2ZXEB

Crystal structure of the sodium - potassium pump in the e2.2k+.pi state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium - potassium pump at 2.4 A resolution
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 51
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zxeB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 2zxeB02
1GD2E 5AW8B 2E42A 3KQGA 2WPQA 4C7NB 3NMDA 4KHXA 5APSA 3HE4A 1OXZA 1MUUA 1FAVA 2Z5HA 1JNMA 3A2AA 2R5BA 2Q3IA 2W6AA 1J2JB 5AVWB 1FOSF 2C9LY 1GK6A 3LIDA 3HE5A 3M9HA 3TYYA 1NWQA 1CI6A 2YO3A 2WWWA 2YNYA 1H88A 5APTA 2WTYA 5AVYB 5AVTB 4B86A 2E43A 3SWFA 1GK4A 1CSBA 3A3YB 3UIAA 2P67A 1HUCA 2VRSA 4GKGA 3M06A 1T2KD 2C9NY 3P32A 2WPSA 3HE5B 3I5CA 1GTWA 3VMZA 2R3CA 3HTKA 2XV5A 3A5TA 2BASA 4AYCA 1GU5A 3WGUB 3VMXA 4I6MC 1H89A 1X8YA 3M0AA 5APXA 2XU6A 3VYIA 3VN0A 1A02J 1IO4A 4C46A 5AVUB 5APUA 1KQLA 5AW1B 2N9BA 2QM8A 5APVA 2WT7A 5APQA 5AW3B 4DZOA 4XE5B 3P8MC 1SP4A 5AVZB 2P2UA 1FOSE 1GU4A 3MGNA 5AVRB 5AW9B 5AW4B 1HBWA 3P7KA 5AVVB 1SLQA 1OWAA 3V4QA 3M91A 1YYCA 5AW7B 4RESB 3M9BA 3TNUB 5APWA 1HWTC 1CI6B 1MV8A 5AW2B 2IPPA 2ZXEB 2H7HA 3O8ZA 3M0DA 3VMYA 1S9KD 4AUWA 1GZLA 3V4WA 3HE4B 2W27A 4C7NA 3B8EB 1HJBA 3L37A 1JUNA 2ZFCA 5AVXB 3NXSA 2Q7CA 2R32A 3V5BA 3A7OA 3VTPC 1CZQA 2Z5IA 5APYA 2KP8A 4GT1A 5AW0B 1G2CB 3TNUA 3IR9A 1T2KC 3NTNA 5AW6B 3LIEA 2R5DA 3L35A 3NFQA 3OAKA 4JYBA 4AQRD 4RETB 4JYCA 4I2LC 4LC1A 2P7JA 5CMZA 3KDPB 4M3LA 1MFZA 5AVQB 5AVSB 1NAFA 2WPRA 5AW5B 1S9KE 3L36A 4HYTB 2YO2A 3MD0A 1DH3A 2QM7A 4EOTA 2Q5UA 2JJLA 3TK1A 2WT7B 2XZRA 3T97A 1H8AA 3WGVB 1A02F
chains in the Genus database with same CATH superfamily
4YLCA 4JHWL 2VNCA 2CUMA 1AZZC 4HISA 1TVDA 3M17A 3RYMA 1YAZA 4WK0B 2NY0D 4QF1B 4WI7A 4G80B 3FHQA 2UY6B 1A6WL 1MW3A 1P7QA 4KO7A 4JDVA 5I1IH 4N0UA 3NH7L 1AFOA 3QUMB 4OFQA 2OMNA 5ESAA 4HJEA 5EOCJ 5C0DA 4MBOA 3CHQA 5J0BA 1NC2A 4KAQL 3BESR 3GI9H 1SDDA 1NDGA 5E99L 4ZKPA 1BOGA 1S9WB 3BQVA 5C08E 4F58H 1D5IH 3I75B 1CLOL 3LRGA 1L9RA 1P7KA 2ZXAA 3NEOA 2FHFA 4I2XB 3V52H 2HT3C 2HFFA 2X89D 