2ZXEB

Crystal structure of the sodium - potassium pump in the e2.2k+.pi state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium - potassium pump at 2.4 A resolution
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 51
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zxeB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 2zxeB02
3NXSA 2BASA 1A02F 5APVA 2YNYA 1CI6B 1S9KE 1GTWA 1NWQA 1OXZA 4RESB 3VMXA 1T2KD 3WGVB 5AW9B 2E42A 5AVWB 4I2LC 5AW2B 1H89A 1GU5A 4I6MC 2WPQA 3L36A 1MUUA 2Q7CA 3A5TA 1HJBA 1GZLA 1CSBA 3M0DA 4EOTA 2YO3A 5APUA 2Z5IA 2R5DA 3KDPB 5AW7B 1JNMA 3T97A 3LIDA 1MV8A 4AUWA 4C46A 2XZRA 3A2AA 4LC1A 1X8YA 2P67A 2R32A 3A7OA 3HTKA 1KQLA 3A3YB 3MD0A 4GT1A 5APQA 3IR9A 2N9BA 3VTPC 5AW0B 3TNUA 3VYIA 3NFQA 1FAVA 4AYCA 1MFZA 3HE4A 5APXA 5AW5B 2C9NY 3L37A 1HUCA 4GKGA 2IPPA 1T2KC 3MGNA 5AW4B 3V5BA 1CI6A 3P32A 2WTYA 2XV5A 5AW1B 3KQGA 1NAFA 2Q5UA 2R5BA 4DZOA 3M91A 2QM8A 1CZQA 5AVZB 1G2CB 3O8ZA 1FOSE 3UIAA 1GK6A 2W6AA 3P7KA 5AVQB 2E43A 1HBWA 5AVRB 1GK4A 5AW6B 2WT7A 4JYCA 1FOSF 1S9KD 1SP4A 5AVYB 3HE5B 4C7NB 2Q3IA 1GD2E 3VN0A 3M06A 5AW3B 2VRSA 2WPRA 1IO4A 4JYBA 1H88A 4M3LA 2H7HA 3WGUB 5AVVB 2P2UA 3V4QA 3SWFA 2C9LY 3OAKA 2R3CA 4XE5B 3HE4B 4KHXA 5AVTB 3TK1A 3V4WA 5APWA 2KP8A 1OWAA 1J2JB 4HYTB 3LIEA 3M9HA 3TYYA 5AVUB 1DH3A 2QM7A 5CMZA 2ZFCA 4AQRD 2ZXEB 2WPSA 3L35A 3NTNA 1JUNA 1HWTC 5AVSB 3B8EB 1YYCA 3I5CA 3M0AA 2XU6A 3M9BA 5APYA 2WT7B 2P7JA 5APTA 1A02J 3VMZA 5AW8B 2JJLA 4RETB 4C7NA 2WWWA 5AVXB 5APSA 3TNUB 2W27A 3P8MC 3NMDA 4B86A 1H8AA 3HE5A 1GU4A 2Z5HA 1SLQA 2YO2A 3VMYA
chains in the Genus database with same CATH superfamily
3AREB 4YQXH 3QIBC 1I3GH 2GITA 1VCAA 4YC2B 5KLIB 1CTMA 2VABA 4WUKL 3KXFD 2J55A 4J3UA 2H0PA 1GOHA 2H3KA 1ZN5A 3D33A 5HYJA 1JNLL 4HX1B 5GZOA 1ZXGA 3FFCE 3L3JB 3C60B 4DO4A 1EJOH 4MS8C 4HEPA 3HHMA 4ACTA 2KZ1B 1E67A 4WNQA 1FNGB 2OULB 3P30H 4HH8A 5G2NA 3R0MA 4JFEA 1G43A 4LSSL 1O0VA 3VXRE 1MJ8L 5JIHA 3SCMD 3CDZA 1CFBA 3L3OC 3MJ7B 5C0FA 5IK3B 3CFCH 1ZSDB 4ODTL 1CFNB 2ICCA 1TJGH 4HJGB 3WV0A 5FYJU 2JKWA 1LO4H 4P9HC 1EHKB 4JZNA 2EEDA 3KPLB 4IMLB 4KAQH 5EA0L 4M3JA 4O9HH 1NH6A 3EKCA 3ASWA 2W94A 3BQUB 3QEQD 4JFFE 4G7VL 3GSRA 5GS1A 4KKZA 1TU2B 4FL4B 3HS0B 1JYNA 3HD7A 4ABQA 4DOHB 3JTBA 4LLVA 3L72G 1TQTA 1WC7A 1T83A 3B5ND 1KT2A 4GQRA 3OB0H 1E5UI 4LL9A 2C3VA 1U9KA 3BEWB 5D96B 5DGRA 5DWUH 1FP5A 2WGNB 2F58L 3FTXA 2DWYA 3VFTA 1CBVL 4NSKA 3RWEA 3GM0A 3USSA 1ZP0C 1KXQA 4IRZH 2EDLA 5FHBL 3VH8A 3SY0B 2O5XH 3HPJA 1BIIB 1FL5B 3NZ8B 5HHME 4BZ1L 2C1OA 2QSIA 3X14A 3S6CA 4HD9A 2ZOLB 1PIFA 1IJ9A 4Q4IA 1T66C 4QRRD 4Y4KB 4WZ9A 5IFHH 3EGDA 2FATL 1B2WL 2HG5B 1OVRA 2CLVA 1DCLA 3L4CA 4BFKA 1NCOA 4XXDB 3QAZB 3K2KA 1JHTB 3U0WH 3BRGC 4S1SH 3WMM0 3QI9A 4RRPM 2VIRA 3GHBH 4DP8X 5JIDA 1YO4A 3BVNA 3MLZL 4KGLA 5LB1A 3TBVB 1E5AA 1SQBE 3VI4E 3NAAH 1T3JA 1UT9A 5C8JA 2WD0A 3D69B 2XNXA 2YAEA 3IJ7A 3MRDA 5EFIB 3WKNA 1DN2A 1TFPA 3GK8H 3BKYH 4B7LA 3V2AR 4AIEA 5IY5B 1WBZA 4JHBA 2YXRB 1CIUA 1AIFB 5INCA 5E1HB 2BPBA 2NZ1A 5GRVL 1GY1A 4JM2A 3V5KA 2BHUA 5C2BH 3FL7A 5EZJA 3DRTA 2APFA 3EO9L 4IRJC 4DFIA 3LEXB 5IFJB 4ZXBA 1S9KC 5KVDH 1NLBL 4EIJA 3A23A 1AD9B 2X44D 2Z1KA 5E6RB 4O2FB 4DP7X 5DJ6B 4IU3B 4C7NA 3EYOB 3U0TB 5FO9B 4LKXA 4X9BA 4JPQA 2DQUL 3GYRA 3P9MA 4HEPG 3OZ9H 1BWWA 3Q8BA 4NJAL 4UDUA 3N42F 4C4KO 4XPTL 2YEVB 3KNBA 2FQFA 3BPLC 3VRJB 1H3VA 5FUCC 3F7PC 4OZ4B 4A6YB 5ESAA 4P3DB 1G0XA 1QASA 4M1GH 4Y5VA 3FQWA 4Q14A 3OX8A 4A6YL 5ANMB 3K2UH 3BASA 1NFDB 1S46A 2QLYA 4NQDD 2Q10A 4C4UA 1NGXB 3CPLA 3DV6A 3QZLA 5K39B 2BFVL 1FVEB 4ODBD 4KC3B 3CN1A 4NUJA 1PY4A 3AAZB 3QH3B 1T21B 3CHQA 1DBMH 3E6HB 3FRPB 4K9EH 1CLYH 1S5LH 2QVTA 3DUUA 1NINA 4H25B 1O5DT 2NCEA 4XZ4A 3B6SB 1KB5B 3X13A 3SPGA 1PZAA 2V4LA 1DUYB 3V4UL 4PR5A 2VWEC 1CFSA 1ZHNA 2P24A 3MRIA 2C9UA 1KILE 4FFTA 5CJ5A 1VQNP 1KB5L 2DD8H 3PWPD 1WFJA 3RZCA 4PG9A 1MG2C 2H41A 5IKCA 1HHKB 1MUJA 5FYKD 3GHGB 1S72P 2VISA 5B3JF 5DRZA 3DXAD 3BGAA 1ZT4A 4HCGA 3VH8G 3SQOL 2AEQH 1D5IL 4HH9B 5TFSL 2Z91A 3SGEI 1QRNE 3MOAH 5I2IB 1OSYA 3D09A 1NTZG 3DX4A 2IYOA 4MDIA 4JPSA 5JHDD 4DVBA 1KC5L 4DPRA 4FRWA 4JZJB 1GYWA 2B77A 5DUPH 1KELL 1OTSD 4NUQA 4HUVA 2J25A 4KRNA 4PJAE 1URQC 4HUKB 4UT6A 2FGZA 2F2HA 2HUEA 2F1BA 3FT2A 4HWBA 1LTIC 4XP4H 3ZL2A 2JEEA 4MDRA 4P5TB 2P1YA 3M88A 2Z93B 2YGPA 2FO8A 1YDPB 5J12B 4FTVD 3JWNC 4U7KA 4OV5A 5D9SB 3PDOB 2BJMH 2L0DA 2X70B 1D2PA 3GSVA 2QLVB 5D1ZD 2OTWA 2VDOB 5F3BA 2CHZA 3P1VA 3LHPL 4KHXA 1OF2A 3GLAA 3IDMB 3QC6X 5C6PB 5ESQB 2J6EA 5IQ7L 4BFIB 4NEHB 1ED3A 1RUAL 1WCBA 2VDOL 5ALCH 5KVEH 5E70A 1P4UA 1E5CA 2VLKB 3IDUA 5A6IA 1K4CB 4IKLA 4K3HA 4C8XA 4ES8A 2L91A 5LGJA 3T0VA 3VA2C 1ZV8A 1EWHA 2W92A 3IDNA 4UOZA 5C0IA 15C8L 1PL3A 4NDMB 1NFKA 3HE7A 1IM3B 3B83A 4KUZH 1NCCH 3MRHB 3BO8B 3FF7A 1CDJA 3VMZA 4HHWA 1TTGA 2X38A 1SJEB 4NUGH 2FLMA 2H26A 4IGBD 4KNSA 1LT9C 1VZHA 4LVHB 4PJ8B 3DIFB 4WJ5A 5H94A 3ROLA 3G5VA 2XJKA 2NQCA 3UADA 1NOLA 4HU2A 4K9JA 3KGRA 4FNRA 4MTMA 1PLAA 1VQ7P 1Y6MR 3GBNL 3WXVL 4PJEB 1VFAB 3GMOB 3QO0A 1I4FA 1UA6H 2YBRB 4O5LL 1PG7L 3U9UB 4DT0A 1G9EA 4D3CL 3CL3D 3QQXA 2EZ0D 4CC4A 5J1AB 1X5YA 1XH1A 1NBYA 