2ZXDA

Alpha-l-fucosidase complexed with inhibitor, iso-6fnj
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
441
structure length
441
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 165
structure length 441
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxdA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxdA01
2CBVA 2D3NA 1ISZA 1BPLB 2WHMA 1Q6CA 3ZIZA 1BTCA 1M53A 3EDFA 3W82A 4HA4A 3W6LA 1J0HA 3AMCA 3WL0A 1VF8A 4GZIA 3W4RA 2O9RA 3AZTA 5JBDA 1CGUA 1R47A 3LMYA 1C90A 3NSNA 2XVNA 5F7UA 3VNZA 2FHBA 1BGGA 4OZOA 4DWSA 3W0KA 2VZSA 1DEDA 2F1AA 1K6AA 1UKTA 1VB9A 3HJEA 1GUVA 5M5DA 5AYIA 1W2PA 3MKKA 2WK2A 2XVLA 3WL1A 4JFUA 4GZJA 5D9MA 1NWTA 5BRPA 1TE1A 2OW6A 1V6WA 1ZBWA 5I6SA 4W93A 4NZJA 3ARYA 3CZGA 1V08A 3VDCA 2BY0A 3WQVA 5JBFA 3H55A 1ISWA 3OA5A 5A8MA 2V3FA 1C92A 3A3HA 1F4HA 5A6AA 2CERA 3AZRA 1VFOA 4Z2GA 5DF0A 1W32A 2Q8XA 4HOXA 4FF5A 2J7DA 3VGFA 4FNUA 2ZUTA 3ZSTA 3W26A 4K68A 4J3WA 1XYFA 2D22A 3ZJ7A 2CITA 1K9EA 2FHFA 3ARXA 5KZ6A 2G8ZA 3D4ZA 1WAWA 3BMWA 3VD3A 4YN5A 1PZ2A 3GXIA 4V28A 4CVUA 1FH9A 4CD7A 1W9UA 1TZ7A 4TX8A 1Y7VA 4U3CA 2E0PA 5JIWA 3WQ6A 4HZ8A 1GCYA 2E4TA 2F2HA 4MTVA 1HKIA 4PSRA 1HX0A 2NW0A 2ZE0A 2ZX7A 1QW9A 2YKKA 5A2BA 2FH8A 3A4AA 3S5YA 2F61A 3VIOA 1V6XA 1JD9A 2W61A 1BYAA 3IJ7A 3LPFA 1GVIA 4J7RA 4PMUA 4N0RA 1JAKA 2XFRA 3FN9A 3W29A 1HVXA 4UQDA 4W87A 3PTQA 3WF2A 1X6LA 2IGTA 2XWEA 4U5KA 4J3SA 1AQMA 2D0HA 4ZEPA 3UR8A 3TTSA 4HZ6A 4U3AA 1UD2A 2XN0A 4PUDA 1ZU8A 3W81A 4GO9A 3BC9A 5E6YA 3MMDA 3OB8A 3DC0A 2VMFA 1WZMA 3GM8A 4C7GA 2WBGA 1SFSA 4QP0A 4LPCA 2J62A 1UR0A 4JFTA 3WDRA 3IAPA 5A69A 1B3WA 3L4ZA 3DDFA 1OSEA 1OT1A 1B3ZA 3VD5A 1OINA 3NSXA 3MMUA 4BQ3A 4BQ2A 2XJ7A 1KGWA 4FNSA 1E6RA 4PTWA 4GPNA 1JZ6A 3ARPA 2WC4A 1HKMA 4UCFA 1VENA 3MV11 3WNMA 2CKSA 5CGTA 1C7TA 1UYQA 3SCWA 4CD6A 5DEZA 2OWXA 1JZ3A 3I3DA 3UERA 4B3LA 1OB0A 3FW6A 3J7HA 5CSYA 2F7QA 3WD2A 1UD4A 2OSWA 4UQ9A 1OD0A 3RDKA 1C93A 4GI6A 4UTFA 1LJYA 2CEQA 1G9HA 4HU8A 3CHFA 3AXXA 4D6CA 1PJ9A 4H2CA 2DSWA 2WC3A 3LRKA 1XH2A 1UWUA 2C0HA 7TAAA 3DHPA 3PZUA 1TQWA 2TAAA 3DDGA 5FIPA 2XYLA 3EMZA 3OZPA 1C8YA 1M04A 2EPKX 1GQJA 5BROA 1UD3A 4DO6A 4NSBA 3GBEA 4PYSA 5EMYA 3AXHA 4UFHA 1V0LA 3CTTA 3WH6A 4NRRA 3GXDA 1VJZA 1EXPA 3APGA 1CBGA 2J7CA 4OBSA 3UETA 1E43A 3VU2A 1QI0A 3CZKA 3VIPA 2CPUA 2DSKA 4IUGA 3LPOA 2WWDA 3GYCA 2V3DA 2EPLX 1W3LA 1E1EA 2YL5A 2WKLA 1TMQA 1LL7A 1BYBA 5I0DA 4PBGA 4ZENA 3D4YA 3ECQA 3CUHA 2DSZA 3OGRA 3BSGA 4MNLA 2AMGA 3RPMA 1V3IA 2A3BA 3MUY1 3QHNA 3F5LA 4IPNB 3PZQA 1US2A 3FAXA 1CYGA 2ZUNA 1C8QA 1UHVA 1BYCA 1WE5A 1F4AA 2XGBA 1QOXA 3ZJ8A 1WZAA 3EYPA 5HPOA 2F7RA 5A1AA 4CCCA 3CZEA 1DP0A 2YFOA 2GDUA 1V0MA 2A3CA 1UKSA 2YL6A 5I24A 4MAVA 1CIUA 1K9TA 3S5ZA 4JHOA 1V3HA 1EH9A 2WNWA 2NT0A 4OUEA 2DT0A 1E56A 3WEZA 5CPSA 1J0IA 4OBRA 3CH9A 4LGXA 5BCAA 1B90A 2VOTA 4U33A 3DYMA 3SUTA 3K1DA 4AIEA 1I1WA 2UY4A 4AZ6A 5A6JA 3VGDA 5M03A 2XGIA 2BXZA 2QPSA 1PS3A 2BVDA 1KB3A 3WQWA 1CGXA 1QBBA 1R46A 2OYLA 1CDGA 2BHUA 1VEOA 4KGLA 1V0KA 1HJSA 1LL4A 1KTCA 3PHAA 2VX6A 2XVPA 4RE4A 2VZUA 1KQZA 5D9OA 4PCSA 1QNPA 4Y7EA 1GJWA 1VJSA 2E9MA 3TONA 3VNYA 2EPOA 1GQIA 4DUXA 3VD4A 3AIUA 1FFRA 3W38A 2G3JA 2BNJA 2EADA 1DWFM 2W67A 1QNSA 3PZ9A 3ZJKA 1E70M 4PN2A 4BF7A 3MV01 3OLDA 3AFBA 3E1F1 5A8PA 1JDDA 3EDKA 4A3HA 5BXSA 3T0DA 3KWXA 4JKKA 1OWQA 1QHPA 4QLKA 2E8ZA 3N04A 5A6MA 3K8MA 4V27A 4NZFA 3AQUA 3NYDA 3VINA 4KGJA 2YL8A 1UD6A 1MVYA 3ZQ9A 4DWSC 4JL2A 2XSAA 3VMNA 4EANA 1J0ZA 1ODZA 1D2KA 1PIFA 5GNZA 4UQEA 3VGGA 3UG3A 5EFDA 4EKJA 4AC1X 4EE9A 3CZNA 1VFMA 1E71M 1NWUA 3SUSA 4GXPA 3WENA 3WDHA 1BFNA 4UR9A 1RPKA 1KR1A 3MMWA 5A8OA 1R8LA 3NUKA 4FLRA 1GPFA 3BLKA 3L4UA 1W1TA 3CV5A 2ZUWA 1VEPA 1MQQA 4AWEA 1DWAM 1MYRA 3II1A 2YDQA 2HISA 3CHEA 3WSUA 2E8YA 2VCAA 4W8AA 1JZ2A 1PPIA 1X1NA 5HOSA 3BVUA 3D50A 2WVVB 1EGZA 5C8BB 3RMEA 3DYOA 4HU0A 4IPLA 4UNIA 1E6PA 3SURA 3A47A 2FDMA 3N12A 3HG2A 1W9VA 1JZ4A 5CG0A 3BAJA 1UOKA 4KRTA 1JZ7A 1IV8A 2WVTA 4HOZA 3LX9A 3OLIA 1XC6A 4CU7A 2J74A 3ZMRA 5D9NA 3WUEA 1E5NA 5AC4A 4J3XA 3VDHA 2CXGA 5HBFA 5E0FA 1H4PA 1K9FA 2OW7A 5GQBA 4JCMA 2D0GA 3AS3A 4S3JA 3WH5A 3TTYA 2WC7A 3MUAA 3WIJA 2BY3A 2UY2A 1QVBA 1W1YA 4JZ5A 3BVTA 1R7AA 4J3UA 4NXSA 2V3GA 3OGSA 4B9ZA 5D8WA 2XIBA 1E3ZA 3VX1A 4TVDA 4ZE5A 1JI1A 2NSXA 1UASA 3LRMA 2V5CA 1CXHA 1WP6A 1XCWA 1C91A 2XHYA 1EOKA 2OWWA 3VIIA 3UG5A 1G1YA 2VZTA 2ZX8A 4EAMA 4Z2HA 3M6DA 3WD4A 4U2YA 2WMFA 1PAMA 4R5EA 3W27A 4H8UA 3EBVA 2YLAA 4PUEA 5AY7A 1B3VA 1E5JA 1R75A 1R33A 1GZJA 3JUGA 3MU7A 3N17A 4WKAA 3VPLA 2VR5A 2XN1A 1UQYA 1E15A 2ZWZA 1WKYA 4AD5A 2PB1A 2VZOA 3VMPA 1XCXA 2ZUMA 4WKHA 3WY4A 1DTUA 1ZBKA 5A6BA 3WUGA 3CUFA 1H49A 3LXBA 4Q7NA 3UESA 3WF0A 3TV8A 3CZ8A 3BVXA 2XUCA 4U2ZA 2DT3A 1G0CA 1BVZA 1TG7A 4B3KA 2C8NA 1TR1A 1W9PA 1J01A 3WEMA 3MSDA 4W7VA 2ZX9A 1WDRA 1U2YA 5CXPA 2V3EA 5IXEA 2F18A 4JFVA 2GVYA 1UUQA 2BS9A 2EAEA 1B0IA 1MW2A 4AYGA 4HMCA 1GHRA 2F7PA 2YOCA 4B16A 3OIHA 5BXPA 1TQTA 1XSJA 5I23A 5HNNA 4NI3A 1BF2A 2GK1B 4DM2A 4AZCA 1ZBVA 3WKZA 4P7NA 3A4WA 4URIA 1KQYA 5ABHA 5HDRA 2OYKA 3IANA 3AOFA 3PZGA 4CGTA 4OJYA 3WH7A 3IGUA 2JIWA 1Z32X 1H0GA 1RP8A 3A6OA 1E3XA 1UQZA 