4K5NA 4PS4H 3HE5B 1T1XB 4R97C 3VXSB 2ZXXA 1A66A 1E67A 3FWLA 1ROCA 1CD1A 2R3CA 3HTKA 4UBDD 4KRLB 1YEHH 3ZU8A 5D2LA 3OHMB 3KPNB 1YITP 4HS3A 4YE4L 1CFSA 1H3VA 3MLRH 2EKSA 4G42A 5EZOL 4E41D 2XKMA 3O6FC 1HILB 2ZAIA 5DT1H 1J86A 4M03A 5BW7C 1IO4A 4LRNH 1I3GL 3ZDXF 5K59E 4P23B 1B0GB 2BIHA 4L5FE 3DSFH 4XPTH 3RU8H 4GO9A 3I02B 4YIQA 3DIDA 3LN5A 1KG0A 3I6SA 2G2NA 3P02A 3U83A 5EU3B 2AV7B 1UA6H 1JNHA 1MCEA 2NDGA 3NSFA 4BZ2A 4Q4IA 4WV1C 1B4JL 4B3EA 1TLMA 3L6FA 4M3HA 3WFDL 3PL6D 4DP6X 5F44A 1XH1A 1KILE 5CJ0A 4MQSB 2Q3AA 3ARXA 4Z7UF 2GSGB 1Q90A 1ETB1 4Q6KA 2WLJA 3ARED 4QEGA 3T3PB 3QW9A 3ME0B 4AZ8B 1WP6A 1X3DA 2XJLA 5HGAA 5JO5B 4P2QB 4GFXA 2GI7A 4XPGH 5FYLL 1XAUA 1E50A 2OXGA 3DHJA 1E40A 4AE1A 3HVNA 2Z31B 3CIQA 3L9BA 4PJ7E 1YYML 1FVDB 4K3HA 3QJOA 3UBHA 3FU0A 4EVNB 5C0ND 3IS1X 3MV9D 1UA3A 1VFUA 2NY2D 3L72G 4GAYA 4PLNC 3FQRA 4PHXA 3I2CH 1NPNA 3VSUA 2VN3A 4R7DB 4QLWA 4OH8B 2NUPA 5BRZB 4KZDH 5B4MD 1HHKA 3IMVA 1PZCA 3SDAC 1Q9WB 3L74J 2RKLA 2CIKA 2DQJH 3WE1A 1UKSA 1TVBA 2EH8H 4XX1G 3WIIH 1JPSH 3GZKA 4R9HA 1L0NE 4Q6IC 4WW2B 5CMAA 3LH8A 2GC4C 3QNXB 5DRXA 4WWKD 2CKBB 2NY1D 2NY6B 2EIKB 2V8MA 2NX5B 4TQ8A 4CL7A 4HJGH 4KMLB 3ALXA 1RH5B 2D03H 3ARBD 2CRMA 1LEKB 4DEWA 2NR6A 4CAGA 2F5AL 2DWDB 3MCG1 5B1KA 5F8QC 3C8DA 3EADA 4AY0A 4HJTA 1TFHA 1WIPA 5SWZE 1D2PA 3HA0A 4A2HA 1Y6KR 4PG9A 1G9HA 1GC1C 2DDQL 4WDIA 4HZ1A 1NINA 2A3TA 4NZUL 3GSWA 5GRJH 1I1AA 2MCAA 1LO3L 4K07A 4ZJ9A 4Z3JA 1LT9A 2UY7B 2OTJP 2BRRH 2OMZB 1KD1Q 2VO5A 3WS6A 3BHBA 4POZD 2X4UA 4IJ3C 4X9YA 5FK9B 4H8QA 3NDZE 2IFFL 4QXTA 3HPLA 2EVJA 3MX0A 2R1WA 3RA7L 4PYGA 3RAJL 3VFTB 2JIXB 4LEXL 5F9WB 3D3VA 5D1ZC 1BVNT 4E5XA 2GBTA 3EDFA 1FC1A 3RY4A 3WKML 3AQYA 3N1QC 2J73A 5CIPA 2BFGA 4CADA 5KW9H 1DVYA 4JQXC 4E5XB 1CFVH 2XV2A 3SN6N 1J8HA 4YSEA 1ZLVH 1IEBA 3H1LJ 1ZHLB 1GZPB 1XGQA 3QEHA 4RBPK 1NFIB 4DAGH 3ZHNA 3BFOA 1CXIA 2JKVA 1XL4A 2F54D 4GO6B 4IHOB 1DO5A 2KUTA 4R97B 4YHIA 3K2UH 2UY7A 3QWNA 1SYVA 2XQBH 3FUHA 5LQBL 3O9WA 2I26N 5F3BA 4UUJB 3V4PA 4EKJA 3WTXA 2Z1PA 4F33B 2WZ0A 3HG1A 1GU4A 2HVJB 