2X4TA 4OGAC 3RWHB 3GJFA 3GKWH 4Y4FC 2MH4A 3DI3B 1MKMA 4FKKA 4YPCA 3VQLA 1XR8B 3NSCA 3SKOB 2IPTL 3A0HH 3WD5H 4YX2H 2HT3C 5E24E 2RA1A 4GRMB 4N2IA 4FERA 1BM7A 2D7TH 1I9RL 1OEZW 1BX2A 1DBKL 1M3IA 1MHEA 2FFDC 2IGLA 2BCCJ 2FXOA 1ZTXE 4N78D 3RX9A 5ICZA 3JT0A 4BUGA 4JVPA 2F54A 5EUOB 4MZRA 3WFCL 1ZVSA 2Q76B 3WIFA 5JOPD 4O2CB 1I3RB 1N7SB 3FU5A 2X4UB 3QQDA 4FI6A 4QXTB 1AJ7L 3O3AB 1KN4H 3VI4A 5CU9A 1WZ1H 5HGDB 4U0RC 1RZGA 5ABAA 3EYUH 4ELKB 5I1JL 1CFQA 1HHIA 2CXKA 4XX1E 1KCUL 3M91A 2ADIB 3JUZA 2RMZA 4HWEL 1EO8L 3U6RA 3VMAA 1BLNB 2Z31D 4WW2C 5FKAB 5MHSD 3BVXA 4OLYH 3NCYS 4MRCA 1W0VB 1XTGB 2DQ6A 3X3GH 1WT5A 1A7OH 4I0CC 4WO4C 3MGOB 2YSSB 1A3RH 1TVHA 4XC3L 2HSIA 3LIZA 2EXYC 5BO1H 1GTNA 4DF9A 4UT6H 4D0DB 4U3FE 1BBJB 2X0UA 4HWBH 4F5CA 4ZFZB 1BXAA 4GAGH 4IW4C 4XN2A 1T1WB 2XFXB 2NNCA 4YHKH 3U36A 2DYPA 1BQHB 3QQ3A 4F9PC 4LXFA 3GRWA 1U30A 2IALB 4RAHA 2YD5A 3W57A 2V7HB 2NQ3A 3MRMB 4WVRA 4DO6A 1V10A 3WN6A 4RDBA 4MMYA 5JIPA 2FXMA 1R3JB 1D5MA 4EJ1C 4PP2A 2ZCKL 1EFXD 1XGQB 3QIUB 3D05A 3IJEA 3P0VH 1ONQA 1UD5A 4MD4A 4XMWA 3NQKA 4E36A 2AQNA 1HILB 3ZE2E 1K3IA 2F74A 3QHFH 4YSRA 1JEKA 4HIEB 5GGRA 4GBXC 3NOIA 2NNFA 2R56L 1JYVA 1KCWA 3EJZC 4KMQA 5CEZD 1Z9NA 4B86A 3T8XB 4C57C 4EN3B 1XZWA 4W4NA 1XB6A 3D6GA 1R5IA 1PQZB 2P28B 4GUPB 4JRYB 1BG1A 3SD5A 1HH6A 1Q8MA 1JCKA 4HGKC 5IW6A 1QZ1A 4JFWA 3A4DA 2M3BA 2Z8WC 4H2AA 2X6CA 3L75J 3ET9F 1MAMH 1L9SA 1K5WA 5HGHB 1O9WA 4Y8AA 2G9HB 4BDVB 4XRCB 5CIPA 5E8OB 5D1QD 4X5QA 4Y8DC 3EBAA 4L8CB 3II3A 3NK3A 2XXGA 3W0WE 1I1YA 2F5AH 4AKQA 3PWJA 4PMFA 2ZUWA 3GJFH 1CLVA 1IC1A 1C7SA 1YYML 4F7CB 2WLIB 1A5FL 2M26A 2WWMD 3A0BE 3M45A 3KXDA 4N1HB 2WV3A 1YEFH 3SHSA 1F6AA 3FB6A 3N2JA 4X6CE 1XCTA 1JJUA 4TLSA 5FYLH 1ADQA 5ADOH 1KCRL 1JOCA 2CAKA 1CFMA 5DU7A 2VT0A 1A6VL 3FOLB 2D4DA 4J3OF 3P11H 4TVPL 2OYKA 4HOWA 4AVKA 2FYVA 4ZUSB 3FT3A 3QUXA 3VXSD 2BEZF 2WINA 1CD1A 3I3DA 1MEXL 3OF6A 3SDXF 1F6LL 1BGYE 1N4XL 4K2UL 3L4VA 1MVFA 4U1MB 2CA4A 1KSRA 3LVEA 1MCOL 4X7SL 4XNXL 4L23A 5I1EL 2QM8A 1W2BO 3D87B 4M1DL 4L4TB 5T1JA 1IO4C 1JOIA 4OLUH 3RU8H 3ZKXB 5I1DB 3U7WL 5IF0B 2WSSH 4PBDA 3HRNA 2F19H 1GD2E 2LU3A 3IRZA 3VXPA 1FH5L 5CBNA 3HRPA 2GJPA 1H9VA 1TZGL 3G5XB 3LIZH 3O4OB 1HGZA 2AXCA 4U1SA 4XHJD 3B9EA 2G5BA 1CCZA 2UYLB 2YIUB 1KYDA 2QTVA 5KYYB 1M90Q 4P23A 4GW4A 4FF9A 2CMRL 1RK0B 1VSCA 1TQBB 1MRDL 2BRRH 1FSKB 3NCXA 2FAUA 1DH3A 1PBYA 4HK3J 2I5YH 3BJLA 3P4OB 1H0DA 2XUWA 1XF4A 2K7PA 3O4LA 3GRWH 3FQYA 3SBRA 1GJIA 4RIRA 2R15A 1FH2A 5I1KH 3D25B 1HCFX 4GRWH 1RZKL 2R1YA 1EC5A 1HIML 2P5ED 2PYED 1EEQA 1RE4A 3D12B 4WFHD 5ILTL 2ATKB 3GGWB 2MCPL 3FXDA 2DZEA 2AEWA 1AG6A 2Z92A 4I13B 5I8CB 5JIIA 4OZFA 5GGQL 5T3ZE 5JYLA 1Z0MA 4W9LC 2J59M 3B2UC 3GZKA 1OHZA 3E9UA 4ZW7A 5HTSA 4X99A 4P4KD 4PWGA 1E28B 3DV4B 4O51A 2WSEH 2QQNL 4WI7A 1HFUA 4YE0A 1JF6A 3IEAA 3IAQA 1LP1A 3H6PA 3L3GB 2K6ZA 3Q0HA 4H20L 1XGPA 2KYIA 3S8WA 2C9VA 1P84D 3N1MC 2FR4B 3GJEB 1KC8Q 1UM5L 4ZX4A 1TKWA 4PRHD 1YITP 5EN2B 4MX7B 3P3YA 3K2IA 1XSIA 5CIPH 2HFGH 5GSRB 3AQZA 1FNAA 5AZ2L 5IBUG 4Q58C 2FX7H 3WCYA 2XX1A 3D06A 3S36L 4DHLA 3GM8A 2I8DA 3TGUG 3D5OF 3V52L 1VGKA 2N1TE 2VE6A 4EI5D 1CD9B 3ULVE 4P59L 3QULA 2RD0A 2X2UA 2E6PA 5IESH 3JSSA 2GUSA 1S3JA 3L72D 2H1PL 3JBG7 4N5ED 4NQEE 4QI3A 5DJ0A 2IBZD 2WZPD 1ML0A 1MKFA 1ADQH 4JJ5A 5EZIH 4JAMB 1QSFD 1XZ0A 1V7NL 3BZ4A 4L1LA 5LBSL 1NEZA 4L3CB 1GA2A 4I5BA 3U4BL 4PBVC 2UXFA 4DW2H 1KDJA 4UB8E 1IZNB 4UUJA 1VPOL 2WC7A 1NU1K 2WVRA 3AGVA 4QRFA 5HI3C 5CJ4A 4JB9H 1RE3C 1EZVE 4EDWH 4PS3A 1HESA 3ATBA 3W68A 4OAWA 4QMAA 2ZYSA 2ZSWA 4NWUL 4CRPA 4NOFA 2ZWKA 4PJ5E 2DTML 2R29H 3HE6D 3KWXA 1FJ1B 3A4AA 3HNTL 5F3FA 4NP9A 4HKJB 3F01A 3REWB 1RI8A 4ZUWB 4APQA 2QZQA 1ZT7A 4EZKA 3TVMC 2NUPB 3U4KA 1OE2A 2HTKD 2OGUA 3MFFB 3CZNA 3JT2A 4JHAL 5FW8A 3CHSA 5HHQB 3FCGA 2Y5TB 1U92A 3PAYA 2NCMA 5AVVB 3UZEC 3VD2A 1WFTA 1SQ2N 3P40A 5B5EE 1GS8A 1IGTB 1UURA 1ZEAH 1YY8A 1QATA 4K7PH 4Z7UA 4XMZA 5FYJL 4AM0B 1K8IA 2CDFA 3IDIB 2B1AH 5J9PA 4QUOA 5GS2H 4LNRB 3DGGB 1OD7A 4AJYV 1N5YH 1CF8H 2ZCLL 1I1AC 3MCKA 1Q38A 2WPSA 3FX0A 2K9FB 1CU4L 2ZCHH 3RUGA 3TO4A 4OD1H 3FHEA 3CBKB 4OZFG 1U8OA 1T3FB 3MRGB 5TGBA 1Z9PA 3RK2B 4Y9EA 4F80A 5EEWA 5FA4B 4BKLB 2OXHA 3SWYA 3UG4A 4E9TA 5GZOD 3CFDB 4WEEA 2HCZX 4WY4A 5D7KD 2ICWI 1XH3B 1IT9L 4YHPB 1I31A 3NIFF 4RFEA 1IM9A 1H0TB 1TQVA 5HYEA 1YMMA 1P9MA 3V95A 2I25N 2XETA 2CHWA 4UM8B 2OYPA 3B7SA 4LRNL 2WLHA 4R5TA 3QWQB 4OZFH 1YNTF 2E9IA 1FL3A 5HHOD 3S5LB 3EG9B 3MOQA 3T4AA 1ZTXH 3OD3A 3QJOA 1AGFB 2FY8A 1T0OA 4J6RH 3PFUA 4S10A 4UCFA 3W9DB 3N44B 4RMBA 4CILA 4MJIA 5J11B 2W0LA 4ZMYA 5L8RJ 1L9NA 2HKHL 2PXYC 2IFNA 1XB3A 1PW3A 1JPGA 4OF3A 5A1AA 5HDQL 1CGSH 2ZCZA 4HEMA 2GTWA 4JY5L 4FFZL 5E2UL 1HHHB 1LEGB 2BDNH 4KTDL 2CBPA 1GSKA 5HJDA 3V0JA 4U3FG 5CN1A 3QH9A 4IRSA 4L9LB 2VB5A 4UB0H 4LC1A 4ANXA 4OFDA 4F7TA 1ETJA 3NIDE 1V7MH 2WQ8A 1KQLA 1QYGL 4PG2C 3VXUE 5FA3A 3L9YA 5DR5L 3IR9A 1NEZG 5GGSY 3T0EE 3WEBA 3KPQA 2FXPA 2UY6B 2YD2A 3CCMP 2V33A 1QHQA 1OP4A 1S3KH 4KQ4L 4JO1L 2BZDA 3DX9A 3BXNA 5EC1A 3ILQD 4GRLC 4NPYA 4NZ8A 1NTZD 3IFPB 3OZKA 3F64A 1KB9I 1EAOA 2E86A 3SE9H 3MKGA 4LL4A 5CZXC 1I7TA 4HLEA 4GG6E 1XL6A 