1OD8A 2G4FA 3SCQA 1E6QM 3IJ9A 1UA7A 2BVYA 2Z1KA 2DEPA 4OKDA 4W84A 3ZT5A 1QWNA 1UH2A 4E4PA 1TVNA 2EBNA 3GDBA 1UWRA 4TXEA 3SUUA 4MJ4A 4M1RA 3HG5A 1UR4A 4F8XA 3ZR6A 5CLTA 1B30A 2JIEA 1MXDA 5JIPA 1JAEA 2EEXA 3RJYA 3T08A 2VQUA 4Z2LA 4WLCA 1IT0A 3CUIA 1KR0A 3D52A 4AYSA 2WVVA 5A95A 1CNVA 2DT1A 3VSTA 2AOSA 1BVNP 2ZUVA 1E73M 2GDVA 4JFSA 3QOMA 1VFUA 2WBKA 2ZXBA 1E4LA 2FGZA 3FHAA 1JGIA 1CXIA 3CUJA 1QI5A 2WHLA 3QOKA 1V6UA 2J25A 5CJ5A 1V3MA 2ZUUA 2J7HA 2PWHA 5TD4A 1XV8A 3VDBA 1H09A 3K8KA 1L0PA 3RO8A 2VO5A 2VRKA 2W66A 3GXFA 4UOJA 5E9AA 1V3KA 4BZYA 4HTYA 1WZLA 5ABFA 4CU6A 2DSVA 4S3KA 3WBEA 5A6BD 1OGGA 3CZLA 3RM4A 3QR3A 5DT5A 4WSKA 4TTGA 3BAYA 3GXTA 1NWRA 4AZIA 3TP4A 1B2YA 2XN2A 4GINA 3VM7A 1JNEA 3KZSA 4AXNA 4CD4A 1LG2A 8A3HA 3A24A 5IFTA 1QX1A 2WCSA 3ARTA 4UOQA 2VX7A 3BAIA 1W3KA 1JG9A 2WKGA 4Z2JA 1KGXA 3O2LA 2ZX5A 4UQBA 3DX4A 4P7QA 3KLLA 1AVAA 1NM9A 1IZKA 2WPGA 4Q22A 4H8VA 2DIJA 3T0BA 4MNMA 3WH8A 4CVWA 4XV0A 1HJWA 4PMVA 3VIMA 1YQ2A 2G3IA 1QNRA 3U7VA 4YHGA 4LXFA 4FNPA 1XHGA 4ZXLA 4ATWA 2WMKA 3VTRA 2V38A 2QV4A 1KCLA 3CGTA 3AIVA 3AICA 2OLHA 1R86A 4GQQA 4W89A 2BHYA 4H7VA 1PEZA 4HPGA 3ARZA 3OLGA 3VSUA 1NH6A 5D9PA 3ALFA 4WKFA 1UKOA 3G6MA 4M82A 5E6ZA 3VD7A 1H3GA 1LG1A 4HMDA 1E6XM 3A5VA 1WZKA 2D3LA 1UA3A 1V02E 1R85A 1Q4NX 2X09A 1B31A 1CGTA 3KE0A 4W5ZA 7CGTA 2ALWA 3FAWA 4AW7A 1CXKA 1EIBA 5LA0A 1QI2A 1HJVA 1VBUA 3GXNA 5AC5A 4PMXA 3U5UA 5CLWA 1H5VA 3BAWA 1JF6A 2A3EA 3ARUA 4AZ7A 2IXUA 4W5UA 3WD3A 1NQ6A 4YHEA 1HJXA 3EJUA 2Y8VA 4JKLA 4CN6A 2O92A 1Q6DA 4M80A 1XD0A 2OYMA 3MI6A 1XH0A 4PRWA 2IUZA 1GJUA 3DX2A 3W24A 3OGVA 3DECA 3QGVA 1M03A 1UR8A 3MANA 5CSUA 3IJ8A 3RILA 1E9LA 1UZ4A 3VUPA 3B9EA 2Y2WA 3NCOA 1HKKA 2X2IA 1E6ZA 5BXRA 2XVGA 4Z2IA 2IXVA 2A3HA 3B9AA 4LYQA 3GH5A 2WB5A 1XD1A 1J9YA 3VGBA 2W5FA 3GNOA 3EDEA 4AIOA 4JKMA 2OWCA 1LQ0A 2ZIDA 1NOWA 2PI6A 3PZOA 1WDQA 5ECUA 4QAWA 1MWOA 1JF5A 2W4XA 5E1QA 1CLVA 1OIFA 1ZJAA 2VC9A 1HL9A 1ECEA 2Y24A 4UFLA 1U33A 1EA9C 4L4OA 3MS8A 1CXFA 1HJQA 5FOOA 3W6MA 1JZ5A 5FD0A 2GFTA 5JUVA 3CIVA 2XM1A 1ISXA 2YDRA 1H11A 2F7OA 2GUYA 2YFNA 4LYRA 4AISA 2BXYA 1CXLA 3AMLA 3CC1A 7A3HA 3VGHA 3VOCA 2E9BA 1JYVA 3WH9A 2J7GA 1LLOA 1E4NA 1W91A 2YLLA 3WBAA 3M7SA 4HZ7A 5ABEA 3ZSSA 4UFKA 1VBRA 4MJ2A 4GIAA 4WIWA 1CTNA 1CENA 3KL0A 3FNDA 4HP5A 4RE3A 2PWGA 1FH8A 1R87A 2WMGA 4N42A 4HMEA 5C70A 3VO0A 1GOWA 3N18A 4TVCA 3SCVA 3ARSA 1DHKA 3QHMA 1ITXA 2VTFA 4P7LA 1Q6EA 2PBGA 4ACYA 2CYGA 3VKKA 5KEZA 1AQ0A 1AMYA 1KBKA 1L8NA 1JIBA 3WNKA 1BG4A 2FH6A 4D6FA 2EO7A 3L4WA 4X0NA 1LL6A 2PBOA 1E4MM 4CCDA 1ISVA 1BHGA 3B8SA 4B15A 2EPMX 1GQLA 1GQKA 5CQ1A 2WYSA 1UH4A 2MANA 8CGTA 3D3AA 1CZ1A 2E3ZA 4P8UA 4HPHA 1PIGA 4KRUA 3BH4A 1HF6A 3OZOA 1XRVA 5BXTA 3CMGA 3WFLA 4CN1A 2J75A 1A3HA 1C7SA 3BUPA 2CBJA 2D2OA 3SUVA 2ZICA 4TX6A 1EQCA 4TUFA 4M29A 4H41A 4NX0A 3EDDA 3WNLA 3VILA 3BMVA 3WELA 5D8ZA 4TTUA 5BWFA 2XPKA 3A4XA 1UH3A 2VVNA 3WEOA 1UR1A 3CHDA 5IHRA 3LXAA 1KBBA 2BY1A 2VR4A 2WZEA 4JL1A 2WXDM 3SUWA 1OGSA 4UQAA 1CLXA 4HA3A 2QMKA 1JD7A 3GZAA 4OOZA 4PTVA 3ARVA 2F1BA 1R7OA 1G01A 1HWWA 3DYPA 3VIHA 1OBAA 1KXTA 2XSBA 2VX4A 4ATDA 2X2YA 2D73A 3U57A 4PMDA 1HN1A 3ZJ6A 4KMQA 2ZUSA 3AHYA 1EHAA 1TA3A 1W9BM 1W9DM 2XG9A 1HTYA 4KH2A 2OSYA 3M46A 4MDOA 3AHTA 1M7XA 2WAGA 3K8LA 3UR7A 3GXPA 1J12A 3AIWA 3AIEA 3RCNA 2YA2A 3WN6A 1UG6A 1PX4A 2YIHA 2EABA 1E40A 1XSKA 2ZXQA 3WNOA 3N13A 1JYNA 1CPUA 4BQ4A 4CUCA 4JFWA 4ZXOA 2CCRA 3F5KA 4AD1A 1IZJA 1TQSA 1E6NA 4PMZA 4AZBA 1JI2A 3OBAA 4CCEA 3L2LA 2PWDA 5GNXA 5CPQA 4U31A 3KLKA 2D20A 1P6WA 1ZS2A 4GQRA 2DSUA 3T09A 2VUYA 1UKPA 2EACA 1RH9A 3W28A 3BUIA 3I3EA 4J27A 4XUYA 1B3YA 3WY1A 1E0WA 4MPKA 1E72M 1HKJA 1JDAA 1NP0A 2DDXA 2WSKA 1QHOA 2BVTA 5ABFB 3VD9A 2YDSA 1B9ZA 5DO8A 2YBTA 1BLIA 4IM4A 1I1XA 5I5RA 3TTOA 4FLQA 1MW3A 2ZXDA 2GJRA 3WF1A 4P8WA 3H54A 3EJTA 2GJPA 2VL4A 2VCBA 3CHCA 4P7RA 4IISA 3WQ4A 3LRLA 1E55A 3T2QA 3KEHA 3EJPA 3AIBA 5EB8A 2WW5A 1GW1A 3EJRA 3K4DA 2E40A 2X0YA 2FGLA 2VZVA 1KCKA 2WHJA 3CUGA 3VSVA 2WCAA 1E6SM 1I75A 2QHAA 5FL0A 3IAQA 2DT2A 3WY3A 4CD5A 4W7UA 1CGWA 3WNPA 1W1VA 4QLLA 1V3JA 4AY1A 1HL8A 3UEQA 2GK1A 1R34A 3MUIA 1B3XA 3NDYA 3BAKA 1CXEA 1J10A 4F79A 4P7OA 3O9NA 2W92A 1MW0A 3HG4A 2UY5A 3BAXA 3AROA 3EMCA 1KWKA 4ML4A 3AJ7A 5DMYA 4NXKA 4M24A 1SYTA 3TA9A 4XX6A 1FHDA 4RL3A 3NIYA 1KXQA 2VQTA 2ZOXA 1GVYA 3FY1A 1ZJBA 1JXKA 1TCMA 1GORA 3WUFA 3PTMA 3WMSA 2XTKA 3N11A 1H41A 2X05A 4AZHA 3RM9A 4PMQA 2C7FA 1VRXA 1J0YA 3PZTA 2CBUA 1X6NA 3LXCA 3POHA 3WQ8A 3T0AA 3ZO9A 4QLJA 1QI4A 6A3HA 2Y8KA 1LWHA 4AIUA 4M56A 1XGZA 3U5YA 3A23A 1WPCA 5M3WA 3BCFA 3VGEA 2RGLA 1OT2A 1VEMA 3WD1A 2J47A 1PZ3A 1VIWA 1JDCA 3G6LA 3BUDA 3AMDA 4AD0A 1OGBA 2D1ZA 1QNOA 5I2UA 4CU8A 3FXYA 3L4YA 4AEEA 3SCNA 4W88A 4AEFA 2BFGA 3PZNA 1NARA 2WM0A 4DUWA 3RIKA 1RD6A 1RP9A 3WDQA 2NT1A 4GO8A 2WHKA 1NOFA 4DWSD 4E8DA 3CZJA 4D6DA 4PMRA 4MNKA 2UY3A 2V5DA 4F66A 1D3CA 2VURA 2VRQA 1U30A 4AD2A 2YBUA 3BLPX 1V02A 1QI3A 2CNCA 2WCGA 4GI8A 2WMIA 1CEOA 2WWCA 3ZM8A 5I78A 2AAAA 3DHUA 3WMCA 2GJXA 4UFMA 1UWQA 3GNRA 4TOQA 1V0NA 3W53A 1KGUA 1ISYA 3AYSA 1JYWA 4J3VA 2J7FA 3F4VA 1MXGA 1EO5A 3D5HA 5M17A 1CWYA 4WF7A 2J7EA 