3NA4A 1MELA 3K46A 2WXFA 3AU1A 4PJ8B 2MOVA 2Z7WA 3CMGA 3EJZC 2X3BA 2QSIA 4RJTA 4IJTA 2AJZA 1U3JA 1Y18B 4K7PX 2X4SA 1RUQH 1UM4L 5FKAA 1JMMA 1P6FA 3EJPA 1T6VN 2BMKB 1KEGH 4AM0Q 4Q9QH 4ETQB 3Q8AA 4GAGL 2NXYB 1PZ3A 2XA8L 4ZDHA 1AMXA 1I53A 1BZ9B 3IMSA 1FNSH 4HIXH 3KYKL 1OWWA 2JEEA 4J12A 5E1AA 2NX5A 1UWGL 3AG3B 4UQ3A 1ZTXL 1KIUB 1A0QL 5D2LF 2BZDA 5D1QD 1UM4H 2K1AA 3RVUC 2J88H 3LJ3A 4HD5A 2AJ3B 1MJ8H 1T2KC 2YQGA 4YSUA 2XTJE 4QHLA 4LSDA 2XWJB 4JL2A 2AXTE 4TUKL 1D2OA 3UJIH 4WFGD 1TVHB 4K3DL 2EDFA 4FX5A 4QIRA 2ZF8A 3BQUC 3TBVB 3IF4A 2VUKA 4MAZA 5FECA 3ZHKA 3D0LB 1BFVL 1LO2H 2IVFC 2YD7A 4PLJC 2EUXA 1N4XL 1FVDA 3P4LA 3FULA 3G6AB 4NZTL 1FFNB 1WYJA 3BUDA 5J12C 1IUZA 2V5TA 1E4KC 4I5BB 3V4VH 3WLWC 4JO3L 3ARDA 5JO5A 1URLA 4ALAC 5ABZA 3KLHD 5EV7A 4QKXB 1XQ4A 3VD1A 5AYUH 1T7YA 3RWJB 5KJRH 2EXSA 1PX3A 2UYLB 2WPQA 3QXTA 3C5XA 3TU6A 2CM5A 2Z1KA 4B95C 3ZTCC 4GRLD 3GZQA 3LZFH 2JWYA 3GHBL 2RALA 1LWUA 1FN4B 5D1XE 4OIFA 3ZYOA 1AXSB 5C09A 4U31A 1MFEL 3FTGB 1LO5B 3R1GH 5EU3A 3SGDI 1JUFB 4C4UA 5LCVL 1JZIA 3DX2A 3U2SB 2WCGA 5IMKA 3I02A 4HLZG 4XGZB 1QVOB 4M8VA 1TQCB 1S3RA 1W16A 1G7HA 3N5AA 1G7MB 1WBXA 1WAEA 3ATAA 4EEEA 4KZEL 2X9WA 1T2KD 2CBPA 3PWPB 3DX6A 4HJGA 3S2AA 15C8L 1PGRB 5J9PB 2XBDA 4W81A 4DKFH 2F8VA 4TN9A 4AEHH 1TFPA 1CD1B 4TPRL 1UD3A 5IM7A 2ZOKA 4KKPA 1R47A 5IT2L 1MNNA 4YHOH 3DDFA 2IADA 1KLGB 1XZ0B 3AG1B 1BEYH 3DECA 1T89C 2D7NA 3FSAA 1S3KL 3OTTA 1BOGB 1GIGL 1HKFA 1S9WA 2DN7A 5D5MB 1DEDA 2LFGA 3SYCA 3HC0B 5I8EB 2X44D 4G8IB 4AGLA 4DUWA 2IBZE 1HNGA 1JL8A 4QWWC 5LHDA 5C0DB 1VDFA 1A7QL 4HFWA 3T0EB 2E86A 1F3RB 2GFBB 1WC7A 4N0UB 1TZHA 5JDJA 3L3IB 3OVUB 2P44B 4PCKA 1IFPA 1NGPL 2VZ3A 4F5CA 4KFMA 4WTQA 1PG7W 4L74A 4FG2A 4ZI8A 4X0KA 3PRJA 2J6EA 2ZE0A 2D0FA 1IFJA 4UQAA 5JW3H 1JYNA 3H9HB 1A3QA 4FI6A 3WNPA 1QPPA 1F6FB 5FLUA 4JQVA 3LNFA 3QPKA 3C6SB 4HIQA 2D3JA 4GRWB 3WNOA 1J1DB 4AJ0A 2IPPA 2HTKC 1VACB 1MHHB 1ML0A 4HBCH 3V6FB 3L74E 1J7VR 2WVTA 5DEFA 1ZJAA 1MF2H 3Q9QA 5IQLA 3BUTA 2G75A 5T3XL 4PGEA 4U49A 2QPSA 5KSVB 3W82A 3KVPA 4FXGC 4ZSOE 