KGUA 2BVTA 3VMNA 1FP8A 1UKOA 1C7TA 4LXFA 1PBGA 1V6UA 2WKGA 4FNTA 4ATWA 3EJTA 4AIEA 2XSAA 2CKSA 1NWRA 5A95A 2CPUA 4P8UA 2VQTA 3WMCA 3LX9A 1GONA 3UETA 3AS3A 3AIEA 3F5KA 1DWIM 3D50A 5CPSA 3VGGA 2Q8XA 5A8NA 4HP5A 4S3JA 3B9DA 1N82A 1E3XA 1PS3A 2E9MA 5EBAA 1PIFA 1CIUA 4HA1A 1W9VA 3MUAA 1KB3A 1BG9A 3WEMA 3TOPA 3NSXA 2WYSA 2CERA 3EJPA 1CXKA 4LYPA 2CITA 3W24A 3CUGA 2J78A 4JFSA 3ZJ8A 4ACZB 1V3HA 1JNEA 1E15A 4NSBA 4L4PA 2FHBA 1JFHA 1VFOA 1HIZA 2XVNA 1P6WA 1XV8A 2YKKA 3CIVA 3PZUA 2YFNA 4JFTA 1MXDA 5A6SA 4NF7A 3FN9A 4TVCA 2CBUA 2OYLA 1W9XA 4RL3A 5A1AA 1WO2A 4JKKA 4QFUA 1IV8A 2XYLA 4DM1A 1QBAA 1XH0A 3TV8A 3BXWA 4URIA 3ZJ7A 1HJUA 1ZBVA 3N15A 2ZX7A 1UUQA 5KEZA 1E0WA 3QOKA 3L4XA 1GVYA 1EO5A 1C7SA 3WQ4A 3VM5A 2D3NA 3UCQA 3VIKA 1GOKA 5CQ1A 4UZSA 1OB0A 6TAAA 3VD5A 3IJ8A 2QV4A 3EDDA 3VTRA 3DX4A 2E9BA 4MB4A 8A3HA 2WMJA 5A6BD 5BXPA 3W6MA 5A2AA 3AXIA 5CLTA 2DSZA 5AY7A 1UKSA 4MJ2A 4D1JA 3WDPP 2CXGA 3WDHA 3WN6A 2WWCA 1MW2A 2VNCA 3GNRA 4P7LA 1HJXA 2BXYA 3DECA 5BXTA 4FNRA 2G8ZA 3GNOA 4JKMA 4MB3A 1KTBA 1B0IA 5HPOA 1PX8A 3L2MA 4AZ6A 6CGTA 1OINA 5FIPA 3RIKA 2W5FA 4JZ5A 1W9UA 5A6LA 1UA7A 4QLKA 2VCAA 5LA0A 3WD0A 3ALFA 1KXHA 1US3A 3WL0A 1XD1A 1JFXA 1JG9A 1W1VA 2BXZA 3A3HA 7CGTA 4WK9A 1JZ8A 3OZOA 4V27A 1UWRA 1KWKA 3BMWA 2CESA 4ZEPA 1NARA 4B16A 2VVSA 3RJYA 1DHKA 2JIWA 4B9ZA 2O9PA 3VD9A 4NZCA 1CWYA 3WSUA 2JEPA 4LPCA 1LL6A 3BAKA 3BUPA 3NDZA 1QNOA 3MS8A 3BMVA 1CYGA 3T0BA 3BAWA 4AZHA 3ARRA 1E4NA 1HL8A 3F4VA 1QI5A 4WKFA 5JBEA 5EMYA 4JHZA 1JZ2A 1B9ZA 4GO8A 1X6LA 1RD6A 4R5EA 2X0YA 4W88A 2O9TA 3PHAA 3UEQA 2EPLX 2OWCA 1TG7A 2X05A 4M24A 2EQDA 3S6TA 2XN0A 3GDBA 1EHNA 2DGAA 1DWFM 2XWEA 2PBOA 1UH4A 2ZUSA 1KWGA 1BGGA 5I23A 3CHDA 3AI0A 2Z1KA 1XSJA 1JYNA 3BUDA 3F5JA 3O9NA 1H11A 3WKZA 1QI3A 1VENA 4WKAA 5BXSA 1JYWA 1CECA 2E3ZA 4NXKA 3AIVA
chains in the Genus database with same CATH superfamily
3MP3A 1KFWA 4NAMA 3OMIB 2ZNWA 4FQXB 3ARGC 4X42A 3RKDD 5CAHA 4ZFZB 3AJXA 2AXHA 3MRMB 3AWOA 3BV7A 4HK0A 1OGTB 3OVPA 2XA8L 4HETA 5IHUH 5BOOA 5MENA 3T8VA 5GGSA 5ERWB 4L3ED 3BZFA 3G1YA 3DVNB 4XOCA 1KCWA 2WTRB 5BZDA 3W7KA 2BDNH 5IXEA 4LBEA 3EOLA 1RZJC 4JUTA 3THDA 4QXIA 3TIEB 5D2XA 5EB8A 4XAZA 3OAZK 4EMZA 1BFSA 1DQKA 4P0DA 1IEBB 1K5NA 4EUPH 4HQVA 2WWMC 2AJZB 1RUQL 2Z26A 3JZUA 4H20L 3HNSH 3P73A 4AYEC 2K3TA 4GG8A 2IG2L 4F7EA 1TTAA 3QUZC 2Y7QA 3SE9H 2VLLA 4FX5A 1M3UA 4HF5L 1TJIH 1GW1A 4PMVA 4O02B 3KS0J 2EUVA 1NMBL 5DR5L 4Z1AA 4K55A 2DOCA 5GGTH 3SZ8A 3B8UA 3GZPA 3V5HA 5BVJB 1KRBC 4FQHA 4X4XA 4XAFA 5KYXB 1MFDH 2QIIA 3MGOB 4V1DA 4DPQA 5AB0A 1U83A 4WTZA 1A7OH 3RGTA 3PP3H 5IB4B 2PW1B 1ZGDA 3QSKB 2GJZA 4ELMA 2ZXEB 2FIRT 1WKYA 2CRIA 2MTPA 2HPMA 4JY6B 5DTFB 3VW3H 3U3HA 1PSCA 3KZ8A 4G83A 3Q2DA 1EZVX 3SN6N 4R7DB 3VRIB 1AQMA 2FVNA 2MPAL 2CJ3A 1EQCA 4K3JL 1HINH 1EEQA 2VM3A 3IYLW 3HZKA 2QULA 1P4IH 3QCTL 2WMIA 4JFFB 3W9EA 5TE6L 5DLLA 3EWWA 4N8VA 4PJEA 3CYVA 4ZXOA 4MD5B 4QY8B 3W6LA 2EHHA 4KEVA 5DA0B 3F4DA 3IFNH 4FFVC 5JTWA 3KJ6H 2CO7B 1A6ZA 3BEWA 3GSMA 3BSGA 3PABB 2C3VA 3SO3C 4NN7C 5C0GA 4FJZA 1X1ZA 1TE1A 4U4IA 2IKGA 1PCSA 4W89A 4Y8FA 5CCKL 3CFEA 3FUJA 5JUEL 4JPVL 1QW8A 5JOFB 2J66A 3LS5L 4ZXBB 3NIFE 1OAZH 3K71B 4NUQA 3B9VA 5IKCB 3G6JA 2C7UB 2XFYA 5D4QA 1G7UA 3S48A 1U91A 3OPZH 3VFWB 2OXGA 1EBPA 4Z7WA 3HE6A 4CCZA 4X8GA 3C60A 4HIHB 1TA3B 3I2CH 4L56A 5E2VL 3HA0A 1G1KA 2A6DA 5DLMH 4F9PA 1FZMB 2F7OA 3Q9QA 4KZDH 1I8IB 5GRZA 1RR2A 4RE4A 2DDQL 3WFHA 4BWTA 1S1RA 2A7PA 2DSUA 3PCYA 5E6SB 3K7UA 1H8NA 4FALA 9CGTA 3BARA 4XVJH 4P23B 4OWGA 4HLZG 4Q4EA 1G7JB 1MKFA 1TR9A 3CHOA 2WB5A 1DQMH 4Y9FA 3T4YB 2C7FA 2H1PH 2I85A 4FMVA 4QDWA 