5A8QA 3S2CA 5CZKA 1G94A 1H2JA 3UCQA 1ODUA 3PN8A 1DWHM 5IFPA 2UWFA 1UZ1A 3VMOA 1WO2A 4F9DA 2J8GA 3HG3A 4RE2A 1WB0A 3SCSA 4UOZA 3ARWA 3N9KA 2JE8A 3IK2A 3AHZA 4DM1A 5FKYA 1PX8A 3N15A 1XH1A 2EJ1A 1K9DA 4MAZA 1TVPA 4LQ1A 2B31A 4JHZA 4MADA 1EDQA 4MB3A 3EDJA 1SMAA 3BVVA 4DO5A 2J4GA 3TOPA 2RGMA 2JEQA 1E1FA 4BA0A 2JALA 3AHVA 1HT6A 1QBAA 2X8RA 1UR2A 5A94A 4UZUA 1DWGM 2CHOA 3CZSA 4FLSA 2CBIA 2ZX6A 2JEPA 1C8XA 4JAWA 4CD8A 5IDIA 1VAHA 2QMJA 3ARQA 4P8XA 1GOIA 2QF8A 4E2OA 4D71A 3T2OA 3MO4A 5EBAA 2ZWYA 4AMXA 1V03A 1HIZA 3OG2A 1QHZA 2CETA 3NSMA 2D0FA 3KL3A 3AYRA 4BCEA 3GTNA 1HVQA 1KFWA 3BXWA 1QW8A 1PBGA 4OOUA 1JXJA 1M01A 2WLYA 5E09A 4GKLA 1LF1A 1FH7A 4MB1A 4AD4A 1KXVA 2X2HA 3CBWA 3K46A 3RM8A 4TVUA 2VT0A 1AQHA 4HA1A 1WDPA 3I3BA 3SCTA 2O9PA 3GH4A 5C71A 3T2PA 1H0IA 4D72A 2X1IA 2ESCA 3RJXA 3WNNA 3TTQA 4EK7A 4PMYA 1NOUA 4D6JA 1GNXA 5A3HA 3EMQA 4WK9A 1LWJA 1VFFA 4BQ5A 2PWFA 3K4AA 3QHOA 2Y4SA 3CPUA 1W1PA 1WCGA 4X0VA 2CESA 3AS2A 3BGAA 3GBDA 2O9OA 2G41A 1Q6FA 1HP5A 3N1AA 3NJ3A 4FNTA 3U7BA 3AHXA 3HZ3A 2PC8A 4U5IA 4GI9A 2A3AA 4PMOA 4W86A 2VVSA 3EJQA 2J79A 3HMCA 3BLBA 4WSJA 3MSGA 3KL5A 1C3FA 3BUBA 3F5JA 1V3LA 3SCPA 1E0VA 2DIEA 5D4YA 1FP9A 3ALGA 1GOOA 4QCFA 4JCLA 1TFVA 4KWUA 4W8BA 2WMJA 3SCOA 2G3NA 1XYZA 1JFHA 5DFAA 5A2CA 3VVGA 1W3JA 2VNCA 4OIFA 1UD8A 2DQXA 1CGYA 2XFFA 4FK9A 3VDAA 4NRSA 5E0CA 4AD3A 3AIRA 1J18A 4MDPA 5GNYA 4LYPA 3WDPP 1BGAA 1SR0A 3WY2A 1B1YA 4UZSA 4HOWA 4F9JA 2YL9A 1MFVA 4V2XA 2YA0A 2W62A 1DWJM 4XB3A 4ACZA 4CN4A 1HXJA 1G5AA 2YJQA 5BRQA 3PBGA 4ZE4A 2W91A 1BG9A 1BSIA 2EQDA 1ITCA 3WDIA 1O7AA 2WLZA 3ZOAA 2WSPA 3W25A 2XVKA 6CGTA 1EOMA 3VIGA 1BQCA 4H04A 1EDGA 2BV9A 5BYWA 5CPTA 4J28A 4W8LA 5FL1A 2WVUA 2DGAA 2XM2A 4FNRA 3A22A 1SMDA 5I77A 1JFXA 1O6IA 1US3A 1MFUA 3AISA 2FYVA 3WDJA 4QDMA 1W2VA 3SCRA 3ZT6A 1TUXA 2J78A 3AZSA 3GH7A 3ZT7A 2J8FA 3NDZA 1HJUA 4MB4A 1ESWA 2QPUA 3OLEA 4B9YA 2F8QA 3HN3A 1UWSA 3SCUA 1JL8A 2W63A 4P8VA 1FP8A 3AMKA 5A6SA 2VCCA 4AZCB 5CGMA 4ACZB 3HU7A 2FHCA 4D6IA 4FNQA 4ZFMA 4PEEA 3LPGA 1TA3B 3O6AA 3DX3A 4DO4A 3SEPA 1N82A 3WF4A 2VJXA 5EFFA 3CMJA 2EXOA 1EO7A 4D6GA 4D1IA 2XIIA 1UKQA 1W9XA 2D24A 5HPCA 1KTBA 2J7BA 4M81A 1UWIA 2PWEA 2Z1SA 4CKQA 1J0KA 4JIEA 4E8CA 1UD5A 1TQUA 1MW1A 5DT7A 2X0HA 2Y5EA 4W7WA 4NF7A 4NZCA 2CKRA 4D6HA 4LX4A 4D6EA 4XZWA 1A47A 3WF3A 1JNDA 3B9DA 2J77A 4PCTA 1GOQA 2WANA 1E4IA 3THDA 1S46A 2WZIA 5GPRA 3WD0A 1HXKA 2QLYA 2WZHA 3L2MA 1FOBA 1E0XA 4AZ5A 3CO4A 3M07A 3VM5A 5A2AA 1GONA 2DH3A 3BSHA 3UG4A 1GOMA 1JYXA 1J11A 1OM0A 1FA2A 1GHSA 1H1NA 1CGVA 4BS0A 2GSJA 5I3DA 1HNYA 5A8NA 1WDSA 4R27A 1QPKA 4X9YA 2XFYA 1EHNA 3AMGA 4GZEA 9CGTA 1OIMA 5LA1A 1OCQA 1BAGA 2PF0A 3WMBA 2DH2A 4M8UA 1V6YA 4QCEA 3PZMA 4PTXA 2HVMA 4L4PA 5HXMA 3PZVA 1YHTA 5A6KA 3WQ5A 3AS0A 4QFUA 3L4TA 1PX3A 2DPEA 5A6LA 2CHNA 4AMCA 1SZNA 5ABGA 2WMIB 4W85A 1EQPA 5LA2A 1QNQA 3PZIA 5AYBA 2VRJA 3BUQA 4ATLA 2VI0A 1Q6GA 4DUVA 3GNPA 2BY2A 5IHSA 2EPNA 1UR9A 2WVSA 1ZBCA 2ZXAA 4C7DA 1MQRA 4D1JA 4UFIA 2X2JA 3H53A 3AIQA 5LYRA 3DX0A 2BHZA 4YPJA 2OSXA 4H8HA 4UQCA 4AZGA 1NWSA 1O7DC 1KXHA 1QWUA 3D51A 1MQPA 4WJXA 3VIFA 2VX5A 3BCDA 2D23A 3GXMA 2CIPA 3THCA 1XSIA 2E9LA 1CECA 4MB5A 3ZR5A 1BYDA 3L4XA 3ARRA 4Z2KA 1EDTA 5E70A 3DX1A 2WMHA 2XWDA 1GOKA 1W3HA 3POCA 4MNJA 1DWIM 1D7FA 3VX0A 4FLOA 3W37A 1WNOA 2JF6A 4OGZA 2FE0A 1JZ8A 1TQVA 4DWSB 4UFJA 4FMVA 2JF7A 4XZBA 5FCZA 1NP2A 3WUBA 2YA1A 3A21A 6TAAA 2JFEX 3VIJA 3LPPA 4PMNA 5I79A 1FFQA 2G3MA 1ZB5A 3SIMA 4PSPA 3PTKA 4J3TA 3S6TA 3AXIA 3MUZ1 1FHLA 1V6VA 3FHQA 3BVWA 1UWTA 4A3YA 3CLWA 3EJSA 4A4AA 1T0OA 4AMWA 1J0JA 2GJXB 3VIKA 4PTMA 3L4VA 1ZL1A 3WFZA 3AI0A 1HP4A 2O9TA 3AS1A 1KWGA 4C7FA 5JBEA
chains in the Genus database with same CATH superfamily
1BGXL 5T1MB 4QROA 1BPLB 4FXGA 1JHTA 5DD1L 4WV1A 4XNMA 1Q6CA 4IL0A 1FVEB 4UDTB 4UIKL 2C1PB 2Y7OA 3EDFA 4UQIM 5AC8A 4HA4A 3PIQA 3RNQB 2L0DA 2MQ0A 1OEZW 3C6SB 1X4ZA 1AYRA 3FUFA 2G0LA 4LOFA 4ZFZB 5SWZB 3WCYA 1P4CA 3AMCA 1N26A 3FJLA 2E9WA 3LKSA 4Y7MA 3E9AA 3W4RA 1I7RA 4ZO6A 3EGSB 4X6DA 2GQ8A 3L1OL 3AZTA 3F5LA 1JCMP 1GRWA 1R47A 1SQ2N 3MLUL 5DZPA 1C90A 1CFSB 3V0HA 5F7FA 1SY6A 2XY2A 3D6GA 2AW2A 4JVWA 5F7UA 2BJML 2YGQA 1HCZA 2D9CA 2WLLB 5J5EA 2FHBA 3MLZL 4HH9B 3FSUA 3F7LA 1JZFA 4OZOA 4PBEA 3OXRA 3VZYA 5KOMC 4TM9A 2VZSA 1DEDA 3WQWA 4J5VA 3HLAA 3NN8A 1DSFH 1S5MA 1A5NC 3E96A 3F03K 3HJEA 4L4PA 3C09C 3M8OL 2J2ZB 3DGDA 3ZZLA 1A0QH 4OM1H 4M6UA 3GC4A 3DKLA 2K78A 3TH2T 4E9XA 1S7RA 3KYNB 4O58L 5HGHB 2ATSA 3E2QA 1KBLA 3NJXA 4XPTL 2PP9A 3II2A 1W2PA 1J96A 4OH2A 4HWBL 2O56A 1V79A 1F58L 1AY1L 3CFBB 3L5WB 1E5YA 5E1IA 3L5XL 4MDJB 3T65B 2F6UA 5D05A 4DI9A 3RWDA 3PR2A 3WLRA 2PFHA 5BRPA 4XO8A 3S98A 4AYMC 3QZBA 3KWWA 2RALA 3HNVL 3IRCA 2Z4GA 1AGCB 5E4EB 2QEZA 3FU3A 2BY0A 3WQVA 3O4LE 4JGUA 3TZVA 4F58H 1C92A 4XZMX 1F4HA 2IDSA 3M43A 3QUYC 4C59B 1SO6A 2YPVA 4HFWB 4OIAA 4PLJD 2CLEA 2W88A 5DY3A 5J5RA 1EJSC 4K94L 1F76A 1C9DA 4RBPH 3M7FB 4Q6JA 4R6UA 3B3DA 1L3WA 5KVDE 1DN0A 3L16A 4S1QL 3HG1A 3GINA 2EKGA 4OAWA 4FF5A 3MKCA 3LV6A 4OCSH 1YMHB 4OTXH 3DX8A 3WTSA 3FQWA 1D5BA 1NFBA 2ISVA 3IPWA 5I3IA 1IGCH 3SBPA 3KPMB 1T1XB 1IAOA 2GT9A 