4WSJA 1YPZB 1FGVL 3AADB 3R0NA 2KZJA 1IKNC 5JORA 3C12A 1W15A 3E0GA 3BEWA 3IFPB 4HUCA 2VDPB 5BXFB 3RURA 1F18A 1G9NC 1QFWL 4NP9A 3UMTA 1MCRA 4FNLH 2CHXA 4EOWL 5BS0A 5D6DC 2DBLH 2YLKA 1MIEL 3IFNL 4V1DA 4B60A 2RN0A 4WKZB 4OGQB 4ZXBD 1ZXGA 4RGOH 1MCLA 3FO9B 5B7FA 1YNTF 5HYJD 3HC3L 5AKRA 4YQXL 1EBAA 2VXTL 5CBEA 2A45I 5B5EE 2FLRT 3GMQB 2F7PA 4AE0A 4PVNA 4E41E 5F8RC 1AANA 1YUKB 2E7CA 1G6VK 4WIQA 4X99A 1M7IB 3JWOL 3KWXA 3GSUB 3ARBC 4DEPB 1P84I 5DI8B 3QB7C 2R5BA 1NTZE 2IH3B 1YMHA 5E7FA 4N1EA 3IMRA 3N1PC 1NWQA 1T0NB 4EDFA 5ID1B 4I48A 2UUDH 4F7EA 3ML8A 4PJCB 3O2VL 4ZW8A 4EXKA 4HXBL 4Z7NF 1AMYA 3I74A 1ZE3H 4NO2B 4HS8L 1OK8A 4MNHB 4HOZA 2VITA 4MLIA 3SDAD 3VVVA 1N0XL 5FXCH 3N41F 1AV1A 3PABA 4F3FA 5B8CC 2G0LA 2Y2TA 4DN4L 3VGHA 3FB5A 5I1CH 1SOXA 3VNZA 1KB5B 3O9WD 3D08A 4X99B 3I2CL 2QMJA 1HNFA 2XWZA 3CX5D 5EO1A 4X6BB 2J6EL 1Q1JL 4MMZC 3V6OA 4ONFH 1T5XA 3HTLX 1OVVA 3CVHH 4UNTA 1MFDL 2RIKA 4FXTA 1ACYH 3PDDA 2EUVA 2J59M 6CGTA 35C8H 1U8IA 4NZRH 3H1KE 5D1XB 3RGHA 4XMXA 3RL1B 3WO3B 3PL6C 1VEMA 4Y7MA 3F05A 1NANH 3D06A 2C1PB 3MREB 2VUYA 1L0LJ 1FNEB 5CCJA 4GKLA 3TNNA 2CDGB 3W39B 3F58H 2WVRA 2B87B 5L8LB 3S36L 2R69H 3HE6D 4XTRC 4FS0A 3MI6A 3M9BA 1MQKH 3KE0A 3OPUA 4LGRB 3PWUB 5AB9A 2B5IC 4JUTA 5KSVA 2HPTA 3W3BA 1XR8A 4P9HL 4TTDC 3QQ4A 3X17A 1S7VA 5DJDB 4PJ9A 2VDQL 5DGRA 1TJXA 4PWJA 2GT9B 2DEYX 4U2ZA 2FT7A 2FX7H 2MSPA 1F90L 1MRDH 3NSXA 4U1LB 1FZMB 4DZBB 1L5GA 2YOAA 3KCPA 3K71B 3EXJA 4OCLC 1RP9A 3D9AL 1RZ8A 4EN3C 2YHGA 3GTTA 1SQXJ 2IDSA 4JFHD 4MSWB 4Z5RB 2ZCKH 2YAPA 3UEZA 4DERA 1WC7B 4HIIB 3QYNA 4FFZA 3VP8A 4XNMB 5I1AA 4ZMZA 5CINH 3ARDC 1OB1B 5JOFA 2WXHA 1Q7YQ 1A4KA 1U8OB 5I8EA 2YD9A 4JVWA 4GG6E 3I9IA 1EEQA 1YRKA 1T6AA 3ABVC 4J6IA 2EVFA 3RVWD 4N28A 3O2WL 3G5VB 2D9QB 3TPKA 4R4BA 3R4YA 3FJTA 3A2AA 1N8ZB 1OGAB 1AGFA 2I60H 3V0VB 2AGJH 4LDEB 2ENYA 2DI7A 4PP1C 2OBGA 4A39A 2FDBP 2YO3A 2QR0A 4JO4H 1ED3A 4I2XE 1G7MA 1G7HB 1TJGH 5HI5D 2SPZA 4LCCB 5FYLE 4AZUA 1ZV8A 2NXZB 2QSCL 3SCMB 3QDGE 4XVSL 5IMKB 1R5WA 3ARFD 4J4PA 2R2HB 2IH1B 5HVFB 2CDEA 