5AYUH 1W15A 3B2DC 4C7RA 3VFNA 2NY3D 3QI9D 1KTLA 3WTYA 2J57A 1E65A 2ENSA 2DH2A 1G7MA 4PJFF 1KORA 4MZ2A 1VFBA 3MV9A 2OJZL 2R0ZH 3AREC 5BMFL 5KAQG 1DE4B 1FC1A 3O3DB 3HG0A 4YC2C 4BFGA 5KLIC 5JORB 4RAUB 4WB4A 2W07B 3OAUH 4ADIA 3PXJA 3UTTD 4FXKA 2AK4E 4Z95H 4RKUJ 4NOBA 1NC2A 1T1XB 2HRPL 3C60C 4MASA 3BAKA 5T1LD 1L4AB 3JVGC 1MFAH 2AHIA 5E9DD 2YUVA 4OZHB 1EK3A 1S7SB 2GTZB 1TYEB 2HJFB 2Q8AL 4D9QE 5ADPH 1L0PA 2YIHA 1UB5B 1NAKH 1Q0XH 1LK3L 4ZXBD 3UBGA 4NN5B 1TCMA 3ZDXE 4YIQA 5E56A 1NTKE 5DURD 3P2TA 4IMKA 4M7LL 3UBXG 3KHOA 2G2RB 3M86A 1SF3A 5CU5A 4PRIE 4AEIH 4QCIA 4I88A 2BNRD 2QEXP 3TA4D 3L3IB 4Q2ZB 1VPCA 2QKSA 4L4VE 5I17A 1K8DB 2B89A 2BVPB 5EU6D 4PJHB 1NKNA 4DCKA 5APYA 2DQHH 2D2CD 3BQUC 3CZFA 1X5AA 5AW8B 5D93B 2WAQA 1QLEH 2EICA 3QJTB 5CBAA 1ZCRA 4FL4C 3HS0C 2N1TA 3UOAB 3FNKA 4X4YA 3TYGH 4ZNEE 1E8XA 2E9BA 4QDGA 5C0AD 5D96C 3V0GA 4LF3A 1EUUA 3JXAA 3Q3DA 2VJ8A 2X09A 1BGYG 5F88B 1QQDB 4NQEA 4LMQE 4N0CD 3RAJL 4LEEA 5EEYA 3Q01A 2ETWA 4N28A 4GKZA 3VMXA 2KT6A 1QW8A 4DESA 1DD4A 3DO3A 4LSRL 4PWKA 2WNXA 4RNRA 3AY4C 2QPSA 3WL9B 1VJSA 4AXWB 4M6OH 1NLDL 3LQZB 2A74A 4MMXB 4Y4KC 1XD0A 1YCSA 3S3PA 3MLVL 1YN7A 2ZUYA 2O5ZH 4IBUA 3AEAC 3QAZC 1G94A 1E7UA 4M7KH 2OQJB 4OFYA 4ZO8A 3LN5A 2PPFA 3SGDI 4ZTOL 1RH8A 3ITKA 3C6LD 4KJQD 3S36X 3B37A 1FGNL 3GMQB 4MNQB 3EDDA 2ITCA 1LDPH 3VCLB 2V5RA 3RY6A 2IIJA 4MAYB 5JMRA 1G7JA 2A73B 4O2EB 4YQXL 1I3GL 3LKPB 4LASH 5D4JA 4BHUI 4GP4B 1EEYB 3SYCA 1MIMH 5KVFE 3FSAA 2RFXA 1BF8A 2CDEA 3ALWA 1EJOL 2I07B 3RGVA 3MV7E 5IVOA 3GTVA 5EU5B 1TETH 5AW4B 2Q8BH 3T6VA 5K5YA 2Y06L 1HYSD 1IAII 2Z7WA 3CDFA 3P30L 5G4OA 3QNZA 2AVFA 1N9PA 4TVSa 4Y7OC 2D3VA 4D0CA 3T0DA 3ALXA 5KLVJ 3DA0A 3L71E 4HALA 3CFCL 5CEXB 3RVWD 4QT5A 3SDAB 3L5WA 4QHLB 5FKPB 4AGOA 4RWHA 3HIZA 4DVRH 3FFCD 4ZW8A 1QVFO 4R26H 2PNDA 4KAQL 3LS4H 4ZUVB 4I9XA 4FS0A 1U2HA 3VXRD 4XNUH 3NIGF 1CXHA 4JCLA 1NIEA 2OARA 2KOGA 2X1PA 2GIMA 1SFCB 5AVTB 2QR0A 3PL6A 1KYAA 2VO8A 3I75A 1F4WH 2YD7A 4W9HC 3M9HA 5FPIA 4MJJA 3PQYA 1JPFB 3ZIYA 1JPTL 3CC2P 5AVSB 4WWKB 3LPFA 3MTXA 1LEIA 1UEYA 2PTTB 2DAVA 4JFFD 4QYOB 2AJXH 1PKQB 4YGVB 1X7SA 4EVNA 4PW9A 1FFQA 1DR9A 1N73A 1NA8A 2WBKA 5AAMA 3RNQB 2Q20A 3GSNA 4KQ0A 3V5DB 5IFHL 5FO7A 5C0NC 1Q9KA 3GHGC 4L8BB 3ZZLA 3VXUA 4PHXA 2JQMA 2QPFA 1RF0A 3VMYA 5C86A 5FOJA 1C5DA 1VADB 4L8SB 3RDTA 3D0VB 1U3HB 4XMKH 5HHMD 3MUHL 4B9FA 1IC7H 2GA1A 3KYMB 3NAAL 3T77A 3F7YB 3RPIA 4IIQA 3CCSP 4JZJC 4JCMA 3AEBC 4UIKH 1IFGA 1XGTB 1E3XA 4AMKL 3AWFA 2K3RA 5GRUH 2R0WH 5DQJA 1P7QA 3ML8A 3R2PA 3IM1A 3PAVA 3CDYA 5IJVA 4GG6A 1IAOA 3L3HA 1GGBL 2ALWA 4OKVB 4P5TC 5DEFA 1JN6B 2DY2A 1KYOJ 3ETBF 5J12C 4YSPA 1JGLH 1KLUB 3HZVA 2MOVA 1SQBD 3A2AA 3K72B 1KLFA 1MCEA 4HUUA 2CBOA 4LCYA 1Z9LA 4JN2B 5KVDL 1NGPH 3U25A 3IFMA 2GT9B 3EO0A 1ZVHA 1AHMA 3ZY7A 2AK4A 3QUKB 1RIHL 1XGUA 1FO0B 1YIJP 2WQSA 3PWUB 1T6AA 4YE4H 3M0DC 3EO1B 2X3BA 4LSTL 4Z78A 2H8PB 2KUTA 1FO0L 3L9BA 2AKRB 5HVWA 4PJGE 2WYHA 4M1GL 5CILH 2GC7C 1DVQA 3UG5A 1FC2D 5B5EH 1P5VA 3UL4A 4WNQB 1OD9A 4PJ9A 2A1WH 4Z23A 5IHZA 1LNUB 5HDBB 4ZZKA 3V0IA 2B7DT 2OMNA 7PAZA 4PJ8C 4LVHC 3CDZB 4UT7H 3L7FA 1AA0A 1GK6A 2WN3A 5AVQB 5C0FB 2KC0A 3FO9A 2APXA 2WT7A 4JPWH 4ZOBA 5ENWB 4ZG1A 1A6AA 1DBML 2XQYA 4BRYA 2C1PB 4K9EL 4LCCA 3S2AA 3BGMB 3O8XB 1CLYL 4OUUA 2QQKH 4Y9FA 4ELMF 4Y2DA 4JZNB 4Q8BA 2PO6B 5EF3A 5MEPB 3IMRA 4PV9A 4MKMA 4K8RD 1PCXA 1PX8A 4FX5A 1SQXJ 2C9AA 3GSRB 2FD6H 4RZCB 1BQLL 4EZJA 3OZLA 5GS1B 1XQ4A 3KPRB 3HD7B 3F7QA 2HFFA 3VD9A 1KT2B 2NY7H 3L2LA 3ZO0A 5ACLA 3MOAL 4IHOB 3STLA 3ETTA 4I48A 1N8RQ 1J1PH 5TF1H 3BDBA 1ZRUA 1LO3H 1WLHA 3E1ZA 4NSKB 1K6QL 4TV3A 4GQZA 3RWEB 4JK0D 3FN0H 3B8EB 2E6JA 1KILD 2XWTA 1JPEA 1R47A 1FZJB 1JUFB 2MKLC 3I9GH 5DUPL 4EPSA 3X14B 1L0NK 4MCZB 3QPKA 4K07A 1HX0A 4XP4L 3SDYH 1ZK9A 1CGYA 3OKDB 1DBBL 2D8KA 5I0DA 4Q89A 2NW3A 3V4PA 5K9OA 1N7SC 3EGDB 1QRND 2DQGL 3HE5A 3MV8A 3KLHC 3GSNH 3GFUA 1NIDA 1A02F 1QTSA 3GTTA 2ERJB 1E30A 4WI2A 3BVNB 3NPZB 4YO0A 4A7VA 1LO5A 5ALCL 5KVEL 3ILPA 3QUYD 3FGAD 3NN8A 4CU7A 3B9KD 1C9SA 3FHQA 4O02B 2FT8A 1QI4A 2CLZB 4YZFF 2Q7CA 1UVQA 4NO3A 3WELA 4L75A 1ZGLP 2YMTA 1L4IA 3HB3B 4FQQA 2FBWC 1MLBB 4O02L 1PGQA 5H35B 4PD4K 5E7BA 3V5KB 4JM2B 2IGTA 3J7HA 4PRNA 4KUZL 4XBGA 2YK1L 4U1IA 5EZJB 4LFHG 2ZYAA 3CH1B 2QEJA 2D3JA 1QKZH 2NNAA 2NT0A 2OMYA 1K8AQ 4Q9RH 2APTA 5D7LB 2E5EA 2Y0CA 4L05A 3PP4L 3ZYOA 2X2YA 4NM8L 1E3FA 2XXFA 1HDMA 5KVMC 1PZUB 1SQQK 4MQTB 3VYIA 1DZ0A 3P9MB 4KZEL 3IFLH 1IGJB 4TQPA 1UA6L 2DKSA 1N6UA 1JZ7A 2DIBA 3NCEB 3OKKA 1XXFC 2XKMA 3QIUC 5ESAB 1FNEA 1T2KC 3KR3H 1M2VA 2FYYA 2PCFB 4Y5VB 3OKEB 2X05A 3HC0B 4KOBA 1G6VK 3GKWL 1T4KA 3IDGA 2QDVA 1ZOYC 1YZZA 3CPLB 1W91A 3DV6B 2A6IB 4TNGA 4YX2L 3WD5L 1LM8V 4EN3C 4Y28J 1Z0NA 5E1GA 1CLOH 1PU0A 1RF1C 4KK6D 2BMKA 5M7QA 1DQLL 3CFNA 4JYBA 3DDGA 3MRFA 1CFSB 1ZHNB 3MRIB 5DCCA 1QI5A 1JO5A 4PG9B 3UXFA 2WM0A 2QBWA 1J88A 2VISB 3CNKA 4CL7A 1N59A 1ZT4B 1MHHB 5DRNA 5E6IA 5GGVY 3BWSA 1JWUB 4H26B 3POCA 4ZOAA 5CD3A 4RMRA 4KDVA 12E8L 3EYUL 1OGSA 2ED6A 3H0TA 3AWGA 4DVBB 5A2IH 4EEEA 3UYPB 1FNHA 3H4HA 3AEEC 4DJGA 1FZFA 2X4QA 3X3GL 4HUVB 3CCRP 1A7OL 2CCVA 2VDKH 3QQ9D 1A3RL 4XVUC 