2CITA 2A5HA 4HQQH 1AGDA 5HHME 4MZYA 3MJGX 1SSGA 2NX9A 3LQGA 3II3A 5IROA 5JVLA 2ZKMX 3LMYA 5DEGB 5AW0B 2EXTA 2J3SA 1JTPA 2GG1A 3PU7A 3APYA 4FQ1L 4IYKA 5DD6A 1IAIH 4LLMB 5D6CA 4AJVA 3TXZA 3Q9PA 4LASL 3QNZA 3MZTA 4JN2A 4M03A 3P2DA 1GOGA 4DGIH 5A7BA 1BWMA 4MTVA 1HX0A 2RDUA 4DFHA 2BRRH 3EADA 4LGPB 3JV0A 3N1GC 5FO9A 2ZE0A 1F8TH 1QW9A 2UY7A 3ARDC 3DJZA 1VKXA 2ZSVB 3ILEA 4G80A 2FH8A 3QS2A 5KBKA 2YXXA 4NOBA 2WOQA 3TNBA 1QO3B 4C4UA 4KQ0A 4ZUTB 2PPFA 1V6XA 4IIBA 2W61A 1CJYA 3HEIB 1SJEB 3A67H 4I89A 4E0RA 1GCFA 3INOA 3LPFA 1GVIA 1I85C 5H37A 5I1HL 3C9NA 4PV9B 3VK5A 4P99A 4M6VA 1BYOA 2ZCLL 3TO4D 4MNQA 3T0EB 4KFZC 4N0YL 5GGSA 5BRZD 4DNHA 2Y7MA 4G5AA 4QRUA 4GW5B 5E00A 1T1YA 3UTTA 4LIQE 2CGZA 3P30L 3SDCD 3WAJA 5CCKL 1YKWA 2Z7GA 3WBYA 1JAKA 4BHUA 3MRRB 3V0FA 4NZTH 5EO1A 5EOTB 1KG0B 3W29A 1HVXA 1FNFA 4FQIH 4OFYD 1KJMA 3PV6B 2FEJA 3SPVA 4D2NA 3QJAA 1N67A 2XDHA 1ONWA 5F7BA 2WLJA 4JO2H 5IFJB 4LNRA 3IDXH 5IQNA 4ABUA 1VQTA 4W9KC 5DUPH 3PSVA 4GKTA 3B03A 4DEPC 3BW3A 4FABL 3U8GA 3E0IA 4NAEB 5FO9B 1JGMA 4URTB 2IGTA 3MJWA 1NAL1 2WO2B 3L1EA 1G6RB 4X5PA 5C8JA 1MCDA 2P8BA 4DF1A 2E77A 1AQMA 1BXUA 3E6HB 4HUXA 2OSLB 3QG6B 1W3NA 3MCKA 1QPOA 1JK8B 3R5EA 3UR8A 3D9AL 4GIPD 4K9JA 3TT1L 3CFBA 5K9KA 4JG5A 2ZOLA 3UAEA 4IOIA 4HLJA 3W81A 4BH7A 4M8QB 2DZAA 3C61A 4WSHA 4B2DD 1LK2A 3MMDA 1IGTB 5GSVA 4NILA 4E41A 4GAYA 4AKQA 2C6QA 1ASPA 1BXVA 3KVMA 5ID0A 3CQHA 3N44F 3MREB 4DF2A 3V5KB 1J1XH 1F3JB 1YA5A 5D1ZA 2PDJA 1KB5H 2Z91A 5CKAA 1DLFL 4AC4A 1G4SA 2ZDRA 4N2IA 3PL6D 2MRYA 2IKJA 5T1LA 4LPCA 2XACC 2B20A 2FL5A 1EYEA 5DT1H 1Q4WA 4G5ZL 1IT9H 1UWXH 2IJ0C 2KZBA 3CFEA 3PV6A 4GYBA 4KKLC 1ED3B 1NDTA 2VXQH 5EU4A 2J62A 3G5XB 4WEBH 4JFTA 4OE7A 1YNTF 3PPCA 3WDRA 4JTUA 4GKNB 4JZNB 1S8DB 2WLIA 3VE7A 3TJEL 1I8KA 1O5RA 1OT1A 3DVIA 2OK0L 3WLTA 4O2FB 3DETC 4A2FA 4PMJA 3NJKA 1OINA 3GLDA 4LLVB 5F88A 3NCFB 5T5NG 1X7QB 1OAYH 2NXZB 1JZGA 3OGOE 4CAGA 1OARL 1UWXK 4PLKD 1KGWA 4FNSA 4PTWA 4BV1A 2SFPA 1FV1B 2O5ZL 4GKOA 5K69A 3R4IA 3PL6B 3QFGA 3QQ3A 4M8VA 5AAMA 4LVOB 4WCJA 4Z7NB 1DVZA 5IMLA 4ZFOB 3L0GA 3H0TB 3HZKB 4ZR8A 1E4KA 3G7TA 3ZYIA 2OXHB 4FHBD 3GD6A 3THUA 5LAPA 1OOAA 3RVUD 3Q8CA 3V95A 5BUGA 1ZK5A 5DANA 4WGXA 1DVUA 3B9KC 4OLZH 5E8DL 4BUQA 4QLWA 5HYSA 4C6EA 2BOBB 1WCBB 3WNMA 4GCAA 4Z5RB 1RPXA 2DYSB 1TPDA 5IBUB 4CD6A 3L68A 2P0OA 3WJSA 4N85A 3WSQH 1JZ3A 3VNMA 2VH5H 1KRAC 3UERA 1SZFA 4Y89A 5CN1A 4FOUA 2CQVA 3J7HA 4AGOA 3CDGB 5CSYA 4L8DB 3RG6A 3FT3B 1J87A 4I85A 3WD2A 5HGBB 1N59A 3QCTH 3PC0A 1EGJL 1M6OA 5H35A 5LKNA 3BANA 1T0MB 1IEBA 4DN3L 1C93A 2VERN 5FF0A 5ADPH 3BARA 1LJYA 2NQHA 4ROQA 1OQOA 5DD3L 2E4FA 5C0BE 1U8MA 2DSWA 2R1WB 4N8VA 1HO4A 3HC0A 2ZPKH 3LRKA 2WC3A 4QHLA 5I1GL 1X5KA 2AJZA 3A6CL 5ABDE 3A4DA 1VESA 3O8XA 3DHPA 4LAMA 3U7WL 1DJSA 1XGYL 3GM0A 2GOUA 3NZ8A 1TQWA 3VFMA 3TJHD 5J06A 2OL3L 2JQAA 4HFUH 4UTJA 2O61A 3MRCA 4GBDA 2IFFL 3P3RA 2W1NA 2CDGA 4G9FA 4WKZA 4OM1L 4GH1A 3U4BH 2KLRA 3QO1A 3MPCA 3ORJA 3EMZA 1M04A 1CBJA 3AWOA 1EJFA 2ZNXA 3BFQG 4HZLA 4RFEB 4NSBA 5BROA 4PRRA 2NQ3A 2AK1H 1H7XA 4W9EC 4QGCA 4A3UA 2X1XR 3KJ6H 2HEJA 2E6PA 4GRWH 2IAAC 3JBG7 4H6KA 1V7NH 3CTTA 3L3HA 3VFOA 3MLUH 2AERT 2DQ6A 2W80C 2JFCA 5IVZA 4KJPC 4NRRA 4WEVX 1JGEA 4X8GA 2P46B 4JX6A 3FFDB 5DMGC 3SHSA 4NZRH 3T6VA 4XMPH 3GMRB 3NMEA 4PVLA 4KKNA 3VD1A 3MRMA 4OBSA 4QTFA 5LCVL 3RX9A 2J7CA 1NCUA 3X2QB 4H9ZA 5DQDH 4ZZ9A 1E43A 1LO5B 2P9RA 3ELAT 3GMPB 4KVNL 3CZKA 4HUCA 1C8VA 1QW7A 4Q8UA 2OOGA 3L7EB 4K3EH 4NQDD 2DSKA 3BWAB 3QIWC 3LPOA 4WEBL 2DZBA 1SHMA 4JQVA 4ZMYA 3CQQA 1UP2A 4P49A 5C0FA 1L6ZA 3GYCA 2LGNA 2WKLA 2YL5A 1TMQA 4FFVC 4R7OA 5FPIA 2H0JA 5I0DA 1EP2A 3I2CH 1UWYA 1ZSDB 3QYMA 4ZENA 4JDEA 3WEBA 1R3HB 4MQXD 3D4YA 2Z28A 5HJ3B 3QISA 2MCPL 3V6OE 1CN4A 2APSA 3NYKA 4DEUA 1FZJB 1BIHA 1MEXL 1DXFA 1I3RA 1WUEA 1CF8H 3ZDZB 2FDBP 3DFSA 5CD3B 4JZOB 3UP6A 4JPKH 3QHNA 4OI9A 4IPNB 3LRHA 1MHPH 1ZT1A 2VKZG 3QRLA 3P8JA 1U92A 1ZVSB 2XGBA 5E8EA 1T7YA 1QOXA 5DFVD 1W0WB 4QHUA 1WZAA 5HGAA 3EYPA 1HQRA 3WLJA 2DYRB 2F7RA 8XIAA 4R83A 3GIVA 3DEQA 4OCXL 3CZEA 3CFCL 1P1VA 2J5WA 2GDUA 3CT7A 2OMYB 3S5LA 3AGWA 3KPLA 4CDHA 4B4FA 4PY7B 1U8NB 1NBVL 2CWXA 1ADQL 3U6RB 2YL6A 3PJUA 5EGRA 1CIUA 2WZ5A 3VXUB 5TF0A 5LDUA 1I2RA 1UQSA 4AZUA 5I5MA 2VDMB 2HE5A 2OQJB 5DRWB 4XTRC 4Q4OA 4NZTL 2OLAA 4O8AA 1V3HA 1DVXA 4AEIH 2JNZA 2VITA 5EDXA 3W26A 4PCFA 3LB6C 3FUIA 1JXGA 3WFEL 5C2CA 3ZZQA 5JOPD 4L4TB 1M7IB 2HXAA 5BCAA 1B90A 2VOTA 3ZGHA 4U33A 3DX6A 1WIPA 5GXBB 2MPVA 3EYFB 4Z95L 2HLAA 4AIEA 2Y25A 4GSQA 3Q2DA 4YSTA 1SJAA 4NKCA 1AFSA 1I1WA 1ZHKB 5B7MA 4LSUH 3NQ6A 5IVXB 4AZ6A 3F62A 3N0PB 4U3HA 5JQ6H 4JTAA 5L2KA 3T78A 3KVKA 5M03A 3FPYA 4WENB 2EKCA 3RBSA 1XLCA 2QPSA 5CEZD 1PS3A 1KIRB 3LSOA 4BFOA 2BVDA 3NPUA 5A6TC 1KB3A 5T8GA 5HA7A 1R46A 2AV1B 1ITBB 3GU9A 4KGLA 1Q5MA 5CSZB 3U1QA 4ZB5A 1RL1A 2KPWA 3QO1B 4YQXL 2Z0IA 1Z41A 5EL1A 2YQBA 5J1AB 1P7KA 4ZQMA 4BEUA 1NCOA 5F1OB 1TIUA 2AQ3A 3PHAA 1K5WA 5DRXB 3ZVHA 1OHQA 3ISRA 1QKZH 4PJBA 4LVNC 1EC7A 1EEPA 1PLBA 2AL1A 4KQNA 3QC0A 3LGDA 3NCBB 3KYKL 3NVDA 4PCSA 3DVGA 1MFBL 4IQDA 2YSSA 2AQVA 2RGSA 1R5YA 2E9MA 3TONA 3MHUA 1MHCB 4R7NA 3MRJA 5ELIA 2E86A 