5EYWA 2DWDA 3BUBA 3QNXA 3CL6A 1CNVA 4MWAE 4KROC 1YTEA 1H0IA 2J9ZA 1H4PA 2GSGB 5IW3A 4A1RA 1IGIL 2VXQL 4I0PD 4AD1A 4XP6L 4NRXB 1S5HB 2JKWA 3ALWA 5DFTA 3WFCH 2OQYA 1LDPL 5AL8A 4H2CA 3M07A 4A2SA 1AJ7L 2Z29A 3IT8D 2IOMA 2EYTB 5KVGL 4HFUH 3KGRA 1WUFA 4LCCA 4O4YL 3T09A 4MAYC 4XCEB 1ET5A 5G2HA 3SE8L 4CSSA 4UNLA 1Z5LA 2E6AA 4PJDB 2APSA 1ZHBB 1A1OB 4IBVA 1WBYA 2FGWL 3PY2A 2PABA 1NQBA 5LGZA 4JW3A 4HC1A 1W9DM 1FP5A 4KWOA 4CVWA 2BP5M 1EAPB 1BM7A 1G43A 3A64A 1NZRA 4K94H 3SQBA 2OSLB 2A6IB 2I5YH 1R2TA 4CD5A 2QDHA 3VUPA 1HYSD 2ALRA 5EKYA 1UJ3A 3AT8A 1AQFA 4LUYA 4JTQA 3ASNB 3BQVA 1JZ4A 4X6EB 3WUGA 2C1HA 1PVNA 5CGQA 1ML0A 2HX8A 4LT9A 3LVTA 3VX0A 1QXLA 3WDIA 3GI9L 1UH3A 3ELFA 4PYSA 4AYID 1S9VA 4RMQA 3FCPA 2NSMA 4APXB 3BVNB 1DL7L 5IHBA 3MSRA 3RWDA 1X7QB 1F11A 2XISA 2CHNA 3GSVB 3LHPL 3BPOC 2IGFL 5I74B 3BO8A 4GMEA 1PZSA 5ADPH 3WH8A 1R46A 2QPXA 4NC0B 3LQLA 1ZIBA 3N19B 3UR7A 3EFOA 3T81A 4ODWA 4DLFA 1HI6A 4NAFB 4YDKL 1B3JA 2VDQL 4YVPA 3MCG1 4HUWB 3BJSA 6FABL 3FO0H 4EQ2A 3AMKA 1OZQA 5HDBE 3RM9A 2FTAA 2JFCA 2GK1B 2OLAA 2QQLH 3PZQA 1WAWA 1XLJA 2LW3A 4UFIA 3OZKA 4IOFD 3W1QA 3SBQA 2AEPH 3G18A 1A0QH 1TV4A 3NJVA 3L5LA 2XWDA 2Q2EB 3P9MA 2ADFL 4LF3B 1UFUA 5AOMA 3IVTA 4L6HA 3A6OA 4LARH 3NM3A 2FJKA 3T2PA 1KTRL 4FFYA 5JW4M 5CSUA 1TTBA 5DQDH 3A22A 1QOXA 1ZCRA 1TQSA 3QLLA 3WJMB 2NXGA 2G5RA 4POZC 4QRNA 1QR4A 5BRPA 2DZVA 1JD9A 2GY5A 3S5YA 1FCCA 3NK4A 3COOA 1S5VA 1HQRA 3AWGA 2H2SC 2E0PA 1Q4WA 1KO0A 2WLKA 4X5QA 3W3BA 3D8MA 5D1QD 4QDMA 2L7UA 3DI1A 4RPPA 1YYML 4Z18A 2Z8WC 2FBJH 1YYLL 1XG4A 4W6WB 4DGVL 3AYSA 1B31A 1J8HE 3RJXA 3QJFA 5GGVH 5EU6D 5DJDA 1XCXA 2RACA 1NUNB 1ONQB 3T40A 1EHXA 3L3OC 3VIFA 3O0KA 4PJ8A 2LFEA 5KJRL 3QDAA 1XF4A 2ZKHL 1CWVA 1RV6X 4LRIC 4B50A 4HK3N 1GVSA 2VWTA 4JUSA 4EN2A 4AVKA 1DQDL 2QELA 3MLRH 4O2FA 1LE9B 1WFIA 2JQZA 4UIKL 5DD1L 4W9TA 2N59A 3QDJE 1INEH 1FCBA 4PWHA 3QPXL 1ZWIB 3UCCA 2GI7A 1JD7A 3SIZA 2NX5D 4FQLL 1S5MA 3LZ3A 2VLRB 3MO1B 2NUPA 1N5YL 3T6CA 4NQED 3PU7A 1L8NA 2VC9A 4YHOL 2ZWNA 1BHGA 1Z3GL 3HPAA 3GHUA 2CO6B 3ZVIA 3BE1L 5I78A 2JQMA 5E6IB 1LK3H 4FERA 1FCUA 2JKJA 2X9ZA 1AMYA 4HUXB 1HHIA 4R97B 3WF4A 1IHIA 2XICA 1YADA 5E9AA 1R0AL 5DD3L 3OB8A 3BQ5A 3HG3A 3MJ9H 2HXAA 5DQPA 2Q6ZA 2VUOA 1Q8AA 3UPMA 1J88A 1WXJA 3N0AA 4PM1A 2QL1A 1KCSH 4OZGF 3V9EA 4O1EA 1TJRA 1KYOK 1UB5A 1EC9A 4HIEB 3C56A 4LKXA 5DVNA 4BINA 4R7LA 2XN9E 1VPOH 3FU3A 2Y36L 3S35X 3PHOB 1CL7L 5DWUH 2JCCB 1W54A 3TYGL 3LOWA 4HIXL 5FECB 3SKNB 4X80L 5I1CH 3NVDA 5GGRY 3UAAA 1DIDA 1G7MA 5T3XL 3KRUA 4GP8B 4GG6F 1UT9A 4H8HA 3ATEA 4GQPH 1F3EA 1R8LA 5IOPA 1MI5B 2WZAA 5E7FA 2BNQE 4AT6B 5G4OA 2HJKA 1HZHH 4H1LA 4TX9A 2PWGA 1U2CA 4UWQB 3FDKA 2YQ2A 1J0JA 1EJOH 2EUXA 4PRHB 1IIGA 1KB5B 3ULVD 1P0SE 1G7QB 1OFEA 3TX9A 2HSIA 4NKOB 3O2DA 3OSVA 4OJFH 1VFSA 4LYQA 5HHOA 4PJHE 5C6WH 3RNQA 3TPUA 4G8FB 4S23A 4NPJA 2ZTJA 4DEUA 1V7YA 1L9NA 3BAEL 2C3ZA 2FZ9A 4HMEA 4OFQA 2UBPC 2UZXB 3GK8H 4YOKA 1UOKA 2P0OA 2OMVA 3KPPA 3TR2A 4G56A 1J96A 4OB5L 2PCQA 3JV6B 3TU6A 2WQPA 3VXUE 4BA8A 4Y4HD 3ZTJH 4Y2WA 3W7RA 4XO7A 1HT6A 1F6AB 1PEZA 2N0KA 3QYMA 2EIJB 1MCQA 2UWEF 3IJ9A 2BHYA 3TT1H 2XBDA 1XS2A 6XIMA 3MU3A 2Z0IA 1FSKB 1VPQA 2B4CL 5FKAA 1YJDH 2BVQB 5CFAA 2XPGA 1G9EA 1EJTC 2C9PA 4EOWH 3QAZC 3HS8A 2OYPA 1XCWA 2FX8L 1CB2A 5EOTB 2DD8L 4PP1C 4IBLT 1JPHA 1PKNA 1KN4L 3Q48A 2QMKA 1A7QH 3GH5A 3HBZA 3S3JA 3T9WA 3W0WD 1A9VA 2CU0A 1DQXA 3FA3A 4J5VA 4UQIM 2PRLA 1CBVL 5HGAB 5CHNA 1ZMYA 4G2DA 4KEMA 2NPLX 1XYMA 4C83A 3SKMA 4IRSB 1WA2X 3WJXA 4XN8A 5IHUL 3IJQA 2ODHA 1JSYA 3TK7A 3OZLA 3OG6B 1JHTB 1QUNA 1QQDA 1FYTA 3KYNB 3P2DA 4YGVA 5E70A 2IGLA 2BDNL 