1XTCC 4PPTA 1BEXA 5D7SH 4M7LH 1NCBH 4MCMA 1QVFO 3PGFH 5C09B 3ULSB 3L4YA 5KS9E 1Y1DA 3ULVC 1UZ6E 3GSNA 3HE7C 4DP8X 1E5BA 1OAJA 1D6VL 1ITCA 3BCFA 3ATFA 1OP5H 1KYOH 2YGOA 2GW5A 2VJ0A 3GSNH 3HG0A 2G3ZA 3H1LG 4XAKD 3AT8A 2EDNA 1Z9SA 3CNKA 3WUWB 3BLKA 2OZ4A 4LEXH 3U48A 4N22A 3SJVD 1UZGA 4PJGE 4C56E 1NMAL 2VQTA 5LKNA 2C9RA 1R19A 2W60A 3EHBB 3P3TA 3T2PA 1MCDA 1CO1A 2I9TA 1NIEA 3CZKA 3FUMA 4WFGE 3WFCL 1MCPH 3TGUE 5EDXA 2GBAA 1H0TB 4NQDE 5TJHA 1Q94B 3RGVD 1WHPA 4DTGL 2OR9H 2Y1ZA 2ICEB 4CVZB 3H1KG 5GGQH 1NTMD 3QO1A 4IOFD 1O6VA 1YJDL 1CGWA 3ZOAA 1EFXD 4I7ZB 1FYTD 3HC2A 5I2IB 1KIUA 4YO0B 3VP9A 4ZMLA 1RUMH 4WU5A 2D3LA 2FX9L 2BWDA 2Q7YA 1SM3H 2UZYA 1BZ9A 3X13A 1KN2H 3LQZB 4G9DA 4ZDHB 5J7CC 4HS6A 3N55A 5MEOB 1OFCX 2E5EA 2Z4QB 1HHGA 3NRQA 2NY4B 3UC0L 2CAKA 3AUVA 3IETA 4FNUA 4J2XA 5C70A 2VE6B 1FNHA 5AVQB 1MI5D 3KR3L 4OAWA 4DKEL 2PYFA 1ZTXE 3LRMA 2VDLL 1HINL 4UT7L 2NY3D 4Y4FD 1KN2L 4AUUA 4F5CE 1FIEA 4PJ6A 2F53B 3O9WB 1MDTA 2H1PH 2NNRA 3D39D 4PY7A 2DJSA 4PMFA 2B4CL 2XDHA 1XO8A 1NFAA 4ZFOL 5B66H 1I3UA 1NFDE 1DLHB 2BNQD 4HWNA 3ESUF 5DUJA 5I1EH 4XNDA 1R34A 3RBSA 4K9EL 3FUFA 5I15H 2BNRB 4UNIA 3BP4A 2J58A 4JZNA 1GYCA 1P5VB 2X9XA 3ULUF 3VX1A 4KOBA 3OKYA 1SFCB 3OZ9L 3QXDB 4KTDH 3QEGH 4OGXL 5EO9A 3BZEA 4PIBA 4FRWA 4YHNB 1IGYA 2H3NB 4X4XA 5CD3A 3M9HA 4MWFB 5EBWB 3U9PL 4YHLH 5E70A 4AYDC 1C16A 3M7FB 4JL1A 5ESVB 3ECVA 5HGHB 3MX0B 4JY5H 5LGJA 3VD4A 4GAJH 3T6QC 4KO9A 2EDMA 1J8KA 1JPFB 2AANA 3E2HB 2C3HA 4RISH 4PJEE 3HS0C 2FYUG 1GTWA 1EHNA 4E0RB 1BQHB 3HZMB 4JRLA 1S7XA 2H32A 4FZEH 3N91A 4Z9KB 4YAQA 2K70A 5TQ0H 4FKHA 4W1TA 4DFHA 4N2DA 4QPEA 1ZS8B 3NIGF 1PZ5B 5D70H 1BGYD 5AAPA 1CURA 5SWZD 3ASNB 4JFQA 2KKQA 4K71B 5FO8B 5C08B 3SODB 1S46A 2OMWB 4HLZH 4NKIL 3F3HA 3TEZA 1UUSA 4N2GA 4S1DD 5A2FA 2DYPB 1Q1JH 2EC9T 3IEAA 4M62H 4B9IA 3IPFA 1LEKA 1G9MH 5APQA 3STLA 4EZLA 3FF7A 1SQQK 4EI5B 2QKIB 2Y3NA 2AJVH 3HFMH 1NUGA 5D70L 3L5JA 4F9LA 2B88A 1DBMH 1JNNH 2QKIC 5D7IB 4G6FB 4AH2B 5CJ8A 4QY8B 5DRXB 1I8LA 1HZHL 1T0MB 3OKOA 3DUUA 4EOWH 4Z77A 2ORBH 1BSHA 