4QRRE 5ICYA 3INPA 1BQUA 4AXWA 2I26N 1FFRA 3GHSA 1UXMA 3W38A 4YSUA 1KFAL 1AJ7H 3BKJL 1AKJD 5MEQA 1DWFM 2BNJA 3TYUA 3USBA 2ENPA 5A6BD 8PAZA 2QPDB 2VM4A 3ZJKA 3BCJA 1JCNA 1A6UL 1WT5C 1PKQB 2HFEA 2BODX 2AJUH 5FF2A 2XNAB 3FKRA 5A8PA 4A3HA 4D8ZA 3S8HA 5CILH 3CC5A 2EDJA 2DQGL 1GOXA 3I02B 2ATPB 3O8XC 4M4PA 4ZUUA 2Y6ZA 3F6LA 4GRLD 3ZLFA 2F6AA 4JKKA 3BJ91 1IFGA 4Z7QB 5AG8A 4QLKA 3N04A 4WU7A 3Q6GL 4UT9A 4V27A 1FGVH 5BW6A 1U41A 4GOSA 2ZPKL 2ZWKA 4TQ8A 1DQUA 3EWXA 4K71C 3VXMD 1MRQA 4QT5B 4XNQA 1WQ5A 1RQ5A 1N0LB 4F5CE 1NF7A 5E8PA 4B9GA 1HG3A 1UD6A 4F4RA 3RGVC 2F54A 3M44A 3V36A 4JL2A 2XSAA 4X0KA 2JJTA 4XPHL 1J0ZA 2YD1A 4YUEH 3VMNA 1D2KA 2R23B 2ONEA 3NVTA 3T07A 4BI6A 4P4KB 2VE6B 2CGRL 3H9HA 5EFIB 5C2GA 1TZ9A 1L6XA 4XVJL 5CBEB 3FJNA 2XH2A 3EWZA 4G1EB 4EE9A 1LMIA 4LU5L 1TWDA 2YPLB 1E2WA 1U8OA 4I9TA 4LAOA 4H13C 3C0LA 3LUTA 1N7ML 3FUEA 3HR6A 4FYTA 2MTAA 1Y1DA 7ODCA 4PFEA 3UJFA 3QDMB 4BWLA 3WENA 1S5IH 3OVQA 4IIEA 5IBXC 5I9QC 1Q1JL 3HS0C 1BFNA 1GYLA 4ZMXA 3QH2A 4UR9A 3BEVA 4OVXA 5K1NA 3DI1A 1FVEA 1EX0A 1ZPUA 4UDTA 1KCSH 3OG3A 1NFIB 3RWEB 4DJDA 1HOCB 4Z7UE 1U3ZA 3ZWTA 3MMWA 2VZ3A 4R7VA 4EVZA 3F7VB 1B3OA 3NUKA 4FLRA 5CIPB 1WWCA 5C07A 1GPFA 1K8DB 1IARB 3L3GB 1OP9A 4QF1A 4A68A 4GUCA 2A6KB 2KYIA 3NESA 1P0BA 3FO2B 1CICD 4RX4D 2J9YA 3MJYA 1I9JL 4PG2A 1OW0A 1ZHKA 5C2XA 1OAQL 3SI9A 3KDPB 1BMZA 1MY7A 3MGOA 3OC8A 4ICCX 5LGJB 5K2ZA 4NC0B 4E8GA 1HK6A 4PCPA 2TMDA 3CHEA 4KV5F 4ZQPA 1HI6B 2O4MA 4NKIH 5I1EH 4IWWA 5LJYH 2VCAA 1SOSA 3JT0A 1MFCH 1PPIA 2H1LM 2R39A 3QDMA 1JZ2A 4W8AA 2OR8A 1IGMH 4M02A 4N2BA 4Y2OB 5J12C 3G1AA 3DBXB 1SNRA 1DVFD 1ZD6A 2VC2L 3ESUF 4Q4EA 1JWMA 3HI5H 2IV9A 4P5TC 2Y6SD 2YQGA 3O6FC 4K5MA 5F1KC 3S34L 4AQEA 5TNVA 1XIWD 1TPVA 3DARA 4UNIA 2JCWA 2QUMA 2FRGP 1CD8A 3QEQE 5JH1A 2EUXA 4IQLA 1HHHA 4OB5L 2R9HC 5J6GB 3W7QA 4CQAA 5D09A 5CG0A 4KDVA 1H50A 4KRTA 3V75A 2AEQH 4QF1B 1XLLA 2Q09A 4OJFH 3SE8L 2E7FA 5ILTL 4HOZA 1XR2A 3FB6A 3LX9A 3OLIA 4KK9D 2BIMA 2PABA 5E94B 2CMRL 1PLGH 2J74A 1TVHA 4Z7NF 4WWKA 3WUEA 4D9RE 3L81A 4NT0A 1MCEA 2XG4B 2YEZA 3SDXA 4DFIA 5AC4A 3AUOA 4PB0H 1Z5LA 1A6UH 1H6EA 3R79A 4J4PC 3I02A 4ZUUB 1YNQA 2QCGA 4G7EB 1DEEB 4XMTA 3FH5A 3KLSA 5JXEC 3O4OC 4P2RA 4U1SA 4UTAL 2OW7A 1K9FA 4WRLA 2W9MA 3PG9A 4GP5B 4F0MA 4U1HB 1GPOL 4RQQB 3OHMB 4NC2B 4JCMA 4IZGA 4HJGB 4RAVB 2H9GB 2C9VA 5KZCD 1QUPA 3TYBA 5ECJE 3FH8A 4DTGL 5D5MB 1QVBA 3P11L 1T6BX 3R0UA 3QUYB 1W1YA 1MCIA 1M7UA 2Z92A 1UWEH 3BQUC 3BVTA 1YYLH 3EO0A 3I6GB 4NXSA 5DQJA 3SCMA 2NV9A 5FEWA 2N59A 3FB8B 4KU1A 2XIBA 1AGBA 1DBMH 3KPNB 2W0PA 1MIML 4K8RH 3RTQC 3LM3A 4JY5H 4HNVA 2CZVA 4DYKA 4PWHA 5CC7A 4LDLB 1EGJA 1O5PA 4ZE5A 1JI1A 3MVIA 5DVOA 1RFDH 1GVOA 1OQXA 2EP6A 4AGPA 3QJXA 2NSXA 1RK1A 1AP2A 1OSZB 1E8YA 4QI3A 3W2DH 3QUKB 4F9LA 4Q9QL 3MRQB 4HTBA 1JUFB 1C91A 3VKCA 2XHYA 4OZ4B 1NGQH 3C6LD 1DFBL 3LRSB 3UG5A 4A7VA 1P7TA 3L3IB 1UWGH 2V81A 4EAMA 3FTWA 2V2TB 4HK0B 5C0AA 2ED8A 5EH1A 4RGNB 3SDXE 1ZSXA 3AO0A 2X4OB 5HTSA 1E2ZA 3KPOB 4IGNA 1AXSA 4KROB 1NGPH 3K72B 4PUEA 3WFEH 3LS4H 3HE7A 1UUMA 3ZFHA 1E6OL 2ZRZA 4IOSD 4MNGA 3TVAA 2XQBH 3JUGA 3H1ZA 3QW9A 4LLAA 5C09B 3N17A 1CFVL 3PHOA 1D7KA 3ARDB 4DBEA 4F27A 1S1PA 2XN1A 2GSMB 4KXBA 1UQYA 3TIMA 3OZ9L 1I82A 2ZWZA 3DSNA 3QG7H 2G96A 3H7VA 2VZOA 4LRNL 5IFJA 3CIQA 2B0MA 3F04A 4NUJB 2A74C 2E9JA 2ZUMA 2Y7FA 1A6ZB 4OCXH 4YGVB 2VEIA 4FX7A 4H1LH 1DTUA 1X4YA 1OGAB 1G4TA 3L95A 1NWOA 3EXSA 1A7BA 3GSOA 3HB9A 3ZO0A 1F4YH 3ZDWA 2VCOA 3HR5A 3VJ6B 3OTTA 5ABTA 5LIWX 3DV4A 3QO0A 3MDWA 3HAEH 1A4AA 5D1XD 1QR1B 1M7DA 4IRJB 1A3WA 3TYEA 1LEKA 4A8NA 3LY0A 1VLXA 4A04A 3EIFA 3TBVB 1G7IB 5AQ0A 4C91A 3UZEC 1TX0A 2R83A 3HNVH 4XO9A 3WJLC 2Z24A 4IL2A 2OOFA 3EO1A 3QUML 4NRZA 4U2ZA 2HPMA 3EWDA 1DXEA 3PQYD 4YE0A 1CBVH 3BG9A 5E03A 1K4CA 1A9BB 4X9IA 2O26U 4JHAL 4ZBCA 5DJ0B 1YUKB 2W9DL 3HHSB 3SDAA 1W9PA 5JIKA 1J01A 3OPSA 1XFCA 1OAZL 1N12A 2GDQA 2C3HA 5ITBL 1W31A 4PJXF 1J5OL 2O4QA 1WDRA 1RVFH 5JHDA 4DPQA 2PXYC 1N6QH 3FXIC 4KETA 5AOJA 2PW1A 4J3OG 3J27A 5L7XH 3OBEA 5FJIA 3ZVIA 5DMIH 2E76C 3N1PC 4JFVA 3QXAB 4ATTA 2GVYA 1OAKL 5HVHB 2CLMA 2AJXH 1UUQA 4GNJA 2Q3ZA 1CW2A 1DJGA 1NMAL 3PVFA 5C9JB 4HMCA 4NSKA 3LOWA 2HNEA 4N9DA 2F7PA 5EF2A 5FF3A 4HIQA 1LO2L 3TYZA 4DJFC 4XP1L 3BXNA 4B16A 5FEZA 4XP6L 1RJCA 4AHQA 3B4UA 3RWCB 4MWFB 3DGBA 4AF0B 1DQIA 3FCSB 3O6FA 4NFDA 1ZQ5A 5CJXC 1U83A 1T7VA 4M5ZH 3MJ9H 4C83B 3NA9L 5IJCC 1QVOA 4Z77A 4P7NA 4LP8A 3A4WA 1DLHB 3U2CA 4XPFL 1Z5YD 2WOBA 2XXFA 1VHNA 2GTWB 3EF7A 1C9WA 4I48B 2QNEA 3PGCA 1HEHC 4TL5A 4NUGL 3VFRB 4S3CA 3WV0A 4HIJB 3ZJ8A 1N7MH 5C54A 2W6RA 1Z32X 1Y07A 4BFJA 1JWUB 3IKKA 1E3XA 1M7JA 3GY1A 2FPVA 2ZOKA 1TJMA 2F7IA 2FCBA 4JPSA 2EIZA 4NCC1 3IJ9A 4P2OB 1UB3A 1UA7A 3RCMA 2GUOA 3OAWA 1ZENA 3ZXWA 5AKRA 4U6VH 3BWUF 3HUJF 1P5VA 4OKDA 4ENZA 1JTOA 3B2PA 4XE0A 4LYKA 1Q2SA 4DVRL 3LSCA 4WTQA 2ICWA 3F83A 5KSAB 2Z25A 1C9SA 2I9LB 1TVNA 4LS0A 1TVLA 1Z3RA 5DS1A 2CHZA 5KYUA 3D3FA 4KK5C 4TXEA 4MJ4A 3BGGA 2DIKA 4HV8B 1P1MA 1BDYA 1XB3A 1OWWA 2I07A 2X53A 5CLTA 1X3DA 2Q01A 5AZ1A 3DTXA 4ZTEA 3L3HB 3VFOB 2VH5L 2MNWA 1MXDA 3UL4A 1C1EL 1ML0A 4LEXL 3UJRA 3UFYA 5TPWL 4HJ0C 4RFOH 4TIMA 