4K3EH 1XLIA 1Z3NA 4M5SA 1DQVA 1C5DB 3PV6B 1NDYA 1O9ZA 4NOBA 3GSRB 4I18B 1V8HA 5CJQH 3U46B 3D18A 4OCMC 4NX5A 3NURA 3REQA 5XIAA 5D32A 3ULVH 3KHJA 1G0YR 3HR5B 1GTNA 2CWNA 5C07D 1MG3C 3GSXB 1ZT1A 2RALA 5EO9A 3HNSL 1IMHC 3FO2B 3SDDD 4XK2A 4JTFA 5F1IA 4DKTA 3VFSB 4OGYH 3ARFC 3FO9A 3SE9L 1SNRA 3CHEA 1TJIL 4MDOA 1T66C 3RWJA 3ZDYF 5GGTL 2C9VA 4ZAKC 2H2PC 1XGYH 1BCIA 1MFAH 1XL9A 1J9TA 1T8XA 3VVVA 2PDPA 1MFDL 1W3NA 1UYQA 1R7OA 3NQKA 3VRLE 3IJIA 1BF5A 1CFMA 4N1HB 1A7OL 2FWSA 1UD3A 3RWEA 1SXBA 1C90A 2DH3A 4GINA 4WTQA 3VCNA 4MZ2A 3T6QC 5CIPA 2V3DA 3ZX1A 3AWEA 1BZ7B 1NCBH 1Z9AA 3VW3L 1SUHA 4MS8D 1D3CA 4X60A 1UP3A 4RWYH 2V5RA 4OF8A 1HXKA 1OYBA 1HINL 3MRNB 1FWRA 2X38A 1P4IL 4L1DA 2DMHA 4JJ5A 5E5UB 2CFFA 1X1OA 5EO0A 3NQFA 1JK9A 1ZT7A 1XGPA 1U6AH 3OGSA 4KO9A 3UTTA 4Y4FC 5AOJA 3IFNL 4LSSH 5TPWH 3KJ6L 4GE8A 4X2RA 2RR3A 3NK3A 2P42B 5DZLA 1W72B 3BDBA 4RRPG 2OTPA 5CJNA 4XVUC 4OKVA 5CD3B 2BIMA 3FLUA 3TUUA 3VFCA 1VEPA 2HP4A 3D4YA 3SCUA 1XH2A 4PJ5D 1BEYH 2BVEA 1NCWH 3CCHA 4PUDA 3D2TA 2EIMB 3KPMA 2HTKC 1OAZL 4P5TA 5AEAA 1U8IB 2F61A 2HJLA 3WE6B 3S1WA 3BZ4A 1DLFH 2BP1A 2BNRA 4O9HL 4MXQD 5ADOH 2GTQA 1II4E 4Z17A 3OPZL 2QHLA 2ESVD 2AK4A 2JIXA 2Z7ZA 3I2CL 3SN4A 3R0NA 3CX2A 5DLML 3PPEA 4H0IA 4YDZA 3QUYD 5HWJA 1FN4A 1FDYA 4KZDL 2O26U 3ZJAA 3TJXA 4A3QA 1BLIA 3DGCR 4FXGC 3LLDA 2ZRVA 3I9IA 3CSGA 5EUOE 4H44C 5F7HA 3MX0B 3IRDA 5DHDA 4N26A 2J7BA 4XVJL 4D6EA 3UR8A 3UO1H 4WSGA 4W1TA 5E5MA 1C9SA 1H6TA 5I07A 4NHUA 4QXTB 4KZ0A 3T4AA 3SUVA 1DQML 2GQ3A 3VGAC 3EYSH 2H1PL 4ZX6A 3W02A 3NN8A 5FDYA 3FTSA 4GSRA 2V5KA 1AZRA 4PG9A 2VCCA 3FUDA 1FP8A 4YDNA 2X4PA 3HUJB 4XP5H 3ZY7A 1KM2A 2E5BA 5CPSA 3GT6A 3WG6A 1JPKA 2KT6A 4S3JA 1I1FA 2GVJA 4XPGH 4JZNA 4HA1A 4R7NA 3D25A 3TXVA 3WFCL 4UNUA 4LCUA 3P61A 4NQDA 3OB0K 2WLJA 2NQ5A 2CLVB 2PXYA 3OO2A 1KFEA 1A4CA 3QEUA 4C56A 4HFUL 2G5WA 1JFHA 5GRJH 4GXVL 2IPUG 2CDFA 3SDXF 2CBUA 2YC1A 2F53D 1WO2A 5D2TA 1Q63A 2ZRZA 4P04A 3BXWA 1F76A 4PG2C 2A73B 2ZX7A 1U8MB 3BPNB 4X6DF 1EO5A 1A66A 1TJGH 1A6AB 1CYXA 3QIWC 1ILSA 3VD5A 4L8SC 5J12B 3DX4A 2IDQA 3S1XA 2WMJA 3MBWB 1RQHA 5DHVA 3WKPA 4NT6A 4K94L 2HLFC 3S35H 2BXYA 2I5YL 4FULA 1LD9B 2WJFA 2FRGP 3GNOA 4ZX5A 3RXZA 4Y19B 2OQJA 4AZ6A 3UAJA 5D1ZD 4DQAA 4KW2A 1Q6LA 5A6LA 1XINA 4LIQH 4XCYB 3WLBB 2HK1A 2B7NA 4UIMA 4RIRB 1K3ZA 4ZEPA 4K8RD 2XTJB 4JFFD 4Z7QB 4B16A 1HSAB 3OPUA 1PE1A 4E9XA 1WA0X 2KHAA 3KXFB 1CWYA 3W7HA 5C08E 4D8LA 2FO4B 1RQBA 3T0BA 4DI8A 7FABH 4O58H 3W2JA 1JZ2A 5TBOA 2DU2A 2JI1A 3CQJA 5E2JA 1H7OA 4S1DC 1DYZA 4JK0D 5ADPL 2F8OA 2ZUSA 3CPLB 1SSDA 4QJ5B 3IDMA 4AGNA 2X1OA 4WKAA 1CECA 4AEEA 4NXKA 3DX6A 3FO0L 2RH9A 5AZ2H 1C16B 4IJBA 5I6OA 4X6BA 2YWZA 3NIDE 3FO1B 1A25A 3Q8FA 1PYMA 1L0XA 4B96A 2PYEE 1LDSA 1ZHAA 3HB9A 4F33B 3QG7H 3SW6A 2QQLL 3E12A 3LQZA 3H9SD 1S8DA 4LCVA 2AEPL 3QUMB 4ZUUB 1S5TA 1A0QL 5D05A 3UTOA 1XIMA 1QG3A 1M3IA 4REQB 5EEZA 4LARL 5D2NE 2HA1A 4DWSB 3OAZH 4P5RA 4GI4A 5DQDL 3I74A 3DV6A 2AJSH 3U9UA 2AL2B 4BFBD 1X5MA 3WENA 4HS6A 5GHWH 2X1QA 1QABA 3EOAA 5D02A 4LF2A 3T71A 4ZFCA 4O1BA 4O16A 5EBMB 4OBSA 4AC2A 4BY3A 3EDKA 4GYPA 1W5PA 2QVIA 4IFOA 2G4GA 3A4DA 3BD4A 3SEPA 3GE7A 4DIXA 1QR1B 3NJJA 3W1NA 4EF9A 3NSJA 1SYVA 5GSVA 2FBJL 4K8RH 2X7VA 3V95A 1UYWH 2XDFA 4IF2A 3R94A 4E9QA 4O14A 1EJ7L 4WU7A 5CWSA 4IJRA 5GGVL 1SZRA 1T21A 2B16A 3GS6A 4W4OA 3DURB 3K5XA 5CN3A 5D5MF 4PIRF 2BTMA 4AG4H 2ROXA 3SODB 4ODUA 1EUUA 4FA6A 1SJXA 3P1VA 4LW7A 1WBHA 3GC5A 2PRHA 1RUPH 1GZQB 4OLVH 5E5RB 3EX3A 1DUYA 4AQEB 2Q9OA 4EAYA 1TTUA 1PFOA 1DZBA 3WY3A 5I1LB 4XUGA 4J1UA 4MX7B 3MLRL 3L0NA 2YRLA 3TBYA 1SXZA 3RVUD 5HNUA 2P0IA 1GC1H 