1IKNA 4NDMA 4XN1A 3WEMA 5FF6A 3UJTH 2X2JA 1VJSA 2HX8A 1NBZB 3ZDZB 3QXAB 1T5WB 1YO4A 2WZAA 2P5WB 1JTHB 3CX5E 1XGYH 1OF2A 3DV4B 3DJZA 3I3BA 2KQMA 3HHRB 1IFIA 5EWIL 5LXGH 3GRBA 3HE6C 4LLMB 4N78E 1SQXE 1KPVA 1SEQH 3QG7H 1RLBA 4P3DB 1P9MC 3CDCA 3EJCA 1FHGA 1N7SC 1SY6L 3PREA 1HAWA 1UZ6F 2EO7A 1TTAA 4JHBA 1IBBA 1GYUA 1FSKC 2GSGA 3WU2H 2BHYA 2NQDA 2W90A 4ZOAA 4YHZH 2WMPA 3AE1C 2VCOA 5CCGA 3VH8G 5KG9B 4FD0A 1SEQL 3GK8L 3ILQC 1R9FA 4M5TA 4FEMA 4PJIB 1C7SA 3AVEA 5AAMA 2GY7B 2LAGB 5EZJA 5MERB 3R06B 4IIQC 5HGGS 1A3RH 3WIHA 3A47A 4JB9L 4JR9H 4F8TA 3FT1A 2KK7A 3GMAA 1QO3A 1KCWA 2AQNA 1V7NL 5IG7B 1N6UA 3DDGA 3FTXA 2DOCA 2EKSB 5ALBH 3LIZA 4YPGA 3D39E 2PPEA 3KPNA 4NHUB 4J39A 5TF1L 4LPTA 2BWIA 2FYYB 2H45A 1KB9D 3BH4A 1WH0A 5L6YH 1GHFH 3VXSA 1E9PA 5HYSB 3EHBD 4Y19D 2HFFB 2WLZA 3MRHA 4U3HA 3U0PB 1T04A 3ZSTA 2BY1A 5E2JA 3O0RL 1NTMG 3O3AA 4B7IA 1NDGB 1TXKA 4L8CB 3CL3D 3NQIA 4EBQH 5GS1B 3CHSA 1X7SA 4Q0XL 1E9PB 5HYSA 2F58L 1CLYL 1KBGL 1MCJA 3GDCA 1YEDB 3ZUCA 3CFCH 4LSRH 5A2JH 3ECQA 1DE4A 2XWXA 3RPIB 2ESVD 4XB7A 1MAKA 3Q8FA 3FCGA 1G0DA 4M4PA 4KY2A 1KBVA 4YX2L 1SF5A 1KTRL 2HX7A 3HG3A 5CXPA 5J56B 4OZHB 5ILTL 5FUOH 2RJMA 4IMKA 3SPVB 3V4PH 3DK2A 4LK4A 2NY2C 3E6HA 5LNDA 3R06A 2NUTA 5M7QA 2W9LA 1M1JB 1JY3P 2AQ1A 3FYEB 1S9XA 4YNYA 4KKZA 5LXGL 4H44D 2D0HA 4NQSB 4RMQA 3K8LA 3Q5TA 4FQHA 4GSXA 4MVBD 1NA8A 3TLRA 3IYLW 1UQSB 3UBXI 3QQXA 4LDLB 4OF7A 2CE6A 4AYEC 1BREA 4AXWB 5JHDB 3ENEA 5K1JA 1SXZA 1FL3B 2AABH 1UOVA 4EN3B 2V7QH 5BU5A 3V2RA 3F7VB 4R90L 3W81A 1W0WA 1JGEA 1WG3A 2J2ZA 2H41A 3ZLQC 4I1RA 2FUTA 1KPVB 3NCEB 4PJFF 1KILD 3NT0A 1S9KD 4QYOA 4NSKB 1RHFA 3NZHL 3PCYA 2Q9OA 1W8EA 5F7WC 1KN4L 5HJDA 1OTSD 1PD1A 3MKKA 3T6WA 5JZ7C 1F3DJ 2H6PB 2UZIH 4Q4EA 5D5MF 3S0PA 2EZ0D 3DTXA 3O2DH 4P2AA 1X5HA 5DQJA 1AG0A 1CDCA 1HH6B 3KLQA 4BXVA 1HEZB 2B15A 4E5XG 2WLMA 1CLOH 2P7JA 3T65A 2OMBA 3UC0H 4M3LA 2XUWA 5B66E 3DUUB 3OD3A 5KKZB 2FJGB 2VDQH 2KPWA 1QACA 1CGYA 2P26A 1L9QA 3L45A 4TUJB 3UZVA 1QRKA 3Q06A 3EO9H 1V7ML 1WGVA 2ITCA 5D7EA 2YXQB 1SXSA 2EYRA 3IBOA 2P8MA 