3T08A 3MP3A 1DBAL 4LF3A 5IUCA 2QULA 2EAWA 4UXDA 2H0PA 4HDIA 4L29B 1U3NA 2Y7DA 3CUIA 2O61B 5IEHB 4AV5A 5A95A 3BO8B 1JS4A 2B7NA 1QG3A 2DT1A 3KXQA 5CZXD 2IGFL 2FZMA 1MFDH 1IUZA 4IM8A 4G2AA 3NCJL 2JKRM 1E73M 2GDVA 2HKFH 4GLRH 1CICC 3IWVA 2ICWI 3L1GA 2UZYB 3NPSB 2NXHA 1FG9C 3K6DA 4FQXB 2H4EA 5EEXA 1A25A 2H26A 1X5LA 1C5DB 2RCSH 3G9VA 4GQBA 5BQDA 4K36A 2SEBB 3MOAL 3M4HA 2E6QA 2X88A 1SGKA 3AADB 3GSRA 3DX5A 3URAA 5IFPA 1W8GA 4HH9A 4LOUD 4UAHA 4G5DA 4C6MA 1HKLL 3G5VA 2CUMA 4JG0H 3S96A 2J7HA 2B7DT 3CHVA 2VISA 3MX0A 3H2EA 1MUWA 3C56A 1L0PA 1WBXA 1J5OH 1W3TA 1HQRB 4HYTB 2W66A 4X7FC 3UY8A 2YUZA 3STZB 4E42A 3G6AA 3WFDL 3PWNA 3VQ2C 1YNPA 4Z6AT 2L7UA 3IE4A 5D70H 4K5PA 5KWYC 5ABFA 3K5XA 4QRSB 3SE6A 4KK9C 3T9PA 3A6CH 5T1MA 3LCHA 4O19A 4S3KA 4Q6XA 4DVBA 4Y4KA 1GZQA 1XZ0B 1EP3A 2PMZA 3O2WL 1EF2A 1ONQB 2V7HB 2WSQA 3RM4A 3MBED 3CAQA 4WSKA 1GPWA 4YFLF 2IAMC 4H8WL 5DJXB 2RJGA 4GRSA 4K2SA 3RHGA 3LKSB 4Z7QE 3V1PA 3JXAA 4K8HA 4LCQA 4GG6E 1VDGA 4XD5A 3F4NA 1BQKA 4GINA 3P4MB 4A8IA 4DUOA 2VDNB 1JNEA 1X5YA 3U46B 2TRSA 4OZFB 4JRXA 4A6YA 3KZSA 4H9YA 1LG2A 2XKSA 3A24A 3U3HA 2HRHA 1VACA 4LSVH 4TLUA 3S83A 1I8LC 3VI3F 3OAYK 4GY7A 1VD6A 3PFUA 5I00A 3ARTA 3APCA 4UOQA 4F80A 2OL3H 1FUNA 2XG5A 1W3KA 3FOLB 3RJOA 1RBLA 4FMFA 5ILTH 5F93C 3PG2A 3GD1C 3KYMB 1IXNA 2VIRB 2CKSA 2NX1A 4D9PA 1KGXA 1S9XB 2OMNA 5JUEL 1LBLA 1F5ZA 1ZGLB 3O63A 3EFFA 5MEPA 1S7WA 3QZWA 4MS8C 4U0RB 5JHDD 4WJ8A 3DX4A 3KPMA 4YX2H 2DYPA 1AVAA 1H9VA 1M57B 5DFVC 3H4GA 1ZV2A 4U1IB 3S47A 3FFSA 4HJJH 4Q22A 2DIJA 4MNMA 1LOSA 2Z31A 4GEJA 1PNCA 4FXSA 1PZ5A 1ZCOA 4V1XA 2XQYK 2A73A 3WH8A 3EB2A 5DD6B 3ZTEA 1X5HA 5HHMB 3CDZB 5I8OH 1BRLA 1RVGA 4LC6A 4XV0A 1D7DA 4XAFA 3V9CA 2IH1A 1FXPA 4U6XA 1FVDB 1PF3A 2G3IA 3RDTD 2WM1A 3X14B 4LXFA 1UCBH 2ZT9C 4X7TB 1C8PA 1LP9B 2R8SL 2WMKA 4U3SB 3LB6D 4M6PA 2WIIA 2DIBA 1KCLA 2WNGA 4FEMA 4QG9A 3OPUA 4G80B 3KRUA 4Q8WA 2A1YA 2OLHA 4GQQA 3IJEB 4W89A 1XIBA 4H20H 1NC4A 1KBGL 5ITFA 4DWDA 3ARZA 4PJCF 4YSEA 4LSSL 1WH0A 1EFXD 3OLGA 5E5CA 1B4JH 4EACA 2DQIH 2XWBA 1U5VA 3B6SB 1K2DA 5J8OA 1F90L 5IJVA 3ALFA 3DERA 3O45B 4J1OA 1UKOA 4WKFA 1BZOA 1T1XA 4S23A 4YXKL 4EUPG 4M43H 3QORC 2C4FU 5CZVL 5E6ZA 4HPOH 4AYDC 2PDQA 4PJ8A 4X0KB 3TV3L 4R4ND 4D2JA 3EA1A 4GRLB 2WNKA 3ETTA 3NZHL 1HE8A 1TV3A 3EBHA 3RUGE 2VC5A 4PODA 3TO4A 1B57A 1JFQL 1V02E 1OFBA 4A05A 3K6FA 3KXFB 4JFDA 3NIDB 3QI9A 5E7FA 1B31A 1XLGA 4W5ZA 3GHEH 4EBQL 4UU9A 2OMAA 4G8AC 5D7LA 3O7UA 3ZL1A 2H6PB 1ME8A 5LA0A 5C92A 5TDOB 2YAQA 3IFLL 3I9PA 5BOJA 3WLOA 5AC5A 5FEPA 1N3NB 4MXWH 1VFHA 3LHYA 3CAFA 2EKSA 3T0EE 1YNKH 4C1NA 5D33A 1NCBL 4A8RA 5ES4B 3DXAE 1LD9B 4FTVE 1F2QA 4Z1DA 1NY1A 4FG2A 1JF6A 5GJPA 4GRWE 4PJXA 1QMLA 5LWYL 2ZC1A 1Q72L 4OLEA 2C34A 3TEVA 2X4TA 1LT8A 2OA9A 5JW5A 3BPWA 2L8AA 3OD3A 4YDLC 3I10A 4QNPE 2V7NA 1E9PB 1L5GB 5BS0B 4YOKA 3W7NA 2A4ZA 4JKLA 4CN6A 1RJYB 3V0WH 1EXHA 2VXQA 1RAMA 2O92A 1SQMA 1A1OB 5C7VA 1WDAA 3PUCA 4B92A 2ZG2A 1DQQA 1FL6A 1P4LA 1KTLB 3ITGA 1PZUB 1L9RA 3DJRA 2E3VA 1SFJA 2IUZA 3NXLA 2VFFA 1GJUA 4PG9B 2Q8BL 5F1IA 1KTNA 3DIDA 3H24A 2ETWA 4MNHB 1HZLA 3QGVA 2A7NA 1G7VA 2DF3A 3QB7C 1M03A 3OPZL 1JWMB 1OC5A 2PPCA 1WYIA 5CSUA 4F0LA 3EYSH 4EI5D 5KOVC 4TYUA 4N1EA 5D55A 1MFBH 4U6HA 1FH5L 2EXWD 4LVBA 4FE9A 4GXUM 3BLIA 4A7QA 3VUPA 2F5BH 4NO3B 5DMLA 4UMGA 1WX0A 5LNUA 2A77H 1H63A 3CFDA 1Q1JH 4HZ1A 3HKZA 1IXOA 1U1HA 3RGVA 3L67A 3QVQA 2R1PA 2XVGA 3Q1SH 5GS3A 1S7QB 2ICEC 3WTUA 4Z2IA 4LYQA 3UGEA 2YEQA 5JA9A 2R15A 3HUJA 1XD1A 3TCXA 2OZ0A 5K9OA 4MGXA 3GNOA 3WK1A 1KYUA 4UT9L 5L2KD 1YEGL 3RKDD 3NRQA 1KBWA 4BQBA 4Q8TA 1P6FA 2VEFA 1I8LA 1LQ0A 4I7UA 3NO5A 1ECYA 4P2RB 4UINL 5E08L 3RR4A 1KYAA 2VDQB 4KC3B 1ZA3B 3ZL4H 1NF0A 1ME7A 1MJJB 3T6WA 3VZZA 3G08B 1KYOK 1KIUA 4ELMF 5DUML 5DC2A 4WTWA 5B22A 5I18L 5K9DA 3KWVA 3RUBL 1CLVA 1H3PH 2HRGA 4HISA 4P48A 4R7NB 5ICYB 3OKKA 1HL9A 3BPLC 5GGUA 2NTFA 4Y2NA 3LVEA 2IKGA 1WHOA 4R88A 4YNYB 2A6DA 3JVGA 1ES0A 4NENA 1DQMH 2IBZX 5EYWA 3GI9H 1CXFA 1JZ5A 1NSNH 4WEUD 2V6HA 1CU4H 3C2RA 1J9CT 3NJIA 3S2AA 1JPHA 3GNDA 4HMNA 5FD0A 2XM1A 5FJUA 2XNAA 5JUVA 5D7KE 2YD0A 4JFPB 4LB3A 5IBLD 1E4JA 2VR9A 3QORD 2YFNA 4LYRA 2EIEA 4AISA 4GG9A 3REVB 4YL2A 2GJ6E 4LLDA 4NDMA 3AMLA 3KR3H 4N86A 3WEXB 2BGSA 4NQTA 2V5LA 3VGHA 2X1WL 2B5IB 4RAVA 5C97A 1JYVA 1JNHB 4OZIB 1TPFA 2F2KA 3M41A 2YLLA 2BCMA 4Y9GA 3TYGL 2IPWA 3M7SA 3HFML 3RTQB 1L6SA 3ZSSA 3R19A 3U1SL 4UFKA 4WR3A 5K39A 5ABEA 1GC1L 1VBRA 4W9FC 1NCBH 4JK0D 1F6LL 3AABA 3GS4A 4LEOB 4ZMOA 2HG5A 1YEKH 3N42F 1NCCL 4XAWL 4ZD3L 1RLDA 4LVAA 3QUXA 4AQ1B 2A6IA 1YMMB 3CEUA 4ZQRA 3AUWB 3MCLH 3HBZA 3FNDA 2YRLA 1G7LA 1FWXA 1W54A 1FH8A 1YN7B 3AVEA 3SBWC 4KQ4L 2BSTB 3LV3B 4HEPA 4UYPA 5K9XA 3F4DA 1YEDA 2ZJSH 4TVCA 4ODUB 3WFHB 5ISZE 3SCVA 2R0KL 4YDLB 1OSZA 2KI6A 2NY1C 4QXGL 1PZ1A 2VTFA 4A2HA 1ZP3A 3DC8A 1WOAA 1I3GH 2LFEA 4N5ED 4P7LA 5F4SA 4TO8A 3IKCA 4PRPD 4RDQF 2DEXX 3RTQD 4HU3A 1BAFH 2GJZA 1INDL 2D31B 1SZEA 3T0WA 4JTCA 4IBUA 3T42A 4QQUA 5KSVB 4I18A 1O68A 3HOJA 3R43A 1BHGA 2Y06L 3HE7B 1NGZB 4D8OA 2WXKA 5CD3A 4OLWL 2EPMX 3LNMA 1IU1A 3GC2A 2B1HL 5EZJB 5A5WA 3TESA 2R29L 2WYSA 3NZRA 3NJMA 1MCKA 3F58L 3W0WA 