1SBSH 2CNYA 5GXBB 1INEL 1CDUA 1N5AA 4NJIA 2H6UA 2C0AA 5D4YA 1AZVA 2JBMA 3O3EA 1MJUH 3LB6D 4YXLH 2D20A 2BOGX 3MBEB 5KTEH 5HHMD 4DX3A 2XRAH 4IDLA 4X8XA 2ID5A 4IOTA 4PP2B 3MNMA 1JAEA 3JTSB 4AQ8A 4MKMA 4YAQB 2MPAH 4KRPC 1A9BA 1LK3L 2WGNB 1DN2A 2Z00A 4GO6B 4QRPA 2EZ0D 1T5WB 4L1HA 4PBWD 3QQ9C 3V4VH 2ED8A 3MJ9L 4P4KA 1KD0A 2OZ4L 4G7YH 3BZJA 1UPMB 1ZSHA 1RZ7H 2BFGA 4GKTA 2I07B 1TO4A 1WAAA 2I32A 1S6NA 4QHPA 3WIFB 5D8WA 3JZYA 1KCSL 4WWPA 4ZMZA 2BCMA 1BQSA 3GS0A 1F86A 4XCCH 3ZMEA 4TNWK 2AXWA 3TKFA 1KPVB 3OKDA 2CR3A 1R9FA 3FUIA 5E4OA 1VPOL 3C6CA 5DWUL 1C08A 3MMUA 3ZZQA 5I1CL 1KEMH 2NY5C 5CJOH 5LNEA 4YDMA 4JN7A 5AVSB 3O3BB 2J7DA 1A47A 4F8TA 4NB7A 4I2XE 4NILA 4OM1H 5LBGA 1M41A 3ME3A 1H0DA 1HZHL 2G9KA 3W7MA 4PGBB 2ONEA 2W9LA 3VD2A 1I8MA 1T6BX 3ZE0F 1VGKA 3HG1A 1EJOL 4Q6YA 1RZFH 4AHOA 9XIMA 3O41B 4MY1A 5HA7A 4DO5A 3ITLA 1BIIB 1X5YA 3CBRA 5FESA 4HD9A 5FHAH 4JL1A 3GRWH 4OJFL 3WU1A 2VTFA 4PTUA 2MCPH 4JCWA 1M05A 4QHKI 4PW3A 3VNIA 1MCWW 4HFWA 1U8QA 2EE6A 1JPFB 3PWPB 5TIMA 2EUZA 3GK8L 5J9PB 3M6DA 4RGMB 3GXUB 3FSTA 2MKWA 2DZWA 1MEIA 1BVWA 1XFBA 1BP3B 3H9HA 3F5LA 3I68A 1MWAA 3P84A 1ZEAH 1Q65A 2A9NH 3AGWA 1HOCA 3Q6FA 3LRKA 3BCJA 4PFEA 4Q6JA 1EEZA 2BSSA 3TT1L 2O4MA 1ODUA 4D9RD 3DETC 4NHVA 3AU0A 3PGDA 3BVDB 1YJDL 4F0SA 2QQQA 3TO4C 4EOWL 1ZSDB 2WHVA 1Z66A 1QUMA 5BOEA 2DVUA 1QR7A 3MOQA 4A3YA 4G2AA 1A7QL 5DA4A 2BINA 3E74A 3K46A 2XLLA 5E24E 1V55B 4E3VA 5FV2A 4IBQA 5EBWA 2E28A 1CFQB 4GQ0A 1KGJA 5E5LA 2LLEA 1JL8A 5HANA 3ONCA 4WJKB 1IC0A 1UWFA 4XNXH 2NZ1A 3QYNA 4PFHA 3H9ZA 3UZYA 2X53A 4Y16A 1O1ZA 5IFHH 4HEMA 3E6HB 3WO3B 4NNPH 1B0WA 3FH8A 4K3EL 2XY1A 5A8MA 4L7ZA 2HRLA 2IH8A 5CJQL 4M1BA 3RR4A 2PR9A 3ULVL 4RAVB 4CSPA 4AENA 1OZTG 3W86A 4GT7A 4ZOEA 4FKEA 4FXFA 1HKKA 1UWTA 3URAA 5E6YA 3WH5A 3S8FB 1K85A 2ZA2A 4OGYL 3LHVA 3BZEB 1DVSA 3ZR5A 1K8XA 2K6YA 2IAMC 3P3YA 4L0PB 5F9WB 3PVFA 1DXFA 5E08H 2FB2A 5KOMC 4MCYA 3TN0D 2YXVA 3KWWB 1GYAA 1QFWH 4HLZH 1XGYL 2DJMA 1MFAL 2QGHA 4I6KA 3QJSB 4GMSH 5DHYA 4HV8B 5E2WH 2PLTA 5C54A 4N3TA 3RZCC 3MXWH 4WNSA 4WR3A 1P5UC 4ZGYA 3CFJA 1RZKC 2LLGA 2BK8A 3N2JA 5DMMA 3U25A 1UBSA 2BO0A 2BVPB 1P7TB 4TTDD 1NCBL 3PUCA 2G2RA 2EBNA 2HNEA 2WVVB 4QCIB 1FO0B 2R56H 1XR8B 4I9TA 1A6WH 3CZFA 5AZUA 4RWYL 5CBIA 4HAKA 4CEXC 1K8YA 3PS7A 4DBEA 3BP4B 3PWVB 1R3SA 2CG9X 4PRHD 1G0XA 4HSHA 3FQXB 3SRFA 2ZZ3A 5CLXA 3O8XD 1CDYA 1D5BB 4H2AA 3CHFA 4JMXA 1U6AL 3K4AA 5JNYA 4RDWA 3KPSD 1DQUA 1DOSA 4LSSL 5TPWL 3CZKA 2CGYA 3L4ZA 4PJFA 4AX7A 4QJ3B 4PH6A 1RK1B 3HS0B 3NJNA 3FU5A 2H3NB 4U5KA 1UH2A 4MD0A 2XIMA 1TYJA 3ITXA 4D9QE 3GMPA 4Y5XB 3BTNA 4P2VA 5JW4N 1GQJA 1S7UA 3WTVA 1G1OA 5TDPB 5CLYA 1E1CB 2BFVH 4WDTA 1BEYL 1BRLA 1NCWL 3KCPA 3UVAA 3LRSA 4N9BA 3RX9A 1VD6A 4CW1A 1H7WA 1DLFL 2E8YA 4BFRA 3X1BA 3NCBB 5ADOL 3PBGA 5JH2A 1P48A 3AG4B 5BPPA 1VYRA 3MVSA 1PGRB 1WV7T 3BOFA 1ZSXA 4MWAC 2K6ZA 2OTWA 1B57A 4MNLA 3RX5A 3LNEA 3P5ZA 4O2CA 3JWNG 1DDHA 4L37A 1VA9A 3AU1A 1CXFA 2EKJA 2JI2A 2GWNA 4NN6B 4GVHA 1L9MA 2F08A 3VXMA 3FQ4A 1GG0A 4ODXB 4GRLC 4Q9CA 3ETSA 4JFDE 3UO1L 2H0EA 1DQDH 5A2IH 3O06A 5AENA 1S78C 3RTQA 2B59B 4E9RA 1NIFA 4PGEA 4N0UE 1EGJA 3EYSL 4DGIH 2FJGA 2QPUA 1NFKA 2PTXA 4WW2F 4POCA 4P3DB 3TTQA 5F1UA 2KZKA 1M3JA 2X16A 3A3YB 3DRQA 1YAZA 3DFHA 4BE6A 1WBJA 3QARA 3OV6A 3TZFA 4H41A 4PHZA 4XP5L 2E5CA 3CFBB 3UOAB 4ZTPH 4B53A 3IS1X 1PKYA 1BYDA 1ZJHA 3CFKA 5B1AB 4XPGL 5EZPA 4F7MB 4U1NB 5DJ8A 2VOMA 4HHGA 5KYWA 2YPLE 1TQCC 3SAZA 3JWOC 3H54A 3H2OA 3MBDA 4QS5A 5GRJL 4QOKE 4OW6A 1EC7A 4TQIA 1Y6MR 3LZQA 1MQKH 4X8CA 1QSEB 3IE4A 4CLMA 3VC6A 1TJGL 1JNLH 1CL7H 3RDTA 3LOTA 3L3DB 2AQQA 2QT6A 4LJ3A 