3FZUD 4AGNA 3MLSH 2WWNA 3WTUA 2NY5H 2Y5QA 2F8XC 1OP3K 4PGCB 3UPCA 4NQDA 3MCKA 4XO5A 5C08D 4PVMA 2P49B 3ISWA 1T03H 1KFMA 5FKPB 3ULUH 4A37A 1JZ5A 2WMMA 1X4YA 4C7NB 1WWAX 3LHPL 5DJYB 3SWKA 3CCMP 3FT2A 5CLZA 5EA0L 1A7PL 1WVZA 1E2ZA 3NJIA 2A45H 4LEOB 4NAMA 3S37X 3CBJB 1BQHA 4YXLL 5C3IA 3OR6A 4NCDA 1NC4B 5CBOA 2DQTL 3LKQA 2MRYA 3HNTL 5FUOL 3VXRA 1T22B 5GRUH 4FQQB 3SWFA 2V9TA 5FYKH 2E56A 3OR7A 4H13B 4KK6C 4MWFA 2X40A 2VZUA 1BV8A 3MV7D 1KTCA 5EFIB 2ICCA 1U93B 3CLFL 3HG2A 4X4XB 3NRFA 4ESKA 3W37A 3VA2C 3NABL 4HWBA 1TQWA 4JDZA 3JQOB 3R19A 1AD9A 3S3BB 1CXEA 4L4VD 1OQOA 2VSDA 1QUPA 2EDOA 4MAYD 1DLHA 1EHXA 1G1OA 1CE6B 3MODL 1SDYA 3KBPA 1O5DT 3KPSE 4LEEA 4XVSH 4RFOL 5F96L 3CXHJ 4NFDA 3ZN6A 1EAOA 1JPGA 4PN6A 2QQQA 1XF4B 1KFGA 1U58A 1A2YA 4MXVE 3LS5H 1PG7X 4N0YH 3O3BB 4PV1C 1VAHA 3RK2C 3H1JJ 3U46A 3DIFA 3MUY1 3FDWA 1HSBB 4LHUB 4F15B 1CE1H 1UCBL 4NP4L 3IJSB 4WI3A 1GH7A 5F93C 1BGXH 2XN9A 3QFJE 4AITA 4PB9H 1AO7E 1WA2X 1Z9NA 4Z7OF 2DQUL 4U1KA 5ICXB 3FF8A 1AZUA 5F7LB 3IAOA 1A4JA 4Y4HB 2IH8A 5GRWA 2NNXA 3IKKA 1WAPA 5A6IA 5I2IA 5JR1L 2YKLH 1KTKE 4JFEB 4PTUA 2Y1YA 4Y1TA 4YDJB 1DQJB 3ARSA 1VGKB 3L4VA 3SY6A 1HDMA 1UA7A 3M1CA 4FMFA 1UH3A 1JSYA 1AFVH 4HSCX 4JCLA 1ECYA 4MMXA 3KM1A 4IKIA 3SGJC 4U1MA 2DI8A 2LKMA 1GW6A 2Z35A 3P9MA 4YSPA 3H1IE 5F3HB 1N19A 1FFRA 5DQ9B 1X5JA 3V9EA 4AEEA 1J1PH 5IEKB 1XF2A 3LZPA 4GXVL 3WKMH 1N6QL 3HNTH 2LU7A 4LLVA 1FL5B 4OKVB 4GKZB 1C8PA 1SJXA 2XVLA 3PWPE 1A65A 1QOKA 2CHZA 2YQ2A 3ZGIA 3K91A 4BSWA 4M5SA 5GZOD 1K4CB 4D0BB 5KS9F 3KEDA 4FTDA 3V4UL 4JM0A 3BH9A 3FBKA 3IFLL 4EJ1C 3UG3A 2Z64C 3U30C 4DO4A 5GHWL 3OKMB 3OKLA 2GPZA 4M62L 5D9SA 3M1OA 5IB3A 4NQXB 1YVLA 1IBYA 4EI5C 4D9RE 1NIAA 4DNLA 1QHOA 4LDCA 2BC4A 2BFVH 1SQVE 1U8PB 2F8IA 2AJVL 1INQA 3HFML 2R0WH 3CC2P 3PY9A 1HS6A 1RURH 1P84H 2FT8A 3ZZ1A 2VERA 2OTWA 1DEBA 1RUKL 2Q3IA 1JI1A 3RL2A 2R2HA 1U3YA 3EH2A 1URQD 1FFOA 3CJJA 4MD4A 5CO1A 1IEHA 3WUTA 2F5AH 3QDJD 1KDIA 5SWSE 3WU1A 3PNWA 4GDOA 1JIBA 4WLCA 3WHE0 4ZNEA 4G83A 5B1AB 3MLXL 4HCRL 3VRJB 3S3PA 1N7MH 4DP9X 