1SFDA 1GW3A 1ZA6A 3D39B 3FT2B 1WISA 4TMPA 4ZMOA 7FABH 2C4XA 1RV6X 4UT6L 3I9PA 1PY0A 5CJXA 2FHBA 2D31A 1PSKH 3GDBA 4FHKA 3OL2A 4N2LA 1YEEH 3V4PH 4U6HB 4UILL 4GH7B 4N90E 3GSVB 1CTOA 2OTWB 2DN7A 5HHPB 4PTTA 1OF2B 4AE1A 5JPNA 3QR1A 2M5AA 5AD0A 3NJXA 4PY8J 5I5MA 1T8ZA 4Z1MH 3ZKXC 2JB6A 3SBWC 1JG9A 4N22A 3E3QC 4NPFX 1UADC 4U3FD 4X4ZA 4ZDHA 2HLFD 5C0BA 5ANHA 3RL0g 5HYQA 2XKNA 3UZQA 4V2BA 3VFGL 3WS6A 1JXKA 4JBSA 1Z9SB 1F1AA 5C0IB 3S3JA 4FQHA 2RALA 1IBDA 1NYHA 3MNZA 3O4OC 1ZMEC 1NDGA 1W5CE 5IB1A 2F5BH 4F7MB 2COQA 5B38A 1P7BA 3N42B 1OT2A 2YIUC 2A9CA 2H26B 3I84A 5H94B 1VEOA 2WLMA 4JO5A 4FZEH 1TQBC 3MX0B 1FSKC 5SX5H 4AQ1A 4NZUL 3VVVA 1ORSB 2R39A 2BS71 4GODA 5KYWB 1JBJA 1IFHH 3RQ3A 2IANE 1RZKC 2AXFA 3JTTA 3VD5A 4H0LB 3B5GA 1MAML 2MTPA 2B5IB 3CFEB 1YUHA 1PPJG 3CAFA 3CVIL 1CWVA 1HS6A 1NBYB 2X4TB 4Y16B 3VXQA 3EJTA 4OM0L 5I5IA 4Z7OF 4HJJL 1TZOA 5I0ZA 1X9VA 3JZ7A 4MMZA 4YNYB 5CGTA 3CXHK 5F6HJ 2LABA 2WO2B 2AV1A 1YNLL 4KKAC 4MZIA 3VFPA 1BFSA 3AM8A 1BCCE 5JO5A 4TTDD 1AOHA 3ARRA 4CGUB 1MREH 4J23A 4ODSH 3VW3L 1YEFL 5I74C 4KTGA 4GAYA 1S5LX 3VSVA 4L3FA 5CKAA 2H89C 5ICZB 3EH5B 4E42A 5FYLL 4OZIA 3P4LA 3EJSA 2F54B 5B21A 1JK8B 5ADOL 2NY6D 4NCDA 1F41A 1ZVSB 1AG0A 3WIFB 3W0WD 2R3CA 3P11L 5T5NG 3K0YA 4NQCA 3GUTB 2V5YA 2W83C 3DK2A 3K5RA 4K23L 3R18A 1NAMA 1HSBB 5DRWB 3QHTC 4WY4D 1BXVA 3S96B 5GGTA 5CCHC 2CD0A 3VI3F 4KJPD 1EXUA 4L4JA 1BCIA 3VDCA 1FFPA 3VGHA 4PLJC 2YQBA 1WZKA 1HHIB 4D9LH 5IVXA 2X6AA 4Z9KB 3T1WA 3U6RB 1UWXK 2UWEF 1URLA 4P5SA 1JDAA 3VFRB 3SWKA 4HAGA 4OLUL 3HUSC 3MLUH 2IFFH 2E8YA 3T1FA 1P0SE 1A7RH 3ME0B 2VRQA 5ICXA 1J05A 2CCWA 2DDQH 2YKLH 1DBAH 1BGYD 3IKCA 4I0KA 3RVTD 2WMMA 2P58A 3L5XH 3T0AA 2YO2A 1JYWA 2FHFA 4WEMB 1UM4H 2WVSA 4KRMB 1NGQH 3IDXH 5FYKU 3WNKA 3ZYJA 3P4MB 4YDIH 1JFQH 3U36B 3NDYE 2NSMA 3DGDA 4IRSD 2N0MA 4UNUA 3EYQC 1ITBB 2BRRL 3LZQA 3LXUX 1GZHC 5FGBA 1HYRC 1S8DA 1K5NA 5FM5M 1KCVH 1J9QA 1TIUA 3HMWH 2I5YL 2VNCA 4M4PA 4XPGL 4ZQTA 3RFZA 2BZ7A 2FSDA 1NCDH 4X6EA 1CJYA 4PI0A 5C6TH 4GLRI 5B38G 3DO7B 4MMYB 2HRGA 4BZ2L 3SGEH 7TAAA 5I1KL 1U8QA 1EH9A 3GXIA 3I6GB 2Y6TE 3CFJB 4J3BA 1MZYA 3E9TA 1ONQB 2BVYA 1EUTA 3BCCG 1XGRA 4FJYA 1JVOA 4PRAA 3HTKA 3ENEA 4WEBH 4ZSOE 3QDHA 1MQ8A 2P1JA 1OTUC 1DLHA 1QWHA 3IS1X 5E2VH 5FGCB 3ZSSA 4MFHA 1R5IB 2XWDA 5LWYH 3EGSB 3HA0A 5EEVA 1XF1A 1FL6A 1GL2A 9CGTA 1RH5B 1QNZH 2Y0EA 3BUTA 1M7IA 2AFNA 2EH7L 3K4DA 2I26N 4K7FB 1IFNA 5F96H 3WENA 2XG4A 1JY2N 3RK2C 4Y19E 1SRDA 5T3ZD 4NFDA 2XIDA 2J8HA 1WRGA 1AR2A 4JFDA 1ZV5A 2F53A 3J2PA 4PJDE 2HFGL 3FTVA 1MFNA 3TSIA 1FZKA 1KQGB 2FX7L 3Q8EA 5DJ8A 1QR4A 2VW7A 1QABA 4ONGL 2X1XR 3UC0H 3GI8H 2VRSA 1S7QA 5I73B 2ADGA 5BVJA 2J8OA 3VP8A 3IMSA 1U8MB 4S1QL 2KKQA 1TO5A 1XCTB 3DUSA 5DD5H 1DDHA 5J11C 4I0PD 5IESL 1X5ZA 4HIXH 1M56D 5A2AA 3MA7A 4DFHA 3C9IA 2WXKA 3QEUA 2G0KA 1ADQL 2ATAA 5L2KA 1Q2NA 2QPUA 3QUXB 1YPZF 2R0LH 3OPZH 3U79A 1J8RA 3U4EA 5ELIA 4B41A 3C6EA 4DW2L 5I6MA 3BN9C 2N1TD 1VESA 3CDCA 1NAMH 4L9LC 4EDWL 4OCXH 1Q9LA 5GGTH 3ULVD 1LWRA 1RHHB 1QPKA 1YLBB 4NQED 4H8HA 5C07A 3IJYA 2R29L 1KUMA 3M17B 3RFRA 1AFVH 1X5MA 3KS0J 4KNTA 1QFPA 4IKIA 3WAJA 3P9LB 3VXPB 3SBPA 1OMIA 5HDWA 3V6FA 3K2MC 4P2RB 4DKFH 1RULH 3SKNB 3LRKA 4Y5YA 4R3SA 1ZEAL 2HX7A 1WWAX 3ZDZB 3DX6B 2V0AA 4M5SA 4PJ5D 4PLNC 3LHAA 5KBNC 3AE1C 2B1AL 1EAPA 4GW4B 2G8YA 4OBSA 2EVHA 2GSIB 2QJKB 4TNWF 5SWSE 4CPGA 1L0QA 3Q9QA 4QWWC 4BUQA 3BD3A 3PGDA 1A4KA 1DLFL 1ZE3C 4ZAKA 1N5YL 1NEUA 1H0DB 1M6UA 4PY7A 1QSVA 5DK0B 5AB9A 3FU7B 4JG9A 1A64A 1VACA 2Y5QA 5DJYA 3SQBA 4M3HA 1FLRH 4RIRB 2AEMA 2FCBA 4HKBA 1BAWA 4JRFA 2DS4A 2EIZB 3SOBL 1L4AC 3LIDA 5K59F 2YD3A 4PM1A 3V6BR 5J1SC 5CP7B 1OGAB 5C2UB 2Z92B 2V9RA 1RK7A 4OZFB 3U1QA 2QE7H 3QDGB 4NN5C 3TN0D 3V0VA 4X99B 1OSPH 5JYMA 3N85H 5HGBB 3SBQA 1YEWA 3K6FA 3ARBD 4KVPA 4GW1A 4P3WA 3DKHA 3A67H 5AUMA 2E74D 1RVFH 4LGSB 2G75A 4ZPVA 4F15B 1AXIB 5LXGL 2GB2A 4NZRL 2IYPA 2BSDA 2HJLA 4P46A 5D93C 2BDNL 4UAOB 1TKWB 4I18A 3BX7C 4OVNF 1DP0A 2HLAA 2CO1A 2IEPA 2H47C 2VZTA 2Y36L 1IUZA 1QBAA 4UB0L 3IGKA 5IROD 1J8SA 1VFUA 1FG2B 3APNA 1V7ML 4C59B 3SYQA 4BXVA 4MA7H 4TLUA 1VGKB 1T04A 1ZVNA 3DARA 3BP6B 4RZKA 1X4ZA 1R6VA 1QTPA 3QULB 1AIZA 1MY5A 1AR1D 3ZUCA 2BVEA 3SDXB 1S3KL 4Z7IA 1NAYA 2BY1A 1ZHLA 5BCAA 1BQKA 2E7LC 4MAUH 4H13B 4H88H 4MMXC 1B3JA 2P8PA 3O11A 3SE9L 4TTGA 5H8DA 3NACH 1INQA 5AYUL 3HJEA 4OFKA 3VXUD 4LPXA 1IGYA 5D2NC 3H2WA 2PTVA 3NFSH 2R1WA 4HPYL 3T0ED 3RDTD 2K7QA 3GXDA 3WFHB 2FJHA 5I30L 3SDDA 2PP6A 1KF9B 2ZSWB 4MRBA 1T0MA 2R0ZL 2X4PA 4MAYC 4URTB 2MWCA 1AC0A 1SHWA 4FYSA 5DMKA 4CVXA 4APQB 3OAUL 1JNNH 1M7XA 1ZT7B 2MEJB 4OFIA 3ARDA 3FUFA 4QAWA 5FV1L 5KAFH 4Z95L 5IP4A 4LVOB 4HDIA 2VXUL 1QLFA 3NJNA 2DF3A 1XAUA 2NR6A 2OMXA 1MFAL 2BNQB 3N43F 4JY4B 4N5UA 3O2DL 1EGJA 3LPOA 1U8PB 2Y2YA 3CMOH 3F00A 4L1SA 1A6UL 1AD0B 4KX8A 5E8DH 2DQEH 4OIAA 5BZZA 2XWCA 3ZBMA 4Z7AA 4Z7UB 5TH2A 5ADPL 3CDGA 1K8IB 1Q0XL 2CDFB 1F4XH 5J9PB 1EJFA 1X9LA 2VQ4A 3PJSK 3SDAC 1VEMA 3CQQA 4AEIL 2AK4D 3MCKB 1OANA 1X5KA 2C7UA 3ESOA 5LVEA 4LFHD 5I8KH 3RUGB 3TO4B 4NFCA 2OTUA 3S4SA 3IK2A 4LSVH 2CM6A 2BWDA 1HWGB 1QUNB 4XPBH 1QLEB 2DQHL 1JZFA 2A9MH 1ZANH 