2BFVH 2AVGA 3NGBC 4NCDA 4O1FA 4AEOA 2DB8A 4JN6A 1W0WA 2NUPA 2JKAA 2WQUA 4HPHA 4KRUA 4KUZH 3ZXAC 5HQMA 1VR6A 4N3UA 1OX6A 3OZOA 1AH0A 2DQHL 1PFCA 1VCFA 5AZEH 4V2BA 3MI2A 4B4HA 3P40A 3L5HA 4HJIA 5EIIG 4F7TB 1Y8BA 3CQPA 4D8LA 4CN1A 4JAMA 1A3HA 1C7SA 3BD3A 5EN3A 4H4NA 3NQFA 5AVTB 1SVZA 5BZXA 2D2OA 3ECVA 4J9JA 2UXGA 1EQCA 2ZOOA 2PP7A 2EDNA 2Z8SA 3ZDYB 2X1OA 3SPCA 4A37A 5L4JA 4ZSOB 1ADDA 4LT9A 3T40A 5TH2A 4O4YL 1ILUA 2B7PA 2PTVA 3HN5A 4KY1L 5IESL 1NC2B 3EDDA 2HZHA 3KOYA 5KAQG 3F2BA 3F4CA 3G18A 5HPMB 2K6ZA 4XN8A 1LP6A 5EBGA 3VILA 5CAHA 3RAJL 5E94A 1HILA 2VR3A 1MNZA 4LVHB 3A4XA 4G8IA 3KBEA 3QH3B 4ADTA 1YW1A 4MDIB 3T2NH 4AQAA 3TZVB 4BWUA 4DZ8A 3HPXA 2XQ0A 1KBBA 4XCNA 2E47A 1JFQH 2CKBL 2HVJB 4TVPD 1DVFA 3QY7A 2WXDM 5KETA 1M1XA 3QCTL 1CDHA 1UXLA 2E7BA 2J1WA 2LABA 4OU3A 1WAAA 1YYML 2CLZA 4AM0A 4TQEL 2JKEA 1KC5L 3DUSA 2JI2A 3Q45A 2MPAH 3ARVA 4P3CH 3S2LA 3WIHL 5LUMA 5L4FA 4GJIA 5DS8A 1KXTA 3UX9B 3RY5A 2P1YA 4YPGB 2GKIA 1QABA 1OF6A 1IC7H 4NQCB 2ICWB 3WXVL 5KSAA 2AMXA 5CJ8A 3FO1A 3B7SA 1EBGA 3DA0A 4ATDA 1P5BA 4D8AA 4NP4L 4A8LA 1KGCE 3QUXB 3V16A 1CDJA 2QSCL 3BZGA 4KRPB 1XISA 3O3UN 1QSED 4EOWL 1MLCA 1VZHA 4PRHE 1FE8H 1RMFL 3NIDE 4WVRA 1ORSB 5DT1L 5LO7A 1BTMA 4ODUA 5I1HH 5KVFE 4ZW7A 3BHBA 3MXWH 4PUBH 3SDDC 4NM8L 3VFRA 3KBMA 5T8IA 1W9BM 3HQNA 3R8HA 3ARBA 1ZCRA 3FOMA 4CBPA 4EPDC 3M46A 2GB2A 1KCRL 2WAGA 5EHFA 1GKQA 2AHIA 3GIYA 4ZPVA 1K8CA 4KCTA 2J8TA 1PDKA 1OK8A 4FXKA 1MY5A 3DWTA 4TSAH 1J12A 5F3HB 4PLJC 3AIWA 3TLQA 2YA2A 5HYSG 4GHRA 1SLVA 1U8LB 1CS6A 4NZ4A 3GDRA 4DBUA 1GQNA 4P07A 3N2TA 2EABA 1OF2B 1WLHA 1YN6B 3WNOA 5C0NC 1MCJA 3QXWA 2DUXA 3H7LA 3BSZL 3KXFD 4JHWH 4CUCA 1T1YB 1XF0A 4BQ4A 3F5KA 4XZ4A 3PAZA 1WFIA 4L37A 5DUBB 3MNZA 3MOQA 2ZQ0A 3S36H 4GX9A 4PMZA 5I3HA 2O6DA 5KYWA 1A5KC 4HBQA 1XPYA 3CUZA 2HVBA 4CCZA 5E2WL 1JR1A 3WJYA 3OBAA 2PO6B 5DCEA 2X4SB 2DLIA 4BSWA 3L2LA 1F56A 4GP8B 1PKQA 4NBXB 1YIXA 5CPQA 4LKXB 3V4UH 4ERSL 5DRZA 3EGDB 3PGFH 2XI9A 4GAGH 4NO0A 3QPZA 3AACA 3D9AH 4CSZA 1SW3A 5LQBL 1DVJA 4K1GA 3GH4A 3MLYH 4JM2C 4ODSH 4XD3A 4EUPA 4HIXL 4ZO7A 2OZ8A 2X9WA 1GWJA 3C5ZA 1OTTD 15C8H 3GSVB 3VXGA 3T09A 2UX6A 3OIXA 2VUYA 1AGFB 1BW8A 3DURA 1U4FA 2R24A 3TO2B 5D1XA 3MPGA 2XZQH 4Z7UB 1UKPA 2XZ9A 5DEGA 1TPUA 1ACXA 4PGBB 1M1BA 1RBAA 1DQDH 1ET8A 1P1ZA 3F2LA 1MELA 3CASA 4NO2B 1MRDL 3SQBB 2NY0D 2WJ7A 3W02A 2OK0H 1NDMB 3ES6A 4PJ6A 3NJGA 5EOTA 4QEGA 3TBTB 3BUIA 3I3EA 3HRZB 4C56E 4XUYA 5GHWL 4MPKA 3TFBA 2VXQL 2VO8A 2FAUA 1DPMA 1D7BA 1G6RA 3KWUA 1J8HD 4AYEC 5ESAB 2Z93A 4L6HA 1XR9B 2DKUA 2WSKA 2J1ZA 4YK4C 2GYSA 5ABFB 5DHMC 4JUSA 3C8KA 4RV8A 3F58H 4UB0L 2ZE3A 4LUTA 4M7SA 5T91A 2FLMA 1ID2A 1G0DA 1YDNA 4BE6A 2ODHA 1BLIA 3NK3A 2YBTA 3GG7A 3JWOL 5I6XC 3EOTH 4L18A 1I1XA 2XU2A 3WO8A 3TTOA 3MJMA 2NXYC 2AEIT 1PTAA 1KGYE 5D6DA 3V1HA 2JLPA 1GGOA 5FS5A 4IIQC 2QCNA 2BSLA 1YXCA 4JN7A 4G6AC 2GSGA 1I9EA 2AJYH 2X7LB 4P8WA 3H54A 1ZE3H 2YUXA 4JPGA 3EJTA 4DAFA 1KB9J 3HLKA 2GJPA 3O6FD 2VCBA 4QEHA 1BAFL 3RDJA 3ZDYE 2EVFA 4HKXA 2OQHA 4PR5A 4L4VD 4IJTA 1NFDA 2FO8A 1W17A 2B77A 1MDRA 4ODTL 1XYBA 4CC0A 5IMKB 3TCTA 1COBA 1DBAH 2B14A 3ATAA 4O00A 3EJRA 4KXZH 1XGDA 4XZLX 1D6EA 5AD0A 3O3AA 2VZVA 2FGLA 2WCAA 1SN2A 2QHAA 4ONHB 1ZLSL 3MFGB 4LVNB 5IW6B 5I16A 3PL6C 1URIA 1YDYA 1V4YA 1HCVA 3A5FA 2Q6WA 1CGWA 1U91A 2Z64C 4JEGB 3WNPA 4LY8A 3URQA 4TSBL 2YD6A 5H94B 5ACLA 4JPWL 1V3JA 3NQBA 1IT8A 5HHQA 1IGTA 5GSVB 5JOEA 2HBVA 2RHGA 4AY1A 4EXQA 3N40F 2GK1A 5DMMA 1R34A 1WKFA 2DWEB 1B3XA 1S4IA 3BAKA 2NY1D 2OXHA 3KBPA 1OC6A 1CXEA 2UV3A 5DELA 4HYVA 1KN4H 5I1CL 2F0CA 2VEMA 2ZXWB 1MDTA 5AOMA 4GACA 4B5WA 1SXBA 4QHLB 3W9DB 1TREA 4Q4MA 3O9NA 5AHEA 1MCNA 4GVIA 3GIQA 3ENLA 3WIAA 3FU9A 3TF7C 3CJPA 12E8L 3AROA 3EMCA 1IBZA 4ML4A 4O02A 1UXSA 5DMYA 1M9WA 4NXKA 2ZSWB 5C0ND 4O10A 4CSPA 4G8GD 3TA9A 1V55B 3FTVA 4K71B 5I3JA 2IQAA 2PCFA 1NJ9B 2BVQB 4JY4A 3MJ8B 5IREA 3EXLA 1FHDA 5K5YA 5IW6A 4ISVB 4JKPL 2OFJA 1KXQA 2VQTA 3EG9B 4YHIB 3CWOX 3FHEA 1DQLH 1MUCA 4Y9NA 4GKZB 2I5GA 5I7GA 1GVYA 3AREC 1UADC 2GJNA 1L7IH 5IJVB 1TCMA 4QRPB 1ET5A 1DBKH 2CO1A 2Y6TE 4CQ8A 4LHUG 3C3NA 2J66A 4C55A 2X05A 4AZHA 1JE6A 3QY8A 2NLJA 2XY1A 3FRPA 4ELKB 3MRFB 1AR1B 2BNRE 4QDPA 1KN2H 1MCCA 2A0NA 1DO5A 4KI5F 1M71B 2H1XA 2IWGA 4RRPA 3CCHB 1JPMA 2W27A 5CHNB 3UCDA 3CK5A 5F0PB 3GJEA 3UQNA 2GC7C 4JFDB 4WI7A 5MENE 4O8RA 1NGXA 2VDQH 5C86A 1IR1A 3WQ8A 4BFIB 1O5XA 3TBWB 1WTLA 1Z3GL 1FWSA 5C9ZA 4IHOB 3C8KB 1S2VA 3VH8G 1QI4A 4ZSOE 4D9QD 5D72H 2Y8KA 3RIFF 6A3HA 4MNHA 4IEFA 4X4ZA 5EA9A 1LWHA 2H0FA 1IGYA 3HMWH 2Z6IA 3FKUS 4GW1A 1MI5B 2O1AA 5AVUB 5T3XH 4ICXA 5I6MA 4F0HA 5KSWA 4M56A 3WUWB 2NX5A 2XWTB 3FCGA 1QBLH 2AQ1A 3WQFA 5ENLA 4KK6D 1EFQA 4G8GB 1IEBB 1J6OA 4JQAA 1WPCA 2FGWL 4JO1L 2NLIA 2IIJA 5FA4B 1TV2A 1HDMB 3VGEA 3QNFA 1S2UA 2RGLA 3EWUA 4Y4KC 4O58H 2R1WA 4HWBA 3WIFA 3NQGA 4IGMA 3VG9C 4CVZA 4Q8MA 1GGIH 2X6VA 4IIQB 3N9GH 1GYNA 1PKQE 3VW3L 2ASHA 3N4EA 1MO0A 1NC2D 2B59A 2X70A 3G9AB 5JLZB 4IBWA 1OX4A 3EJZD 4FNLL 4MLIA 5DK0B 4F91B 3TW7A 5ABAA 4HK5A 4W4QA 5JH2A 3L65A 3BUDA 1XX9C 4JYFA 4PZVA 2W81C 3DO7A 1WA0X 3C87A 4TQEH 3IS4A 2J13A 4JQ1A 4JHMA 1ZGLA 2EDXA 