4LCYB 1BA9A 4CADA 1D9KA 2B5IB 2LQRA 3S35L 3ZHDA 3PRZA 4G1MA 3QISA 5FL1A 4G8EA 3FNDA 4P5KB 1L6XA 2BDQA 6REQA 4GY4A 4LIQL 4OCNC 4H7CA 4XX1G 4QP0A 1MJ8H 1XDTT 3TJPA 1YDPB 4XO4A 2HMID 1E5BA 2Y85A 3LCWA 3N41B 3R12A 2QGDA 2QCMA 2Y07H 4JNMA 5E8NA 2C26A 3O3AB 5CR1A 4H0GA 3DDMA 3T0DA 3QZ6A 2R14A 1R17A 3KH3A 3DUSB 2H9AB 1BLNB 4DGWC 4OZGE 2JELH 2V2HA 7FABL 1DEEB 2DBJA 1NBYA 2E7BA 3AB0B 4O58L 1KM5A 4DKFH 1VIWA 4KDTC 2BMKA 1EZUA 1UQSA 3HQNA 3QFJE 5B22A 2IQ0A 3BOXA 3VWKC 4IJTA 3C5JA 4YSSA 1TQXA 5JDJA 3M0MA 4GRWB 4L0ZA 3S6DA 4GG6E 3BV4A 1TG8A 4C60A 4OF5A 2G5UA 4PW4A 3ESPA 4KIEA 1BYPA 1SJAA 4F8XA 5AZ2L 3MRCA 3SUTA 1XKYA 4LLYA 2WOYA 4D2JA 2P44B 2GJ6E 1K5WA 5IHLB 4RISH 3QG7L 5H6HA 2G3MA 2PW2B 3OEXA 1E4XH 2J79A 2OYKA 3OHIA 5F89A 2X2JA 3NIGF 1XLAA 1J0ZA 1YY9D 3OA5A 4L1TA 4YEFA 3ETBJ 1CBVH 5LA1A 1GYLA 3RJOA 2ZADA 3W25A 2AJSL 3MLXH 4RBPK 2TMDA 3HMCA 5ABFB 2WQAA 5D7JD 4BSWB 5GHWL 5EU3B 4DAIA 1YEWA 4ORGA 1OY0A 2OL3B 4S2CA 1U8JA 1P4BH 2XINA 2X0SA 1MFVA 3D4GA 5HGBB 4M5TA 4PLKD 4P05A 3SUWA 2UWEE 1MZYA 3FCSA 3H6AA 5A8OA 4R2GB 3F7VA 4BQ6A 3B1TA 1XYLA 3H23A 4XE5B 5IBXA 3SIMA 4K8RL 3BWWA 1UYWL 2WKLA 1QASA 4EI6B 4K5OA 3QJHB 4Z76A 1UXWA 3W11C 3QUXC 5IG7A 3GHTA 2A83B 4AMAA 4ZI8A 1K7EA 2OK0H 3VC5A 3KPOA 5F7MC 1FNSH 2B77A 2CO4A 4U1HA 4AG4L 2DT2A 1FL3A 2ANUA 1TVNA 3GC2A 3L67A 2EIKB 1W72H 3MODH 1RUPL 3PBVA 4OLVL 4L61A 3IU3B 2GUOB 2ZKYA 4CNUA 1ZJAA 2R1LA 2OR7A 1HNFA 1U8KA 5SWSE 4KIRA 2VGGA 3QC0A 3TLRA 1GY1A 3WV0A 1KLGA 3FQ1A 2EPMX 1OHLA 1GC1L 3C9NA 3F7RA 1SBSL 4QRBA 2QJNA 2LAGB 1JZHA 1XF0A 3N6YA 4NNXB 4UTTA 4H13C 1MJUL 4MB1A 2Z65C 4YXLL 4D72A 5KTEL 2XRAL 4EXQA 5ETUB 5C09D 1UXSB 3N6JA 4G9FD 4F5CA 4EQ3A 4Y19D 4IXXA 4GIRA 4R3UA 3MACH 3B8YA 3T0EB 1FOBA 5DUBB 3T2QA 1S7SB 4GKSB 3V4VL 2PZ0A 2GK0A 4FR6A 2XTJD 4Y9EA 5CILH 1EUNA 2Q76A 4G7YL 4JTHA 1XF2A 2P46B 3MMWA 4D6HA 4FYTA 1RZ7L 4PJ9B 2DPKA 1TCRB 4F7TA 1DQQB 1UEMA 4Y9MA 4PRAA 4I5RA 3ZDYE 4GUJA 1MAMH 1T5XB 2Z28A 4BFIB 2DWYA 4F2UA 1X8FA 4LAQH 1G01A 3NL2A 5I24A 4GQBA 4XCCL 1Y8BA 2O55A 1OALA 1E8WA 1MSSA 4OIAA 3WO4C 4KCWA 3SJVE 3LI0A 2CRZA 3HMJG 2V5JA 1LO2H 4G59C 4B5XA 3G08B 5ENWB 4WDIA 1KEML 4RGOH 5CJOL 3RVVD 1JXFA 3ES8A 4JIQA 4WO0A 1LEIB 1IXOA 4FA3A 3LHUA 5ESAB 1C8QA 4O9HH 1FG2A 1UWXH 4OM1L 1LE5B 5IQ9A 3HO8A 2X7WA 5I1HH 1ZV5A 2E67A 1M6OB 2WK2A 1CN4A 5D7LB 3MV9D 2D03H 1RZFL 2NUTA 3B8DA 2WSQA 5EWIH 1D5XB 1XGRA 3BL3A 4NQXA 2CBTA 3EBHA 4KOBA 5FHAL 1WXYA 3GRWL 4KVNH 3PDOA 3DKHA 2H5UA 1HN1A 3FT4B 2Z93B 1RALA 2MCPL 4OZIF 1I31A 2Y70A 6PTDA 4AIEA 2XSAA 2GUUA 4D9PA 3CDGB 5DJCA 1NWRA 4P8UA 5AOZA 3ULSA 3AS3A 3EYOA 4D9LH 1AD0A 2A9CA 1U8CB 4BM7A 3DGGA 1WBXB 1A6UH 3YPIA 2YHGA 1W9VA 1DVZA 4ADTA 4ZSOA 3OB0H 4NERA 1S4IA 4IYKA 4FGMA 1PY4A 4JZOA 1AQKH 4O51B 5DQJB 1LQ2A 1RKRA 1ZEAL 2A9NL 1T1WA 3DMMA 3FT2A 5A6SA 5A1AA 1RK7A 3A4JA 1XH0A 3T42A 5BNXD 1YVLA 3BGFC 1OGAD 1IAIH 2P8LA 4HGWB 2Y3NA 4M61A 3MTRA 3BQUB 2MRYA 1L9PA 4HKZB 2D3NA 6TAAA 2VC7A 4PV9B 3IJ8A 3VTRA 3WLWC 5LIUX 4GXVH 2E77A 3N3TA 4GAGH 4LB3A 1WSST 3GBLA 1Z0NA 1PX8A 4BK9A 2QEZA 5KSBF 4OQTA 4ANWA 4MDRA 3TVMB 3KYOB 3P80A 5E00A 4ZMOA 4EP8C 5JXEA 4J2PA 4XNXL 5EH1A 2HPIA 4NQCE 7CGTA 1M7UA 3A3HA 2WNXA 3L66A 1EXHA 2CW6A 2Y8UA 2X28A 3PL6A 1VERA 3D85B 5IFHL 2KKQA 4NNPL 3MZGB 3FFDB 4JDZA 3JVAA 4TS6A 3GEFA 5E99H 3VXTB 5E4AA 1V77A 3GG0A 1IL1B 2WN2A 4XMWA 1L5GA 3HAEA 1CF8H 1SXCA 3PQYA 3R8HA 1H7RA 3O05A 3ARRA 1AHWB 5IR1A 1F97A 3OPSA 2X0YA 2VC2B 1XLMA 4KNUA 1XIHA 2OLDA 3M16A 3FK4A 1VFAA 5F7DA 4QAMB 3FU9A 5C0AB 3GMRB 1FDZA 5IWLA 5HYJE 1BGXH 3W39A 2QUUA 3JBG7 1KBJA 3ITTA 2AZAA 4DP7X 3AI0A 4YBQC 4BUGA 