2R1XA 1ETZB 4HWNA 4D9QD 5L9DL 1RPUA 3TBWB 4HGWA 4GOSA 4A38A 1EAJA 1QLEL 2DW5A 3AGWA 1SFCC 3KWUA 3RBZA 3RTQA 1NTKD 4N86A 4GKNA 3AY2A 4W6YB 1IM9B 1WAPA 3AQXA 4NQTA 4PJ9D 3TA3B 4ZO7A 4PRID 3EFFA 3J27A 3TYGL 4U0QB 4G80A 1W0WA 4L4VD 4M8VA 4MCNA 3BH4A 4EI0A 5DHMC 3I85A 3MMEB 1FL3B 1RURH 4L2LA 4JM4L 3BT2L 4WWKC 1Z56A 1E2ZA 3QYMA 4PTUA 1I8IA 4UYQA 3CX5E 1IE5A 5T1KD 2DB8A 3LKSA 4P5KA 1NBQA 2QL1A 5DWPA 2L4OA 3UROR 3S34H 4M6OL 2CBMA 1Y9BA 4KK5C 3JV5A 1AP2A 4MXQC 3WNMA 2O5ZL 5C08A 3MUDC 4U6XA 1S78D 2CALA 2YEQA 4M7KL 4ZRGA 3WJJC 2ILLA 5J06A 1AXSB 1MW0A 1SQPG 4L8SC 1HOCA 3L1GA 5CCKH 2WYZA 3G9RA 1U3HC 2ICWA 4EE2A 1LDPL 5DSCA 1S7RA 4URKA 2LHAA 5AAPA 3H3KA 1DVTA 3QDME 3C1LA 3KPQB 3SWFA 2WXIA 2IPUK 1L3WA 1MIML 2YPKB 2XWXA 2E5YA 4N3YB 1UZ6E 1NU1J 3B2XA 3DX9B 2BSTA 5EC1B 1JRHL 1A3LH 5LBGA 1TETL 3G6AA 4QF1B 2W80C 1UIXA 1YEJH 2UXTA 4FP8L 3WEMA 5T1MA 1ASOA 1KTLB 3ARVA 3FZUD 1QBLL 4PJAF 1WD9A 5JIKA 1G7MB 4KKQA 2APVA 3VXTA 1H9DA 4A7GF 3EJJX 2FWOA 4U7SA 4MSWB 1YQ3C 2I60L 3DVGA 1U7JA 1G7HA 4HKXB 5L88H 1XVSA 3MV7D 2WSCJ 3GZQA 3CSPA 3QEGL 4R26L 1VQ6P 3LS4L 4HU8A 2Z1PA 3H9SA 1WEJH 4W68A 1Y47A 3IDYB 4JDVA 2QGDA 4AJ0A 4XNUL 5DD0H 1UZGA 2NX5A 4HKZA 4IBLT 3TT3H 3INUH 3VD7A 4F7EA 1LP9E 3RVXD 1J5CA 2OSXA 2C5DC 4HIJA 1E9QA 1PTZA 4JO4H 1S9KE 1KPRA 2VM3A 1F4YL 2ZXWB 3ULUH 3OHMB 3BAIA 1SM3H 4H0IA 2G3MA 1EGJH 4K7PX 1NBZB 4K9EC 1MI5A 4Z7WA 3WI9A 2OX5A 4PJBA 1IIKA 1NCJA 2WXQA 1HWWA 1RZJH 2BFGA 2DBLL 4NHCH 4JFXA 1CYWA 3DECA 3O8XC 3H1IG 5SWZA 3OM3B 5IT2L 1JGVL 5I17B 5MENE 1NCHA 2C26A 2AJXL 4G8GE 2J72A 2PO6C 5FUCE 3SCMB 3Q8AA 4LU5H 2YUXA 1QA9B 3G08A 5I19H 3CZFB 3CWBE 1F00I 3QFJE 1J11A 1YNTB 5GS1C 1KYOI 2XTJE 4G9FA 3K8MA 2DWEA 1L6PA 5F0JB 1AHWA 2A6DA 4BA8A 3HD7C 3CN0A 1PZCA 5DA0B 3G6JE 4P2OD 1T83C 4KVCH 5MP6H 3H1LE 2VKXA 3FHAA 3QPXH 2DMGA 3MTRA 5C92A 1LO2L 4KKCD 1JVLA 2CDGB 3SYOA 4LO9A 1JMZA 4V2CB 5EN3A 1R5WB 1RUKL 2W6BA 1G7LA 4NIKB 4QTIH 2R0WL 2YMXH 4RNRB 1X5GA 4I9WE 3B5NB 5C0JB 4LOFA 4E9RA 1IFIA 5FIEA 1DUZA 3DX1A 1KJMA 1D3CA 3GMNA 1RQ5A 2L7EA 3I9AA 1JGLL 3WOVA 5L6YH 3DTXB 4R5XA 4GG8A 3HG1A 4KRPD 4ZMNA 2GEQA 4EF3A 1A7QH 2ERJC 3H1JE 3VN0A 4APXA 2WHVA 4Z7VE 3UTSE 5GSVB 2V5SA 5JNYA 3WUTA 2ITCB 4OV6F 1CL7L 1EJ8A 1U6AH 1W72H 2IDTA 5LG6A 1WA2X 5IMMB 2HTLD 5IVZA 5IVNA 2DKUA 4TNVK 4D8PB 1GY2A 2K3HA 3GI9H 2CNZA 4QRPE 1JPST 3A6OA 4BH7B 4YSUA 5GHWH 5AAWA 3HB3C 3BH8A 2RFXB 1ZJAA 3B2MA 2BRQA 2Y9ZA 2CDEB 4ZOEA 2EIMB 5CILL 2W81C 3QP3A 5GZNA 5K1JA 4JM2C 1DJSA 1LVEA 5IWLA 3QC5X 1Q90D 2H6PA 2JJWA 2A1WL 3QNZB 4PSRA 5IFAH 4D0CB 1FRGH 3C8KA 3NZHH 3B1UA 4UT7L 3KPPA 2DKMA 4G42A 4JPWL 2K4AA 3V4VB 1DFXA 1JF1A 1YYLH 2PCPB 2QQKL 3SGJA 5H2BA 1JIBA 3V4VL 1WFOA 5T8IA 5IJKA 4CJ1A 2X4SA 2GJZA 3A4EA 5C0BD 3Q44A 1VA9A 2CBQA 2WSFH 2ZX7A 2H3NB 4JQIL 2V6HA 4BHUA 2DMKA 4ORZC 2FD6L 3C8DA 1E2WA 4M1CD 1GTWA 1A22B 2R83A 3PL6B 4TLTA 4HKZH 2FK9A 1RY3A 3RLSA 1UWGH 1H89A 1BJ1J 3O6FB 1J1PL 1NMBH 4QXWA 3PQYB 5TF1L 1KB9H 4PV8A 1LO3L 3DPDA 1NL0H 3FN0L 1LILA 1YN6A 4XE0A 2VLJA 5EOCH 1GGCL 3I9GL 3HI1B 4IFFA 1X4XA 3ZE2F 2O01J 4QOKE 3VNZA 1N73B 5TD4A 4BKTC 1A7PH 4F24A 4DP1X 2ZWLT 4XOBA 5IJBC 2FX9L 4RO0A 2VN6A 3FUIA 3GSNB 2PPCA 2IH3B 3LRLA 5FO7B 1D5BA 1Q9KB 4PEEA 5KAQF 1TZ8A 3GSNL 1D9KD 3BAXA 2W0PA 5KBLA 1UGKA 3L74E 1C5DB 2VMJA 5A7EA 1KXVA 2W59A 4OGQD 1THCA 3JQOB 4EZLA 2UVFA 5E99H 1U91A 2BHYA 1C08A 3FU9A 1T7VA 1ULVA 3RPIB 2D7QA 2FNBA 3HI5H 5DT1L 3DETD 3EAKA 4LBAA 2HPOA 4NXKA 1KV4A 3SY6A 1M7LA 2YGOA 3MRCA 1P7QB 5DQJB 3SE4C 1NAFA 1VF5D 2F8OA 3IFOA 3TNMA 2XU9A 1JY3N 4M48H 5DEFB 5EPMA 5JHDB 5IHBA 1UXWB 1OX3A 5KSVA 2ARJA 3OXSA 4HV8B 1VQ8P 1P84K 4LCUA 5HY9A 3SN6N 1YHPA 1MCPL 5TISH 3IRPX 3N0AA 2KXPB 1KLFB 4LCYB 2OTPA 3CK0H 5IIEB 2NDFA 4IOSD 3BPOB 3G3LA 4X6CF 1E0OB 4Q9RL 3DBXA 1CFTB 1K9TA 3EO0B 2W9EL 2F15A 1XSKA 2FIRT 2FYUE 1PAMA 1J1OH 2A6JA 3FT4B 3IFLL 2HPCB 4WNSA 4Z78B 4IRJA 4N2GA 4OSUH 3V4WA 1F0LA 5I1CH 4HT1H 4MJ6A 3WUVA 2IAMD 3W39A 2BX5A 3KR3L 5F71A 3ZQXA 3MR9B 4WHYH 1Y18A 5D2LE 1X9UA 3T9WA 1P5VB 3NFPB 4PGBA 5DVLA 5GS3A 2B15A 3S0PA 5IV2A 2N56A 1VQMP 3E7KA 5F7UA 3ES6A 3O45A 3ARXA 4YEEA 3C08H 3L7FB 4YN3A 4YFEA 3FO9B 2XBDA 3JYCA 1NKZB 1CLOL 2WT7B 5T5FA 5HYJB 4BRYB 3EBGA 3NIGB 2J4WH 5B3NA 3NYKA 4OUUB 5E4AA 4Y2DB 1BVLB 2Y6SD 4L0PB 4N3TA 5KUKA 4H0LC 4YLBA 2XZQH 3PCYA 2AQ3A 3SGDH 1F5WA 1OAKH 2B5IC 2O6EA 3EH3B 4DKDC 3G6JA 2WN2A 5APVA 3LKNA 3NK4A 2Q2LA 1SMDA 1FFNB 3EHBB 5I6KA 3EBIA 1F3DJ 3MLTA 4Y16C 4P9MH 2WLKA 4X5XA 2AF2A 4W9KC 1ECZA 3U83A 4S1RH 2HFFB 3HZMA 4CBZA 2LE9A 3BRTB 5DA4A 2BOBA 1WZLA 4UV4L 4IDLA 4EAEA 3STLB 4E9LA 4PLKC 1XF5B 4P9HH 1JGDB 4PY8I 5HPOA 4LLHA 3GSUA 2VDKB 4C58B 1GL2D 1IAIH 2XWTB 2J73A 4BGLA 1N2DC 1ZXKA 2VDKL 3QWRA 2VJXA 4JPKH 3RB5A 4JW3A 1PD6A 4X8GA 2NW3B 3V4PB 1NGWA 3S1KA 2D0GA 2KS1A 5EV7A 3RA7L 1PSKL 3QJRB 3E8UH 4P2QE 1S9VA 1G1CA 1YEEL 3V4PL 3ZN6A 5DC0A 1YHQP 4HQQL 4G83A 1U8HA 2WXJA 3EOAA 4WK4B 4YO0B 2GJ6E 2VKWA 2BXYA 1P1VA 2JF1A 3ILPB 4FLRA 4NCC2 3PP5A 2ZOOA 4P5MA 2XV5A 4WU7A 5JDSA 5TE7H 5EIIG 1LE9B 5CLXA 4NO3B 1R3LA 3PFQA 3CVDA 5IMOA 3RWJB 2QHLA 3O9WD 3D9AH 4X9FA 3RI5F 4NQXB 4N90D 4PRNB 1KTRL 