1D9KC 4KUCD 4LEQA 1L7TL 3EA2A 4GVGA 4UNKA 3UWWA 4MFHA 4N1HB 3GVWA 1C16A 1EPFA 2FJKA 3TXVA 4K39A 4XMUA 5GGVH 3L4YA 3SCNA 1BEXA 3ZQWA 4I87A 1G7IA 3S3PA 4FQHA 4J4PD 3X12A 2AABH 1NJJA 1NARA 3PZNA 2WZ6A 5KW9H 2WM0A 4RAUB 1KD0A 2FSEA 3ZLGA 2ON3A 2EHHA 1HQ4A 3HZMB 2WBWB 3FTYA 3UC0H 2IOIA 1PG7L 3HHSA 3BP6B 4WNSA 3PREA 4UBDC 2NT1A 4GO8A 5AL8A 1QHQA 4NM8H 1YLBB 4HD5A 4JX4A 4AC7C 1NLBH 1A4KA 1A80A 4PS3A 4FZIA 3CSBA 3IWUA 1XGEA 4D6DA 4F7KA 5CCGE 5SWQB 1TPXB 4ZQOA 1QFUL 3DX7A 4PMRA 4Y7OC 4U0QB 3AW5A 2UY3A 3ULVF 1IQDA 2YD9A 1S5HB 2B9AA 4KQ3H 4NKQB 2F53A 1ZA3A 5ERWA 4F66A 1D3CA 3JZYA 1R9FA 3EWWA 4GG8A 2CKBA 4R97B 1U8QB 2OO6A 4YHOH 2V67A 1PTZA 4PUBL 1Q7QA 2JK5A 3BLPX 5FO2A 3CPRA 4C6LA 1QI3A 2OR7A 4Z3HA 1NCAL 1S9VA 2ABBA 2O5ZH 1ZHBB 2FZ3B 2PW2A 2QV2A 2WCGA 2X4PA 4JM0A 4GI8A 4KZDL 3GZQA 1AD0B 1ZAHA 1A6VL 4ILDA 3COOA 4E36A 3KBSA 4D0DB 1VPYA 3ZM8A 5I78A 4JYDA 1JERA 2IDTA 3DHUA 4XOAA 4FADA 5C0DB 2JLLA 4AG4L 2GJXA 4XWUA 3SCWA 1V0NA 5J57B 4BZ2L 2V68A 3WQDA 2BSTA 1S7XB 3LV3A 4BKLA 3B9VA 4HS3B 4PJAA 3TBYA 1FNSL 3OMIB 2K6YA 3MV9B 1EO5A 2O5XL 3QIUA 4JR9H 2LE9A 3G1FA 5M17A 2I1OA 2J7EA 5IOPB 3P6LA 1JWUA 5G1TA 3FYPA 4JE0A 1CFNB 5CZKA 3QWRD 4AUJA 1F3DH 4FQIL 2AQPA 2R8SH 3N43F 1KBIA 1D5BB 1FQ9C 3PXHA 4S3GA 4P46C 3VFNB 1OF0A 3ESNA 4JRXE 5AKQA 4HIPA 1JQXA 5DEFB 4G8GA 2Q8LA 3O4OB 4HJSA 1MRFH 5CEYA 4R9XA 3VXMB 3TC3A 1S5TA 1WB0A 4PUWA 3UPMA 2HJFA 2I9LA 3ARWA 2IFGA 2NXZD 3N9KA 3AHZA 2A83A 2VMJA 2PDIA 4RLDA 4WJ5A 5DY2A 2CGRH 2I07B 5JPNB 1XH1A 2EJ1A 2XRAL 3ARBC 3PSWA 3UXAA 1MIEH 1GW6A 3S9YA 4AWUA 4XB7A 3HI1B 1B4LA 4LSQL 2NLYA 4MAZA 3JZEA 4A35A 3U1SH 2B31A 5HYIA 1L6WA 2OTWB 2G60L 4FNLH 5JIHA 3RVXC 5EU6D 1IMHC 1S3HA 4MB3A 4IPPA 4L4TE 4L1DA 1XAUA 3WK3A 3BVVA 3TV3H 4F7MB 2P8MA 4EVNB 1YEHL 3E49A 1R3KA 2O6PA 3JWNG 3BKML 3TOPA 1OCZB 4M3PA 3ZE0E 3EH2A 3UJJH 4BA0A 4ZTPH 1ODAA 1UT1A 2QDVA 3QEUB 5D7IF 5D7IE 1VGKB 3UROR 3ZTJG 1HT6A 1QBAA 2BNUA 2R2BB 3TA3C 4N0YH 5HHVL 1UR2A 3O8XD 5E9DD 1WOBA 5G2NA 4UZUA 1SFTA 4UC5A 1S3KH 5EO9B 4JQXC 2HV5A 4YTRA 2JEPA 4CD8A 2R1YB 1QSZA 1DQML 3HMXH 3CL8A 4I9XA 5FUZL 1CB2A 1AC0A 3QGKC 3F00A 3EZJB 3L3KB 2J57A 3OWRA 2FX9H 4H8PA 2BC4B 1VS1A 3GMNA 4JNYA 4AH7A 4BCZA 1FJ1B 2X9YA 4ZUVA 1HI6A 3MO4A 4NQEB 3HB3D 1REQA 2RH0A 5EBAA 1YDPB 2DQCL 5AW8B 2DOCA 4ICNA 2Y69B 3N2CA 4RBPK 3MR9A 3N2MA 3MCLL 5E9DE 3KL3A 3U4AA 2A9AA 2C1OB 2Y7LA 4M5YL 4ORGA 1H0DA 3AYRA 3G77A 3Q7JA 5CPOA 4C54A 5PTDA 1HVQA 3BXWA 4OQTH 4RE0A 1T4KA 4QT5A 1SFDA 4AT6B 3W74A 2A9CA 2ISFA 5TH2B 3ZE1E 1TKKA 2PDGA 4KEMA 3HFMH 4LFYA 1Q0EA 1ADOA 3L3GA 4DVBB 1N7KA 3RVTC 3L4CA 5DXXA 2P10A 1UWFA 2QZRA 4H8NA 4I4WA 3I6LE 3KPSB 4OZGA 3E1ZA 2VE6A 5EFIA 3TFKD 4GUOA 3X14A 1TV4A 4UTMA 1UT9A 1QRQA 3ZU8A 4TVUA 2EIJB 3VNKA 5J12B 3DSFL 2G9HB 4QS5A 5DLCA 3TZFA 4XCNB 3I3BA 5D4JA 5GGTH 4XP5H 2VRAA 2VDIA 3T2PA 4LOVA 5IW1A 3CQ0A 1WZ1H 3MXVH 1T8XA 2GYIA 3LNFA 3QJHA 2GZXA 3MJ6A 5IG7B 4JTFA 4CW1A 4GH7B 4FJZA 3C3UA 4LB8A 4KNUA 4W9GC 3LCWA 4JHVA 2PGEA 1SUXA 1QO3A 4ZXBC 1U8KA 4NPYA 4R2GD 3KVJA 3M5YA 3EYVA 1W1ZA 1Q94A 1NOUA 1Q6RA 4PMYA 3UDWA 1SVCP 4NY2A 4K3JH 1ASOA 4WK9A 4YVPA 3QZAA 2XSXA 4F15B 2PWFA 2WQXA 3U0TA 4H01A 2N7AA 5IY5B 3W75A 3QHOA 4Y4HD 4GUPB 3CPUA 4XN5A 1WCGA 3BV4A 1BQLH 2F53D 3SKJH 2CJSA 2BS8A 3L3DB 2CESA 5E08H 2V9UA 3PBUA 4LW7A 1LQ2A 4G6JH 1HP5A 3IBOA 3QORA 4TS6A 1CFQB 3FGCB 3U7BA 4UTKA 3MMTA 2PEVA 3HZ3A 4Q6IC 4U5IA 4GBXC 3ATZA 3S8GB 4GY1A 3WE6A 1SFHA 4NUGH 3L08A 4XH2B 5I5JA 2I5IA 2NQCA 4P2CG 1OVZA 4XMKL 4YHKH 4D0CB 2J79A 3O2VH 4GT0A 4MFDA 4JQ4A 1X5ZA 5DCCA 3V8OA 2BIHA 4MLRA 4WSJA 3MACL 2XISA 2YKLL 4PJHA 1C3FA 2ZC8A 4FXJA 4AWTA 2WZPA 1FORL 5B7EA 1XLFA 3F5JA 1TZAA 3QARA 1V3LA 5CGQA 1E0VA 2Z92B 2AQNA 1KLGB 2ZWNA 1AGFA 3K72A 3T71A 4ELME 1FP9A 2L7EA 4FA3A 4XCYB 3ALGA 3R8GA 1T7LA 1DZBA 2PNDA 3NCCB 4ZPTA 1G9NC 5G2WA 4KWUA 2Z29A 1GTEA 4W8BA 1XI3A 2AJXL 2FT8A 3I9GL 4G9DB 3NFNB 1DDTA 4ZMPA 4GKSB 5DFAA 2Q5BA 3ABRA 1OGTB 4KX7A 2IW0A 4UFIA 4H3DA 3MNWB 1MAMH 3G5XA 4ALAH 1W3JA 4BHYA 4OIFA 4RNFA 4ZJ9A 5J5DA 4DKDC 4FK9A 3RX5A 4LLWB 5LAXA 3VDAA 3FCPA 4NRSA 5FI8A 3EH5B 4AD3A 3TQKA 2R29A 3VQMA 4BCXA 5F7DA 3QFJE 2RMNA 4N2CA 5TQ0H 5IUSA 2W65A 1F11A 2XXCB 1GYVA 2MNUA 3M64A 1G9EA 2W07B 4ZO9A 3D05A 1BQHB 3TO2A 1MFVA 2VAAA 2YL9A 4KEZA 4F7EB 3FNKA 1ONEA 4OFKA 3N0AA 4H6QA 4X2PA 4PWFA 1X5FA 2Z7WA 1GS7A 3RQ3A 1Q6QA 4BHUI 1Z66A 5CSBA 4CN4A 1HXJA 4IU2A 5BRQA 1EK3A 4QNWA 2V9QA 4O16A 2KC0A 4P61A 1DYSA 1ICTA 3REWB 1N8IA 2OJPA 1T7XA 2AMUA 3GMRA 3EO9L 5C0AE 3UC2A 3NZ1A 5CGYD 4RNJA 3TS8A 4HJJL 3BLEA 3PBWA 2XVKA 4JTHA 4JR9L 4DCQA 4OFVA 2GSIB 3D09A 2NUTB 4FZEH 1N4XH 3QJRB 4AQOA 4ZFGH 2F8XC 1EJ6A 1BQCA 2JSFA 4G8FB 3QPKA 4LMQI 3WE1A 4EDXB 2FTYA 2GSHA 3CVHB 4DI8A 5BYWA 2DAVA 4J28A 4DEPB 2GABA 3QK0A 4C6IA 5FL1A 1NA8A 4XNYL 1XICA 5HJXA 2XM2A 2XINA 5C0QA 3GSQB 3HBQA 5T3ZE 3SY5A 3VXUD 5FM5O 3FQ1A 3H6OA 3W9ZA 2YARA 2G95A 3MRNA 1MFUA 4M3KB 1CE1H 2DPKA 5L2KE 4Y6GA 4DEWA 1KBGH 2CE6A 4HKXB 4YDNA 4CQCA 3G6DL 1UOVA 4XVSL 3B2DC 1FO0H 1JUEA 1ZT1B 2EDMA 1TUXA 4QRRD 5GS1B 4UAOC 2Q0ZX 1AIZA 2VR8A 2HRWA 3FEQA 2J78A 1S7QA 3C5SB 1NEYA 5G4MA 2AXWA 3WL9B 5U7SA