4APQA 5K39B 4ZD3H 3TFBA 3VG9C 4UTUA 1AHMA 3SDXE 1S2TA 3O9NA 2XH0A 5E08L 1JYWA 4LRNH 4BEIA 1QFWL 4HSAC 4X6DE 2XBTA 3T44A 4FE9A 4GMSL 1KIUB 4QRRA 5E2WL 3MXWL 4YDJA 4UTAA 3GR4A 1NELA 2BNUA 5IF0A 2WQ8A 2RUSA 2CUHA 2VLJA 1FV1A 3N1QC 4G6FB 3E0FA 4MCNA 3F5WA 1DP0A 3B8VA 3A4XA 4XIAA 1GQNA 3G0UA 4RDQG 2JFEX 2R56L 5D70L 2JKNA 1FDLH 1A6WL 5EUKB 1EJVC 3EMZA 1YUHA 4UM8B 5JQ6H 3VI3A 4GRSA 4DO7A 4PRWA 3N9SA 1JVNA 4Q4PA 1GVIA 2Z92B 1E4KC 4KRNA 1NGYA 1CE6B 1KIQB 5ICXA 4RX0A 4IMLA 1KTKE 4MYWB 3DJTA 1AGDB 1FKXA 5HJ3A 5EOQL 4U1GC 3PTMA 2Y69B 3INUH 4LUIA 4K7PH 2VXUH 2YSWA 5HHNB 1EP2A 2B14A 1CLXA 5IVNA 5I9QB 5EC2B 5B4MD 1ICSA 5SX5K 3QHTC 3BRFA 3HIJA 2A3HA 4GAYB 1AJ0A 4F7KA 4OZHF 3QXBA 4LYRA 2BFVL 1GOMA 4HKJB 4JM2A 2WJ5A 2BX5A 3U7WH 3HPZA 1XDLA 3SQSA 3IV8A 2IUZA 2DWXA 4HLEA 4PJ7A 5JOPD 3UZXA 4F3FB 5AW9B 2VEIA 4NY2A 4P2OB 2NSQA 4KTYA 2IPJA 1MRCH 3TF7C 3BD5A 1JN6A 2E9IA 1JS4A 1ZT4B 3OAUH 2F54D 1ZUAX 4LVOB 1AD4A 4KUCF 4M6AA 5ID1A 1RBLA 2X30A 3EYFB 4LOUD 1J8SA 2HQAA 4JQAA 4AQAA 5LGJB 5CGBA 1TXKA 1PD6A 4U28A 4HOWA 4G6AD 4BH7A 3TCEA 2XV0A 3E2SA 3EGDB 5K5YA 5C9UA 2A9MH 1QRKA 3QI9C 3WY2A 4IRJC 2PMZA 3HI6H 3O11A 2YLHA 1EVTC 3L68A 3LA4A 4GISA 4BCYA 5DQ9A 2XHYA 1OF6A 5MEPA 4FXLA 5FOBA 5M17A 4DGIL 3G3MA 2QT3A 3C5ZB 3MLPA 3BW2A 1HZYA 3PWUA 3KCLA 3GSQA 1I1AA 4IBSA 4DK3A 1J0IA 1WQVT 3U9PH 4H6RA 4L4TD 4E4UA 3HGRA 4KCUA 1ZS2A 3W82A 4KJWD 2YD4A 4CQBA 4ZTPL 1UPPA 3H4WA 4MA3A 4JFEB 2FDMA 4QRSA 1QW9A 1UWYA 2YL9A 2WMFA 3M44A 3NL3A 2BX7A 5KITA 1EEYA 1PPIA 2AF2A 4ZMYA 3IFOA 5D5ME 3DX8A 3LEXB 2OZ4H 3CV1A 1ED3B 4BH8B 1MVFA 3NDYA 4BKTC 3TLLA 1DN0B 1N3NB 5AW7B 1RUKH 2R24A 2UY7B 4O8AA 3DVGA 4Y5VB 2NY4C 3VZXA 5D4IA 1FC1A 3VXSE 3MV7B 4FQPA 1MQKL 1MEHA 3UJTH 3QG6B 1JNLL 3IWPA 3ROLA 5L9DH 2O6DA 4IBTA 1HCFX 3NZ8A 5C0BE 1ESWA 1JDAA 2E9GA 4P7RA 2EIBA 1T1XA 3RPIA 3FB7B 3N9GH 5FC9A 4BCZA 3I10A 4QROA 3FSVA 3CO8A 2K0RA 3U7AA 2XWBB 4G8GD 4X4MA 2QVFB 2XZ9A 3GC4A 1D5MB 3WQWA 1O5XA 2EDHA 1FPTH 2O5YH 3MRIB 3B8WA 2V5DA 2C91A 1BVNT 1Z42A 1MJ8L 4PJEF 2AQNA 4ZE5A 5IMMA 2F8QA 3O4LA 4BELD 2X6AA 2R39A 4ZW7A 1QNPA 5J06A 1HKWA 3DX2A 2Y07L 3G1XA 1HVXA 1VJIA 3BGGA 3DKLA 3H6JA 2AL1A 2ZQKA 2QS8A 1BYCA 3LKQB 2JELL 1RY7B 1JCVA 3A3XA 3AS1A 1WUNT 2UXVA 3V0VB 4IQLA 1HCZA 4CVXA 4DKFL 4BKLB 4HNTA 2FO1A 1ZGLA 1OD7A 5D2NC 2J1YA 5AAMA 3T2LA 2H8PB 3DTUB 1LT7A 1OTTD 2YSSA 5C6PB 3G6JF 3ZDZE 2ADGB 4KVCH 3TS8A 1OT4A 1EXUA 4DOHB 5AW0B 1Z89A 2CKNA 2OMUA 4Z7WF 1AY1H 4X5XA 4LEFA 1JDFA 3HC2A 2CLIA 2BOBB 2GITB 2ZCKH 3SCPA 3ZE0E 3LPWA 3CVHA 1N9PA 5D8JH 3B3BA 4J35A 3SDCA 3CFNA 2Q0ZX 2FL5B 4KXDA 1EBAA 2WQDA 4RISL 3BLDA 4UCGA 1E4XL 3TWAA 1SMAA 2PSNA 5EGRA 3BKMH 4KEZA 3FSWA 3H70A 1XXXA 4FDWA 4J23A 2OFQA 1DJYA 4HUVA 3QOMA 1L6ZA 4FQJH 4NOFA 4PS7A 4FQ1H 2X1IA 3MLXL 3IBEA 2F9RA 2PO6C 4X5LA 3EF4A 2WSKA 3D05A 4R34A 4RFOH 2A3AA 1P4BL 5AYZA 3JT2A 3QIBD 3O7UA 2X4NB 3QEQE 4XE0A 1Z9SA 4OD1H 4Q3MA 1FO0H 2ALWA 1H51A 4GCAA 1XYFA 3MRJB 2ZUQC 1KTNA 1V8EA 4HPHA 2WWKT 3RGVC 3CZJA 3FONB 1WH0A 3IDIA 2V68A 5D96C 2XH2A 5KVFE 1KYAA 5AC7A 4QHUB 2ICEA 4JZJC 4RCAA 4QF1B 4RZ4A 4UUJB 2OK0L 4WDXA 4ENEC 1FNSL 1AMXA 1J6OA 3IK4A 8PAZA 3ZE1B 1IR1A 4JQIA 1W72L 3MODL 1NIEA 3PHQB 2CLOA 2WD0A 1PF3A 2QGYA 4PEKA 2GCYB 4K68A 1GTHA 1U92B 2RA1A 4N2OA 1XF5A 4S1RH 4RXFA 2I25N 3LV5A 1QTWA 1R3WA 1XPYA 4IS6B 4NQTA 1F6YA 4JY4B 5DJZB 4KTGA 4A6YH 4KEUA 2OBGA 1VCGA 1GGTA 2Y61A 4PUKA 4JXCA 4FEIA 1CDJA 3Q3GB 2APWA 5HAOA 1EIXA 1ES0A 1QD0A 2OMTA 2I26N 1YZZA 2ZF8A 3L7FB 3TYAA 3QKZA 3BYTA 2OR8A 1E0XA 2EAEA 5EB9A 4MYAA 1OTUC 5GGVY 4UTBH 5GS1B 3MACL 4HG4J 4G9DB 3ZDWA 1JCYA 3K72A 1PCWA 