5E4OA 4QXGH 4U1IB 5L2JB 2F5BL 1JV5A 4CMHB 1ESOA 3WEXB 3ZHLA 5EUKB 3ZKMC 5F6HI 2IDUA 3MRBA 3ULVF 2OMBA 5CMAA 5HHXL 5E2TH 3ABMB 4JANB 2VSKB 4N8CH 3DJSA 4ZS6D 1NGYA 5C07D 4NAQA 1FPTH 3TEXA 4AQ8A 1AQMA 1IFHL 1SOXA 2FJSA 4IDJH 5EORH 4EKJA 5C1MB 3C5ZB 4KROD 1PFCA 4WI5A 2ZQKA 1LT9A 4H8QA 1URIA 1FNEB 3ZX1A 2WQUA 1M2VB 5AOZA 3UDWA 3P4NA 1MAKA 3UYOD 5KSBE 1T4KB 1U58B 4HIHA 1NTZK 1CE6A 4LSDA 1U8JA 2I85A 2IGFH 2HYMA 3SYPA 3UTZB 3QCVL 3S37H 1J8HA 2RBLA 1ZLWK 3T5WA 4GOEA 4PW4A 2IAND 1KFAH 5I16B 2R9HD 1FVCA 3D85D 3H1LG 2BMKB 4JDZB 1MREL 4ODSL 2H5UA 3APMA 4XNYH 2QQLH 3AMLA 1E50A 5T5FH 4QD2E 4Y4FA 3F3HA 3KJ6H 2QQQA 3G5YA 3MRFB 3D08A 3S3BB 4BE5A 1XMWA 5CUSH 1DQVA 5JW4R 2DIAA 3CBJB 3MC0A 4BFRA 3UJTH 4OLWH 1YJDC 3Q5OA 2I1JA 3LMJH 1N59B 4P2YA 5DRNB 5E6IB 4KFZC 2FFDA 1RJZB 1USQA 5AW9B 5D7IA 4C56A 1IIIA 1ORQA 5CD3B 4H7VA 1BFTA 1L0NJ 3SPJA 3FS9A 5E5LA 3DJZA 2YC1A 4RWYH 5I73C 4R5VA 3GG2A 3D2UA 2X4QB 3AACA 3T3PB 2XLLA 3RZWA 4HHAA 5EU4B 4RA0C 4UIMA 1WIUA 5TPWL 5GS0H 3G71P 1E2VA 1GAFL 3LB6C 2DDQL 1R17A 5C0CE 5B1JC 2YKLL 2P46B 4V1DE 4DO5A 2EVGA 4Y99B 2DICA 5BVZA 3QUXC 3D52A 2G3ZA 1KG0A 1UFGA 2D31B 1HHJB 1UM4L 1NGQL 2H2PD 3JWNG 4YDIL 4MN4C 4QY8A 4MXWL 4HJ1A 2ZSVB 1OZUA 3O41A 4ESKA 4ECNA 1ZT1A 1F45A 3QUZA 3AT8A 1HSAA 1KCVL 4NX0A 2OCCB 4PD4J 5ERWB 3BKML 2YGQA 1J0YA 3FSZA 4RMUA 5EWIH 5C6TL 2R5BA 1H8SA 3L7EB 1YEGH 3L3DA 5HYQB 2F7QA 2C7FA 4U1KA 1AZCA 4U7JA 4LVEA 3JWNH 4UQDA 4FQHB 4XCEA 5KS9A 1EANA 3MNZB 3NIDF 5EZPA 1NDGB 4RJTA 2XYCA 1SQQJ 3ILEA 5B38B 3WIAA 1PLCA 2KZJA 3UJIH 5HHNA 2QJKC 3ZO9A 1SZNA 2AXGA 3MNWA 4B9YA 5LWYL 3EOTH 4BWTA 1S4IA 3QZWG 1KLGB 5KEZA 4XXWA 1QNZL 4U1LB 2AXTH 5AOLA 4TNWK 3N04A 4FQXA 2H0FA 1SJMA 1S4XA 1YUHB 4JJOA 4XBEH 3RILA 2XN0A 4NGHH 4IJTA 1X3DA 4Y0GA 3A6CH 5AOMA 4F93B 4UZSA 4MMZB 4FG6D 5F1SA 5B4MD 3H1KJ 3GNML 4MNGE 2E8ZA 4QHUB 2E9WA 1J18A 1LTAC 2AV1B 3U2IA 4BK5A 5L8LB 3IVKB 2BCCG 1DZBA 2VDLH 2PYEB 4RETB 5T3XE 4G6AC 4EUPA 2C4FU 4Y19D 1CLCA 3NMEA 4HF5L 5DD5L 4E42B 4DK3A 4JR9L 5F3HA 4BYHA 1F58H 5IB5A 2X4NA 4CW1A 1T03H 2AMUA 1N0XH 5LUMA 3QJFB 4F15C 2ADJA 3R06A 1CE1H 2NXYC 1GZQA 4Y1AA 4FABL 3BWZA 4P4KB 4NO0B 5J3HD 4UAOC 3ZDXF 2GJ6A 3OPZL 3R7QA 2MCMA 1U95B 3ZR6A 4NKIL 1QSEE 3FOMB 3VWKD 4B0MB 2XN9A 3F7VA 1FFPB 5GGTL 4Z5RB 5E95B 4EMZA 5DC9B 3N06B 4XX5A 5KJ7C 4NXSA 5IVXB 3K8KA 5JW4Q 3L16A 1CZ8H 4EOTA 1TCRB 1WK0A 1XR9A 3BH9B 4PGCA 3SFEC 3VTTA 2YRBA 7PCYA 2O5YH 3TJEL 1AFVL 2HPTA 3GLMA 3BESR 1Q1JL 4N24A 2FYUG 2MNWA 5DUJA 1E5BA 3T1FB 1OAZH 1FDOA 5ICXB 4H13C 1MCJA 2YRPA 1TF4A 1B0RA 2E75B 3BOVA 3IKCB 4R4BB 1KBBA 4XO9A 4Z7QB 1RULL 3C75A 5F21B 2AW2A 1XXDC 2H43A 2CKNA 3LH2H 5J4MA 2OR9H 2K3TA 2VITB 5FFOA 3WDIA 3ZDYB 4GAJH 3GJFK 5TDNA 2WXMA 1NCWH 5DYOB 5BZXA 4EXKA 1FDLL 4RISH 2BHFA 3IF1A 5E51A 4B9IA 1S8DB 3VE0B 2WBXA 4EN2A 2JWYA 4X6EB 1E27A 4MXVE 4JRXA 4RDQF 2F61A 3KYNA 4APQC 1F1DA 1G2CB 1FLRL 4HS8L 4QXUL 1U8QB 1ND0A 3ASNB 1CYXA 4AG4L 2H6UA 2YMKA 1OOWA 4Y5XA 2NYZA 1FE8H 3PYCA 2ZKXA 5SWSD 1RQVA 1QD0A 1WH0A 4WWID 2PW1B 1G84A 2YXWA 4CADB 2TRYA 4WUUE 2JKSA 3HZKB 3WHE1 1OSPL 4RVBA 2BOCA 4UTAA 1CXIA 1FL6B 1MF2H 1T5WA 2VR9A 1VZGA 3L75G 2WW8A 3HN8A 5BZWB 1F42A 3UABA 2HR3A 3TO4C 3WS3A 2H2SC 2ZJSH 3HAEB 1E9PB 3RHWF 2JKTM 4YDJA 4X83A 1P6FA 1RSFA 8FABB 3FONA 3CXHJ 3GEFA 4TYUA 4M8RA 4XMPH 4ZFQA 4YXKH 2HX8A 4EUPG 2QKIB 2F53B 3GXUB 1T3UA 2R2HA 3TA3C 3WFDH 1H5BA 3ZOAA 1R5VB 4MQXC 3TGXA 3C09B 3ZZ1A 2OSYA 3G5ZB 4KH9A 3MXVL 4ATTA 3AE3C 1EHXA 3NP4A 3MNVA 2JKLA 2WBJC 4MA7L 1WG3A 1VGEH 4AGNA 3FQUB 5C0CA 5BVJB 4K15A 5HYSG 5DTFA 2GJRA 5FUOH 2PF6A 5IGXH 5GJSH 5KANI 3LZOA 4NPJA 1BWMA 4EUPH 2W90A 1HVXA 2TRHA 3O6KH 3VI3B 3MA7B 2AXJA 3RKDC 4NYLA 5FB8B 5FGRA 3QEUB 4M61B 2HMIC 4H88L 2AJVL 1EEZA 1KEMH 4RESB 4JUTA 4PJXA 3RVVD 3D8MA 2UWEB 4DOHE 3NACL 3LSOB 3BEVA 3GLDA 1PIGA 5EO1A 1F3RB 4NQQA 3NFSL 1X6LA 1Q9LB 3P8CE 1KIPA 2CPUA 3KBPA 1ILUA 4FCAA 4LHUG 1WCQA 3F12A 4Q4EA 2N9YB 4U1GB 3S97C 3ZYZA 5D8JH 2J5LB 2EKSB 1ZLVH 3KGSA 2NTFB 1ZPUA 3UAJA 4JZOB 1JNNL 2IWFA 3NA9L 4HIQA 1MCSA 4C83A 2PFXA 4KXDA 1OFCX 1RE3A 2FZ3B 1B6UA 1X7TA 5CEYA 1I8KA 4JKPH 3PS6A 3HJ0A 3QFDA 4IOFC 4R4LA 2UXVA 4IU2A 4Y5YB 4OLVH 3KZIH 2DI8A 5E8DL 5TE6H 4R3SB 2DQEL 4QTFA 3OAWA 3THML 1BGXL 3KLQA 3GMAA 2DM7A 4P06A 1ZOXA 2EH8L 4KKLC 5KUMA 2KDYA 1CI6A 1A4KB 1BZQK 4ZAKB 2V2WA 3CUPB 5EZLA 1KDIA 4PYGA 4ES9A 3ZUNC 3BP5A 1J1DB 1E4JA 3G6EP 1DJHA 5DJYB 3SQBB 2M8RA 5EOQH 4LSVL 4OZGF 1AXTH 1AO7A 4HKBB 3L5HA 4YHOH 3NCFB 2J8UF 3B7RL 4U1HB 4PJCE 3IDYC 1RU9H 2YKPA 4UI2A 4KMLB 4J8RB 2GYSA 4OFPA 3H6AA 4HAFA 1HI6A 1UJ3B 4FQCH 5ISZA 4XP6L 1I1AA 3WLBB 3M46A 2X4OA 1AMXA 4LQFH 1VQKP 3WUUA 2VMDA 3QIBD 4UT9A 4LK4A 5T1DH 2BP0A 4YSCA 1JDDA 3HS8A 4YHMH 1VKXA 3V0VB 1PZ3A 4XNDA 2C9LY 2EJ1A 3KVQA 4HPOH 4IMKC 3TK1A 1KFGA 1KENH 1TU3F 4PJGF 1Z5YD 4MS8D 4XZUA 1MCRA 4GW1B 5I76A 3PIQA 2Z7ZA 4UTAH 5AUMB 4MDJB 3SCMC 4AQRD 4JGJA 2G75B 4JLRA 3SOTA 1DJYA 4PWIA 3P69A 1QSEA 2ZNWA 3S34L 1MAJA 2HJLB 2VMEA 4P46B 5ANME 1UOWA 4LKCA 5C9KA 2BNRB 2BLFA 3UERA 2J6WA 3II2A 4LEXL 4GLRH 3PGCA 4ZMWA 2A06E 1T7XA 2AJSL 5CJBA 3UP1A 2ZOUA 5LGKA 2HT2C 2OMVB 5HJGA 3KCPA 