2IPGA 3ELAT 2CSPA 2O9RA 3TAKA 4W6XB 3B7UX 1OXYA 1T6WA 5D7EA 1GWJA 3GM8A 5I0VA 4XB7A 5CILL 3VDHA 2EXOA 3DFNA 1R7AA 2I9UA 4PRRA 3ZZ1A 1ZPUA 1OCCB 4Q9RH 1MAML 4DP5X 3E6FA 1S7QA 4HIIB 4LAQL 4LLVA 2X4RB 1P9MA 2CYGA 2XVBA 1BVNP 1FC2D 3HTLX 4K37A 4HJSA 4PPTA 1THAA 1LO2L 1ASOA 4C4BA 2RJMA 4HWZB 4X0NA 4QS6A 4RGOL 4BK8A 3H6OA 1MRAA 4O2EB 2KDGA 4H9MA 4N2DA 3B9KC 2WMPA 1HEJC 3CC5B 4KO7A 3GTTA 1IZKA 5E0KA 1Y5XA 3DX7A 4JFZH 5I1HL 4ABQA 2AMUA 1QMUA 3IEAA 5CZKA 3AQDA 1QEXA 1EZVY 4DJFD 1SJBA 3APDA 2D03L 4AV5A 1AO7E 2BSBA 5EWIL 2I9LA 2YXMA 4IIHA 3AXLA 4WXZA 4EPDC 5SV3A 1C5BH 4KVNL 3MQTA 4B3LA 2XZZA 1CGTA 5GRWA 3AUVA 5G4MA 3R1ZA 2CHXA 2DL9A 1UD8A 4FQXD 5I0XA 3Q2NA 4ODHL 3CH0A 4H5SB 3PHSA 4M93C 3I4KA 4D9LL 4C47A 4PTNA 4DN4H 1T3FB 2YUZA 2FQGA 4Z2KA 5CZXC 5FA4A 4PZVA 3QQWA 1A6UL 2NNCA 3TFKD 2EKGA 2GJRA 2J2ZA 2GQAA 1A5LC 1E5CA 3AHYA 1QT1A 3T78A 3VA8A 1AQKL 1B88A 2LFGA 3GIQA 4OZFB 3D48R 2PZNA 3EKCA 5LHFA 4K38A 5CBAB 1TZIB 1M1BA 2PTTB 4LKCB 1FVEB 1IAIL 1I75A 4NUPA 9RUBA 1J5OH 5FW6A 5K9QI 3BGJA 1EGZA 2NYYD 2P5EB 4R27A 3SGEH 3S4TA 5IMOA 4QUOA 4Z7IA 1TEGA 5F9AC 2MUCA 4LASH 3UJSA 2ORBH 4B9KC 4TL4A 3R0MA 2XFRA 1BVOA 4XI5C 4GAGL 4AF0A 2VZOA 1WD9A 3W73A 4AK1A 3UTSE 1VZHA 1YMYA 3SBRA 1OL0A 1GAFH 1XGTB 3ARPA 2UY2A 1F3JB 5LCVH 1SFSA 3KYMA 4GRWH 4ZRGA 4YCPA 4DJDC 3ISYA 1EGVA 2NUWA 1LL7A 1KJVA 1KRAC 1CICC 1A5NC 3DCPA 4C1NB 1HO1A 5E99L 2KC0A 4HIJB 1JF1A 3ZKNC 1CF8L 3TAOA 1DJWA 1MCOH 2EDLA 1T04A 2VX7A 2VZSA 4C7FA 4DWHA 1AXSB 3I6SA 3JWNH 2P8PB 2DKMA 2GJPA 1Y5VA 1MEXH 5U4NA 1BGXL 2ISVA 1PAZA 4E2VA 4OUUB 4ZD3L 4NZ3A 5D1XB 2C34A 3NP4A 2XJLA 4J2XA 1IVTA 4LRNL 3O0RH 2ZBTA 4PB9H 3E2RA 4A63A 3B34A 3LQGA 4I13B 4OOZA 1UA3A 1OVDA 3HN8A 2ZP9A 3KVDD 1JR1A 5IK3A 3DPBB 3MSPA 3VNKA 3EH5B 2J25A 1EEUA 3G2GA 4UOJA 5GZND 4ZXBD 5GRXG 1N2VA 1BTMA 3S34H 1BZ9A 4YGAB 1R3TA 1AIFB 2BZNA 1J9SA 3QZBA 3NFPA 2ZUYA 3LV3B 2CLRA 1FDLL 3MJMA 1HXMA 4M8QB 1TJ1A 4AGLA 1D5ZB 5JQ6L 4JFXA 4NO3A 4OLWH 3RHWK 3BE7A 1X1NA 2ZXDA 2OMBA 3X17A 5MEQA 4O02H 3BWSA 2YWYA 3D39B 4C90A 2YRZA 4G8AC 4LEOB 4IGSA 2E4TA 4Z7OF 2ZXWB 4PTTA 3INUL 4K7PL 2VXUL 4LLWB 3AACA 4P23D 2GQHA 1BOGA 3NCFB 4RNHA 1RK0B 2Z1PA 4GOAA 4H8QA 3VFMA 2UYLB 5F4WA 1TPWA 3V5OA 4WHBA 3O07A 2G60H 1FCQA 4JFHE 1IQ8A 3MV8A 2K4AA 5EU7E 5BQ7B 5IJBC 1RZIA 3EFFA 4EKXA 3VXOA 3P4NA 5LDSA 2AAAA 1BX2B 2FJHA 1GT8A 3U7WL 2WXGA 1OSEA 7PAZA 3MTWA 4F0HA 2X4TA 1Q2SA 4WJXA 5HJYA 1DVFC 1MRCL 3MGTB 4JFVA 5CPMA 4X22A 1ZVHA 1UM6H 5CEXB 1XR9A 3QUHA 1F3XA 3M17B 2PU0A 2YDSA 3KOYA 3MA7B 3OAUL 4UTHA 3PSWA 4XPAH 2V3GA 3UNDA 1XB6A 3QYSA 3NFNB 3BIKA 3NIGE 2GC7C 4BUHA 4AJ0A 1IQDA 4L9LB 5FO8B 1PJWA 1ZNNA 1BVLB 2WJ7A 3CSPA 5D6DA 3COTA 3N42F 5DMLA 2JK2A 2NQHA 1RA5A 3UTQB 5BRZE 2A9ML 4CJ1A 1TQVA 3HI6L 4OGZA 3TVMD 3OQEA 2DQEL 4U4BA 2AKMA 5C0CA 1HH6A 3V6OE 2AZUA 3DJZA 5CD5C 1MY5A 3KCOA 4XH2B 2VT0A 3U9PL 4Q8WA 3GZQA 3LNFA 2V2DA 3P8JA 4YHPB 1WFJA 3X1NA 4H8UA 4A8NA 1HHHA 2DQCH 2C14A 3FXIC 4DY1A 4TMCA 2VGIA 3WFLA 3AVEA 3UWYA 3LMJH 2CAKA 4MJ6A 3SGJC 1HILB 1EJRC 3OGRA 5I06A 5C0AD 4FR1A 1B4JH 2Y25A 4NPKA 5ANMA 4GYJA 4XAWH 2CCWA 5HP5A 5DS8A 3TH3T 5FA3A 4WSJA 4X5WB 1QSFE 1RUKL 3DXAE 1PZAA 4X9HA 3FB5A 3GMMA 2R7EB 3S8GB 2RH0A 4M1DH 5HGDA 5G2IA 1YPZA 2Y5JA 2P53A 2A2IA 4IIQB 3UJTL 3RURA 1BD0A 4K7FA 2XVPA 1OAJA 1FTXA 1LO5A 4KJPD 3CWHA 5L9DL 3S6CA 1YO4A 3Q1SH 1NBQA 4MXVF 4K7YA 2V5TA 4G72B 1JPGA 1YQ2A 4Q4IA 1KTLA 4AYBA 2F9BT 3PBMA 3E0WA 3N9GL 4Q22A 5DT5A 4G6FD 1KGUA 5AB9A 1YPXA 1C7TA 1TENA 2FBRA 2X4UB 5T26A 4IGBA 1FPTL 2O5YL 5BS0A 2FPVA 1DWIM 1KBGH 1PLGH 2DTSA 3B9DA 3S36H 4DEPB 4R5VA 3SSZA 5BUPA 1IC7H 1ZIAA 3NSXA 1S7WA 2NX1A 2XG4A 3ZLFA 5A6TC 3GINA 3M1ZA 1YEHH 4HCIA 5DVKA 1VFOA 2WV3A 2YKKA 3V5FA 1IXQA 1CDHA 2OYLA 4JKKA 1CLCA 4PUJA 3ZJ7A 3HE7C 1IE5A 1ACZA 4AM0B 3M8OH 2RMNA 4BSJA 1SHXA 1FWAC 2X41A 1MCKA 2ICWB 5GGRA 1MCRA 2PPEA 4LH8A 3FB6A 2QCLA 2C79A 8A3HA 3PWLB 4KVCL 3L7EB 2E5EA 3WDPP 2CXGA 3D0VB 3GAKA 1AY1L 2XWTB 4R83A 2OMYB 2ZCKL 3ESMA 2BXVA 4AVOA 5D8JL 1DJIA 4FZEH 3B2MA 1BSLA 3RPTA 3QKEA 4XBEH 3FTGA 2RD0A 3UPCA 4YSAA 2CGZA 4JLRB 1JG9A 2W27A 5JO5B 2A6KA 3NA9H 1LEGB 2YJLA 3WD5H 1KWKA 4C59B 5IOKA 3UY8A 1DHKA 4B9ZA 3BKML 4I7ZC 2XT1B 2Z25A 4TNFA 4OZIE 2C9XA 1CDCA 1RJRA 3WSUA 2GSMB 3G5YA 7PTDA 1NIBA 3S5NA 2A74C 3NL6A 3GSNA 3QVAA 3V4PA 2P8BA 4FQJL 5T1MB 3QS3A 4FQ1L 3DIFB 1AH3A 1QI5A 1T0NB 5T1LB 5JBEA 3V6FB 4YX2H 1MUJB 3CVBA 4QEHA 2CIIB 1RSYA 3UEQA 4AOFA 3OYXA 4RFOL 3S6TA 1ZLVK 4EIVA 4MGGA 3IIXA 2CBMA 4MMXA 2TRSA 3I6GB 4OD1L 3U4KA 2VLRD 1FO0L 1S9XA 3LSOB 4ZMLA 4OT1H 5JLZB 1K03A 2V67A 1P4LA 3ZL1A 4YLWA 3EO0B 4C6KA 1TSHA 4FG2A 3NPSC 2E3ZA 4JKNA 3SPJA 5E6ID 2AJVH 1S3KH 4IBYA 4PY7B 3CX5K 1CFTA 3KW8A 2YBVA 5EFIB 3DX3A 1TZZA 1NAL1 1WFUA 2MANA 1INDH 3FCBA 1QRNA 2CHDA 1B0GA 4AY0A 1TTGA 3NCMA 5F2LA 1BQHA 1WAPA 5IBLD 4W5ZA 2VR6A 5A43C 4B9YA 4FXKC 2PODA 3G5VB 4QRQA 1M04A 3Q58A 4ZPVA 1PDKB 1RXLA 1RY8A 1P0BA 1IQWH 3FTVA 3BAXA 4S1RL 5KSBE 1LNUB 2J24A 5HMSA 4GUGA 4U0RB 4A6YL 5I1DB 3UMNA 5SWZA 4MJIA 2CZFA 5CINH 4XMKH 1ESOA 3VQLA 2PDNA 1FHDA 1OPOA 3K30A 3B5TA 1IBZA 1EOKA 5L2KE 1MI5D 5D70H 5HQLA 1K2DA 4KKPA 2X1RA 2O4QA 2IDFA 4Z3IA 3M43A 4UTBL 3BCFA 2BHUA 3B06A 3P3UA 2VEPA 3W1RA 3ABZA 3QQ4B 4EN3B 1SN2A 3K8LA 1EX0A 1B5TA 3QV8A 2X10A 3CHRA 1B3WA 1TELA 4DPPA 3JV4A 4F20A 3EGSB 3CUHA 4TNEA 3EOOA 2J8UB 5EOQH 4N9GB 3IETB 3MNVB 5FCZA 4U3AA 4WI9A 3G8EA 5JW4Q 3L95B 3V7AG 4NNBA 2Z27A 4Q9RL 1BG1A 3W70A 2VEGA 5DC0A 4GKNA 1BWVA 3V55A 2CM5A 2XGBA 3UBHA 3PIQA 4M62H 5D9OA 4NN5C 3QRHA 3E0LA 5MERB 2QR0A 3ALGA 2Y5TA 1TVBB 3U0TB 5GZOA 4ZXLA 4L3FA 3O3DB 3FOMA 4FK9A 4OZ4B 2I16A 4ICMA 3LY6A 4R3SA 2ZUVA 4MCZB 1T7VA 3DUUA 4MY8A 2F74A 2VZUA 2O61B 1Q6CA 3NEHA 3ARDC 5INCA 4JFZL 4KOCA 1JQXA 2INZA 2BIQA 3L5WA 4XNZC 2OMXA 3TN3A 4AYGA 1L6SA 1PX3A 3QT2A 5A2FA 5BZAA 3N4FA 2ADJB 3K2IA 1JXKA 2V3EA 5IEHA 3RY5A 3AQYA 5ISZE 5KS9A 2DJXA 2CLZA 2PLKA 3BI9X 1Y1UA 1C5BL 3SCQA 5CCJA 1E28B 4FADA 3ZU8A 1KYFA 4WXYA 4ILSA 4IHOA 1L4IA 2H90A 1HE7A 2YBGA 3BUYA 5FYJD 4GQRA 3T8LA 3G0XA 3FJ4A 4W9IC 4NZUH 2OXNA 1U33A 4P99A 4IRSD 1YEGH 1KFKA 4DN4L 2IEPA 4YSOA 4OZHE 2WB1A 5AVXB 3QPKA 2PA6A 2Q86B 1BXCA 3DERA 4ANUA 3A5FA 1FGNH 2J9YA 4UAOC 3EDJA 3DBXB 4H8WL 4IMGA 3KLKA 5LIYX 1NM4A 2XY2A 5C6TH 3T65B 4GKLA 4MMZC 4HCRA 3ZTEA 3TCXA 2ZRWA 4E4FA 3T0AA 5DCBA 5M5DA 3H3PH 1KB5H 3C12A 1FKWA 3DSNA 4AH2A 1OAKH 4G6JH 4URTB 1JIBA 1J5OL 4XB3A 4JICA 3URNA 2R2EA 1RFDH 1WDWA 4WV1A 1NGZB 2ADIB 1JXGA 3GBEA 2OTUA 4ACZA 1XRSA 2RDTA 1PVHA 5H4ZA 1XAUA 2V8ZA 4LASL 2ORBL 2W63A 1RERA 2BH0A 4FLRA 1SDDA 3U83A 5MENE 5E23A 3WLNA 4O0QA 2ZUNA 3L45A 4FEZA 1UWAA 1IB5A 2GUYA 3GNDA 1GAFL 1V7NH 3H4GA 5LCVL 4CMHB 4AZCA 4K3GA 4ZQPA 1SXSA 4BWLA 1KFJA 3MRLA 3TYUA 5CZSA 4JQXC 4L4VB 3KBMA 4Y7MA 3TLQA 3LDBB 1KPRB 3DHFA 1Z5YD 3PFUA 1KLUA 1MCOL 3A21A 1N7MH 3FDWA 2VQ4A 3BLPX 3FFCA 4EO5A 2X3AA 1NGWB 3RFZC 4WK2B 4KK9C 2O6FA 3WS3A 1BTCA 3L9RB 1WAAF 1MEXL 2BP8A 5FYJH 3UG5A 2QCCA 1YW1A 2ALAA 3BVWA 1JDEA 3JUGA 2Z1WA 1WZMA 3ZR6A 5HQMA 4TQHA 2NZ9C 3P2BA 4GACA 3O0RL 2IV8A 4FNPA 4V1DE 3DOSB 4PB9L 1HHKB 3VDAA 1AZNA 2Z8SA 1UOWA 3UW6A 2CZEA 2PU1A 3TA3A 3FQWA 1SZEA 2X1XR 4W84A 1IKNA 2XQ0A 5FEXA 4BQ3A 2DM7A 2Y7DA 1T22B 4HKBB 1OSZA 3S34L 3AZRA 5DRNB 1F00I 1BIHA 3ZXAC