3A21A 3JWDH 4KJYA 1TJIH 3T8VA 5E0QA 2NYYD 3CD4A 1WBYA 3CX5D 4B0MM 1KV7A 3Q05A 3NMDA 3BISA 2X87A 1C8PA 5K9QI 4HUXA 1YPZB 3ECVA 5B39A 3TWYA 3B5NC 1ZHLB 2P5WB 5C0AB 4DP5X 4GFXA 3T6WA 4J39A 1ZLDA 5DJTB 2Q3XA 5CINH 1AHKA 3UCRA 2P8PB 3O11B 1OT1A 4G8IA 5CJQH 1MH5A 3KYOB 2DBJA 1J8KA 1INQB 2Q86A 4F2ME 4WNJA 4HC1A 4YLQT 3Q13A 3QDMD 3BRDA 4WVZA 2GBAA 3WIHL 3WMQA 1BZ9B 1AGBB 3V2NA 5LAPA 4X6FA 1R3HA 2X4PB 1UKSA 1T66D 2PW2B 1QW9A 1MOEA 4YXLH 5GGRY 3ARDB 4WO0A 1Y7VA 1YAIA 1N64H 1B0WA 2WSDA 4ILDA 4LAJH 5IMKA 5DD0L 2OMXB 2WKGA 2R51A 3TT3L 3QHZL 3INUL 2LVEA 4X6DF 2IV9A 1BP3B 4JO4L 3ULUL 2NSXA 1A8JH 4HW6A 1SM3L 2WMPA 1EGJL 3CDGB 3SKUD 2XA8H 3VQMA 3MBEB 4ODWA 3WUZA 2Y1AA 3MQIA 2WZ7A 4HX1A 1RZJL 4NHCL 3L3JA 3C60A 3ZHKA 1TLMA 1RIUH 2MQ0A 4YDVA 1R0AH 3DDFA 3AE9C 2C7UB 2YLHA 4ICWA 1FNGA 3S4SB 4IRJD 4KO9A 2NLJA 4LU5L 4BZYA 1S9KD 2R1XB 2HUHA 3MJ7A 3ZKSD 5I19L 5IK3A 3CFKA 1ZSDA 3O0RL 1CFNA 4M9PA 4HJGA 4QRUB 4YFLF 2R23B 3HNVL 3RTQB 3FFCB 4JEGB 5D72H 4HOMA 4GKNB 3U6XA 1RQUA 1QFWI 5MP6L 1A7NL 3KPLA 1W0WB 2VMCA 5MEND 3O6FC 2XRAH 3BYYA 3TC9A 5IMLA 2CA3A 4G8GD 4UT9H 5APWA 4PJEE 5E6YA 4IM8A 5MI0B 2OP4H 2EDHA 3CU7A 1SVFA 3CWBD 3QFJD 1TU2A 2MJZA 1I8IB 3HS0A 2XTJD 1GGIH 1N73C 5AAMC 1JY3P 4HCIA 1CK0H 4NP4H 3BEWA 4I8DA 1AGCB 4LRIC 1SDDA 3H1LD 3BHBB 1GR7A 4MBRA 5C08B 5IQOA 5L6YL 4U6XB 2HVKB 3J07A 4Y4HA 5EEZA 4JFFB 5B39G 1A7QL 1BIIA 1FL5A 3NZ8A 1T5KA 1W72B 2HKFH 4WI3A 2ICWB 3MA9H 2ZOLA 4ZFGH 3AS1A 5ALBH 4I9WD 4UBDC 1U6AL 1W72L 2X6BA 1EXJA 3MV01 1VAHA 5DJ2B 3MVSA 2AV7A 4Y4KA 4K7PY 2HG5A 2CHDA 5EUOE 4XXDA 3GHEH 2VYRE 3FPYA 1DQJB 1N67A 3DMMA 3HG3A 5CR1A 2R2BB 3H8NA 4DZ8B 4ADGA 4M8QA 3W5MA 4UOJA 1LWUB 3H1JD 2PWHA 2X3AA 4K55A 3TBVA 3ZGIA 3UTSD 4JDEB 1QZNA 2X1QA 5IOPB 3FO2B 1UKQA 1JS4A 2E9JA 5T1MB 3RP1A 3RIAF 2ZPKL 3NZHL 3AUVA 1NTME 1BD2A 1M9WA 2QMJA 4XCCH 1MRCH 1URQD 4QRPD 3OAZK 4L37A 1VIWA 2FWOB 3KBHE 3N41F 1YYLL 1ZA3B 3LN9A 3DVGB 1ZXQA 4HLZG 4TUOB 1T89C 2ADFH 2VQ1A 1FORH 3RX7A 3LEXA 2APBA 3VO0A 4B9KC 5IFJA 2CGYA 3H9SB 3JCUH 3H56A 4KBPA 3OKYA 1ZS2A 5AWNH 4GT0A 1I8LC 4HKZB 4O2FA 1PLBA 4G5AA 3IYLW 4LGDE 1E9QB 2R4SH 1KPRB 3VFVB 4OM1H 1CF1A 5FWQA 4Z7WB 1UWGL 2QFPA 4PJBB 1MDTA 1B4LA 1JNLH 4AYGA 2LTQB 1NMBL 1SOSA 2RTTA 4JFXB 5DVNA 5DSCB 3H9HA 4KKNA 2GW5A 5SWZB 5CBEA 2JCCF 1DQKA 5EOCL 5ANMA 4Y2DC 1NFDA 3CLQA 5G4NA 1RPKA 1NGXA 5JW3H 1A7PL 4KUCD 3X1FA 1FVEA 1DX7A 2EDMA 5DO8A 4YPJA 2IVFC 3EHBC 5IW1B 4JQ0D 3I6SA 4RBPH 5AW3B 3L4TA 3WNIA 4GEJA 4XR8C 5I1LB 3E6HA 3TOPA 4POZC 2GK2A 2HXAA 2WQVA 3FC8A 3R7RA 2FTAA 3MJ9L 3N50A 4WGVB 4HJGH 1KB5A 4MD0A 5EA0H 1DUYA 3CFBB 2RIKA 2DJSA 2CHXA 1DVUA 3VFWB 2IWGA 1IFPA 4QOKD 2GBVA 4KO7A 5E99L 4G7VH 4HMEA 3HI5L 3GHGA 4OGAD 4LP4A 4Y4FD 1LJ2A 4HH9A 4JQXC 3WE1A 1DUZB 2GJJA 3M1CA 3F04A 4M48L 5I2IA 2GIYA 3AEDC 2HT3D 2ORBH 5EF0A 1O75A 4LP5A 3L74D 1JXFA 1PEZA 2F58H 1MFMA 5FHBH 1OT4A 4JZJA 3RBXA 2BSRB 5A2CA 3HG1B 2X9YA 2KNCA 4W9DC 1J0HA 1H3UA 4APXB 1OAJA 1DJZA 1PPIA 4EI6B 1HZLA 3OMNB 4M6AA 4FXLA 4GSRA 4L9DA 4QPEA 1J1OL 3AXHA 2JKIS 4HBCH 2FATH 1B2WH 4TVPE 4H8WL 5IVZB 1BPVA 1YDPA 1NC4D 4MCMA 4OSUL 5D9SA 5I1CL 3HFFA 3EDEA 3PDOA 2NY4D 4PMEA 1JYXA 2X70A 3BH8B 1EXIA 1DEEA 4N6JA 3ETBJ 2WB7A 3IDMA 4PJAB 2V5MA 3H55A 1P69B 2EXSA 3K6SA 3CMGA 5KLVG 5KVGH 4CMHC 3WSQH 4NRYB 2CIIB 2VLKA 1FAKT 4H8VA 4NI3A 1K4CA 4ZUUA 2FYUD 3M0DA 4U33A 4KKPA 5AOJA 1FCGA 3C08L 4GAFB 5AB0A 3KDPB 4OD2A 4WO4D 3GHPA 4TSAH 1YEIL 1ODAA 2J5WA 1RERA 1IM3A 2J4WL 3CCEP 5JOEA 1GYUA 3E3QE 1HH0A 3UGXA 1R3IL 3EO9H 3C5ZC 4GB9A 1JZ3A 1GOFA 2X4SB 3LH8A 1SJEA 1HF9A 4ODVH 2GJZB 1OAKL 2L3BA 4PJ8A 1NLBH 2QSTA 3DIFA 4YDZA 5GQBA 4PCTA 4PB9H 5IBTH 3TEWA 2CKBB 2Y1ZA 3EJRA 2WPVB 2QMKA 4X50A 1NCIA 4UTBA 4S1RL 2YWYA 4PJEA 3GMOA 4CBPA 1OF0A 2YBRA 2CKBL 3ILDA 3U9UA 2MSPA 4BSVA 1WFIA 3D07A 3MUUA 3ETSA 4PV8B 3BKJH 1YN6B 5E1QA 2AJZA 3P3RA 4D7BA 3I6LE 4KXCA 1ZLUH 2B87A 3BN3B 3SKOA 2BFVH 4JHZA 1CT8B 4GBXD 2ZWYA 4IL6H 1PEWA 4X0NA 4AZUA 2VR6A 1S7XB 5GTIH 1INDL 2IC2A 3VXME 3BVHA 4Z77B 1S9YB 2A6KB 3F58L 2H7HA 1RD6A 3E8UL 4PSPA 4KO6A 1D7MA 1XTMA 1KN2L 1VQPP 4UB6E 4XODA 5CHXA 5T33H 1OKEA 3I02B 5J6GB 4GUOA 3VX0A 3L70E 1U8IB 1KYFA 2Q76A 4QJ4B 3MRQB 4F33B 4FQLL 1UB6B 4R7DA 4O2CA 1W0YT 2XN2A 4JY6A 2IFMA 1J1EB 5TE7L 2XC8A 3DJ9A 4GS7B 1D5IH 4PJDF 5DQDH 4LSUH 2O61A 3TNMB 1I7UB 4P3CL 3QA3B 4P2QD 4ELKA 3D9AL 4XTRC 4Y99C 2VZUA 3J8F7 5KSVB 1OAYL 3HEIB 2ARJB 3LY6A 4NKOA 4KDTA 4KX9A 3CCHA 1EQWA 4CC1A 1M1SA 2QT6A 1A02J 1BLNA 5CCHE 1KGXA 2GJ6D 2FEDC 4N2FA 1W0VA 5FCUL 4Z3TA 5E2JA 3D50A 1GS7A 3LNEA 3EF4A 1DEEG 1WDAA 3UGEA 5H37A 4TQEH 5D5MB 1KYOH 4W9EC 3NJGA 1OGTA 3ESUF 4PJ7A 1UXMA 4Y1SA 1TTCA 5EORL 2KL6A 4D6TE 4MJ6B 1PY9A 2RGSA 2B39A 2W9DH 3NJKA 3W39B 4P0DA 5CKGA 2FH6A 3L9EA 4LHUD 1PNDA 2VL5A 1VEPA 2IALA 2VDOH 4Z0BL 3TTSA 2V7HA 3MRMA 4G8FB 3SDCA 3UTPE 3Q8CA 3O45B 5E9NA 3HC3H 1IVTA 3S37L 1KJ2H 1CD8A 4JFUA 1LD9A 2F8VA 2QELA 4NBXB 3QIUA 2FYNB 1KFAL 3M6DA 2BSBA 15C8H 1WA0X 4JMXA 3RG1C 3JZYA 3K46A 2KBGA 4WI9A 1MVYA 2QQLL 3CHXA 4XNYL 1HILA 2GAZA 4GXUM 1INEL 5T5FL 5ACMA 1HEJC 3KJ6L 4AYDC 1SQXG 3GINA 4HIEA 1JXJA 4F8TA 1QPPA 4XCYB 2MJWA 3LKNB 4O4YH 5FYJE 4EN3A 1LQSR 2Z64C 5JLZA 2EIEA 4X5XB 1RF1A 1HZKA 3LMJL 4GUPA 4JRYA 3U9PH 3TF5A 5LQBH 1DEBA 3WXVH 2ID5A 3V5BA 3HZMB 4W70A 2EXTA 4X6BB 4NUPA 3QGVA 4O5LH 2BOBB 1PG7H 1BXXA 4AZ8B 1KB3A 2Z0BA 4UTBH 4ZTPL 4D3CH 4POYA 1KTMA 4OD3L 2XV6B 3ARTA 3T6QC 4RWYL 1CR9L 4PD4I 4BDVA 3GIZL 3VNYA 1SYVB 3HPLB 2WSKA 5H4ZA 2CUIA 5GS0L 2IPTH 3NH7L 4MLIA 2EINB 1J12A 4F7CA 4P4KC 3TDKA 1XF2A 3HBZA 1Z9OA 1I9RH 4R84A 2KS1B 1L0LE 2FRGP 5F1NA 1DBKH 1OCRB 3RY5A 1QL2A 1S9VB 3RIFF 1AV1A 4JUSA 3GUFA 3DUHA 4KXZI 3LZFH 2YMOA 1NTKK 4LB8A 3TF4A 4PRDA 5FGSA 3EOAB 1QHOA 3QJZA 2KZIA 3FOLA 5DLMH 3K6SB 3RVUC 3QPQC 1ZLEA 4DQOL 1NTMG 4ZUSA 2ZYDA 4B9JA 3AT0A 5C0CD 3PP3H 4V1DD 3D34A 2A5UA 4WU7B 2CK2A 1CBJA 3FB7A 1JL8A 1AJ7H 1P84J 2E46A 2VXVL 3AABA 4P5MB 3ZHFA 5JDSB 1HAUA 3Q2WA 1MCCA 1ERNA 4LT7A 4GXUN 5IMOB 4TRPH 2E75C 1R8EA 1SVBA 1G4RA 2POHA 2XKSA 4X7CC 1KCUH 4XAWL 3BLBA 5H37G 1KYUA 2FNWA 4L4TA 4HWEH 2B9AA 1N26A 3PHAA 1JV5B 5F2FA 3MP7B 1DCEA 4GO8A 5I1DA 3MRBB 1NPJA 2P80A 2AC0A 5C0RL 1JF5A 2BS9A 3UJIL 1TJXA 3DO4A 1HE7A 1BZ7A 1BQHG 5FGBC 3P02A 4IEFB 1NGYB 1JZ4A 5TF0A 3L72J 1OY3B 3G5XA 1A6ZA 5KAIE 1U8KB 5H37H 5ID1B 1LO0H 2EIJB 4ZMZA 1OL0A 3FMGH 5KYYA 2Y9YA 1M71B 5HI3D 1RJYB 4XBEL 3P4NB 3DHPA 25C8L 1RK0A 5SV3A 3FRUB 3MACL 4H40A 3QJQB 4UQ2B 4AITA 5CGMA 5L7XH 2CK0L 3A6CL 2ZWSA 4NZDA 1CE6B 3LKQB 1XMEB 3Q3GB 5ACZB 2Y22A 4QMEA 4EKXA 1SHXA 4ZO9A 4C46A 1MWAA 1FN4B 1SBSL 1HJ0A 1JZHA 3NA4A 2JIXA 3AE5C 3D25A 5F72S 3TVMD 2QGEA 2ZG3A 1GGTA 3ZTEA 1O9VA 3ZE1F 3WU1A 3GGWA 4I7ZB 1IAIM 3TEYA 1U42A 3SZKC 4EDXB 5EF2A 1T03L 5EU7E 1N0XL 3OA7A 2ZX8A 3ABKB 5C09A 1MJJB 3JWOH 1IK7A 3RGHA 1UZ8B 1OXYA 4AVHA 3RHWK 1IKNA 3GZPA 1SXAA 2QKIC 2IPPA 4LCWA 5C9JA 4JO8A 2GCYA 5D7IB 5T3XD 2ED9A 3C09C 4HXBL 2ZOKA 3L3GA 3W1ZA 4GSDL 4V33A 3BZFB 2BCKB 3US1A 4AGQA 1FZMA 1FDIA 3QQ4A 3GJEA 1FZAA 2FR4A 3IRCA 2O5YL 1CDIA 2XZCL 4DEUA 3D2UB 4FE9A 5EN2A 4PJHE 3VJ6A 4WJKB 1UATA 3OMAB 1IGFH 4UIMB 2GBUA 1X44A 1KWKA 1OAZL 1JI2A 4BFJA 3L54A 1YYMH 1DVXA 3DK0A 1A5FH 3BP4A 1W2EA 1QSED 5JMOC 4YSQA 4N0UB 4E0RB 1I8UA 1SXZA 3GBLA 4XH2A 5CLWA 2WXGA 3GMPA 2IOOA 2OR9L 2EE2A 4PRPA 4XP5H 3HUSA 3NUKA 4QY8B 5F9AC 2VZSA 5DRXA 2PXYD 1ZT1B 3AS2A 3QUZB 4BWNA 4RISL 4YR6B 3BSGA 1DN0A 4U1GC 3T2PA 1HSAB 3ZT6A 3OJ2C 4JAMA 1TMQA 2FO1A 3EH2A 1UYWH 2J5LC 5E23A 5FAAA 4TUKH 4UQ9A 1I82A 3ZVVA 1YYCA 1N4XH 4K2UH 3CXHI 4B5EA 4U1KB 2AK1H 3T8MA 1ZMYA 1GOGA 3G6DH 5I1EH 4XCEB 5KS9B 4KK8D 1GZHA 2VN5A 4Y5YC 1FE8L 3SJVB 3BDXA 3V6IA 1FJ1A 4HH2A 4HKJA 3REWA 1U8CA 4ZUWA 3TP4A 4GP8B 1IBYA 1JE6A 1ANUA 3LRHA 2NUPA 3ILQC 1MCBA 1PL5A 5HHNB 3MFFA 1UZ6F 2WLNA 3LRGA 5HHQA 2E5TA 2YEZB 4ZAKC 1TZGH 4GRLD 1MF2L 4HJIA 2EDDA 2XIBA 5ESVA 3JV0A 3HLAB 1J1DC 2ZJSL 2RR3A 2ZYGA 4FQXB 1NTZJ 3AMKA 1IGTA 1OP3H 3OKOA 4AM0A 1IAMA 4UZGA 1FYTA 1OK0A 2KDGA 4PB0L 4XMPL 4UNVA 4YXKL 4LNRA 1TXKA 3DGGA 1UJ3C 2Q6QA 2PR4H 1S7TA 3O3EA 4L1DA 3TJPA 3WFDL 3W38A 1DQDL 3ARED 5CR8A 2BIHA 1G1KA 3FTGA 4LEBA 5D7HA 1KN7A 1T3FA 2YXQB 3MRGA 5C6WH 3PABA 1XBRA 2EVIA 2EYRA 5EH1A 5FA4A 2LU5A 3KBFA 1VGEL 4GIOA 1F8TL 2H6OA 3C60D 3STZA 1MWAH 2WSPA 3FKUS 5ILTH 5IGXL 5GJSL 2H1XA 2PWEA 2AERT 5F3HB 5IB5B 2ROYA 1LP9F 3BPCB 2X4NB 3QIWD 4YHPA 5DUBA 1QBMH 3K1KC 2JJTC 2ADJB 3HE4A 2IQAA 2OYMA 1HNGA 1GZQB 3R06B 4Y1AB 1I9IH 3BCDA 1W8NA 2XWEA 4UM8A 4CMMA 4UOQA 3FWLA 3D2TA 1KNOB 4P46C 5A2FA 3EG9A 4U6VH 3ARBB 2I32A 2Z35A 3TFBA 1FNSL 2E74B 2XN9B 3F7VB 3FQ4A 4OGZA 1OTTC 4BK4A 2O30A 4ERSH 2EQDA 5FO2A 3RIKA 2Z0UA 3MPCA 4QHKJ 4OJFH 1KGCE 2HA1A 4KK9D 4PGCB 2YN5A 1DJGA 4Z3IA 1OW7A 4X8XA 3BQUD 1LEGA 2QRXA 2AS5M 5D8JL 1PKQE 3QCUH 3ZPDA 5DD3L 3FT1A 4ANWA 4L9LA 2DM4A 2H32B 3FUEA 1PZSA 3V7AG 1N5AB 1B0RB 3KCWA 4JKPL 1P7HL 3VYPA 3ZR5A 3CIAA 2Y25A 4XVSH 2DLEA 3P8CD 5CSBA 3AG3B 4OLVL 4FA8A 4W4OA 5TE6L 3MLWH 2X9XA 2VZVA 1KIQA 4Q6IB 5SX4I 1KPUA 1Q9OB 2D3NA 4JFPA 3ZT7A 1ROWA 4GO9A 3WYRA 1OVZA 2SODB 2ZX9A 4HK0B 4WWPA 2V5TA 1H6TA 4FEMA 4GPVA 3IFPA 3L1OH 3NTNA 4Y4KD 2HG5D 3KYNB 3VFUA 3OGOE 5EOQL 3VE0A 3ARDC 43CAA 3I5CA 1AXTL 4YHOL 3T0EB 1V54B 4KJQC 1DVZA 5JPMA 3OWEA 1RU9L 2ZKHL 3ULUC 4D8OA 2OL3B 4G70B 4Z7VF 4Y5XB 2CGZA 5KVDE 1NHLA 4FQCL 4NRXA 3WTUA 2TSAA 2OL3L 3BMWA 1DE4A 3O3DA 4UQAA 1RZJC 1SXNA 3MI6A 4HETA 4RAUA 1V8HA 2WQRA 5T1DL 4LIQH 4DH2A 5CAYB 4E2OA 3MBEC 4YHML 4JHAH 4HPOL 5CZVH 4FULA 2QZ5A 4N6RB 2BOCB 1L4AA 2ITFA 3OKLB 1KENL 1HYSC 4JQVA 2YA1A 1PYWA 2XJLA 4OZHA 1S7SA 3VFSB 3WLWC 1LYQA 1V55B 5FYJH 3NTCL 5CLTA 4HFWB 1UB5A 3IGAB 5I0XA 4Y7MA 3EADA 1SQVE 4I87A 4XMUA 1TZHB 1EO5A 3OXRB 3RTQC 2ZCLH 4JFEE 5HDBE 5FEBA 1H5BB 5AG8A 2G0LA 1L0LG 5JR1H 5LXVA 1K8DA 1S5LE 4PJHA 3JWDL 5I15H 1TJIL 3PAUA 2UUDK 1JWSA 1CI5A 1AS7A 1CL7I 1V3KA 2AEPH 3EOYG 4OW6A 4U05A 1U57A 4A7TA 3BCFA 4KUCF 4PRIB 2Y0DA 3ZMNA 4OLXH 4GW5A 4NYLB 1AYOA 2Y3NA 1FFOB 2A06D 1EEZB 3EXJA 4RAVA 4RGNE 5CINL 5DYFA 5CJQL 3Q1SH 2BVQA 5GJTH 3KPRE 3R19A 4Z1PA 1SN5A 3K8LA 4G6JH 4JHWL 4A2EA 3EF7A 3M1OA 1FOSE 3HBGA 5BOPA 3NFNA 3W3BA 3WL9A 4OCWH 5HDQH 4BIKA 1KXQE 4DN3H 4JFZL 5E2UH 3LQZA 5IM7B 2CG9X 4KTDH 4ZQKB 5B1KA 1MVUA 5C0ND 2M8XA 1ZHBB 4YXLL 3OHXA 1BQ5A 2BOLA 5D2NA 4BSJA 1N64L