1RK1A 4EMZA 4JPVH 3TNMB 3MLTB 4TVUA 4Z7VB 4RWYL 1JDCA 3QIUA 5CJOH 5CZVL 1HHJA 2EXWD 3UEQA 3RFRA 3L74D 1NIFA 3F01A 5ADOH 2YMTA 1A0QH 3N44F 1S78C 3KS0J 4PJBF 3I6KA 5E8NB 4HCIA 4I0KA 1VF5B 3RJQB 2UZPA 1PEZA 4QTHB 3U1AA 2I5YL 3RK3C 3VI3A 1MCCA 1R3IL 1NH4A 5AW1B 1GIGH 3IRCA 1LP9E 3CN0A 4Y0GA 1GC1L 5JOFB 4DGUA 1YQVH 3VFSA 1RCYA 3JT0A 2D31B 1FVCB 1ZY9A 2XOTA 4R5VA 1WJ3A 4XNMA 5I1AB 1M7XA 2YPLA 4N3TA 5GRZA 3SJVA 4BZ1L 2ADFH 3BEVB 3KWWB 4NQVB 5E6YA 3SKNB 4HX1B 2VKWA 2I5YH 3X1EA 1NTKD 1CFTA 3T0VA 3WTWA 4QAWA 4E9RA 2AI0H 4H5SA 5DJZB 3ULVE 1NDMB 2OL3A 1KZQA 5IZ7A 3U36A 1EERB 3CXHE 3QUZA 2M8RA 3K71A 1KXTB 1PDKB 5IJKC 5DZNA 3TBBA 1HQ4B 1NFDF 4ODWB 4OLVL 4XVJL 3RNQA 2X88A 5I75B 2A4ZA 2GKIA 5JOPE 3FO0L 3NPSC 5KTEL 4JN1H 4FEIA 1UFGA 2J5LC 3SYOA 3BYTA 4YFDB 4F92B 5C07D 2FIRT 2EEBA 1LT9C 1T2QH 5EBMA 4I7ZC 3H1LE 1Z6JT 1PJ9A 4IIZA 4G8EB 2CDGA 3W39A 2H8PA 2X0WA 4YHYB 1JWMB 2X42A 4POUB 5L88H 4KNTA 2QFRA 3T6VA 1E65A 1UWGH 2DQIL 2F58H 2OM5A 2OYIC 3QUMH 3EGDA 1KENH 3BCCE 3FQTA 4OT1L 3ZE0B 5T1DH 1K5WA 2ADIB 1LTJC 3R0MA 4N5UA 2XKUA 4O58H 1G9NL 1A64A 4MRCA 1IBHA 2C9XA 5I82A 3ZKND 4YC2B 4C59B 4RWYH 1F11B 1C12B 5GRVK 3RK3E 1S3JA 3LY6A 5CLWA 3WAJA 3HMXA 2A6DB 3HG1E 4TQHA 1OXZA 1KB5A 2OX5B 5LLIC 4CU8A 2Q8AL 5EU6A 3QUYA 2VN6A 1MWAH 2EDQA 1SYSB 2Y25A 3MRRA 2IBBA 3ZMEA 5L0QC 1E79H 1SQVK 2FB4H 3R4RA 1DBJH 3MLZL 3L2MA 3KXDA 4NO2A 2J71A 3W38A 4ZW6A 2FJHB 3BO8A 2XIIA 5INDA 3DJRA 4XP5H 4TL4A 4ZMXA 1CK0H 1X4XA 4LGPB 4IIQA 4R0LC 2LVCA 2N7BA 3S36X 3LZFL 1A9BB 4PLKC 2NY0C 2QT6A 1YMHB 1S1CX 1JP5A 2CUIA 4DK6A 1HQRA 3VD5A 4GUPA 2E8ZA 1P1ZB 3K5SA 1H3WM 3JUZA 4JFFE 4Y4HD 2XA3A 3QNZB 2P5EE 3CE1A 3WNJA 3CFJA 3BW9B 4OY9A 1N3NA 3FH7A 1HAUA 4BRJA 2H0FA 3N0PB 3DK0A 1P84D 1FH2A 5I0VA 1X9VA 1GPOL 1IT9H 4X80H 3LPWA 3VQMA 3E1ZA 4F37F 4G1MB 2HFEB 4WF7A 1P5UC 3AWGA 4LPWA 5CEZD 5I76A 5BW7A 3DVNB 2IGFL 2Y7LA 5JPNC 2CO2A 2IPKA 2J4WL 1VPOL 4LOUD 3P7KA 4WHCA 4Z3TA 3GG2A 3FTVA 3K72A 4QRTB 3WJMA 1G7LA 3X12A 1PAMA 4X6CB 1UCTA 1W5CE 2VDNB 4OLXH 5IR1B 1CE1L 1UCBH 4NP4H 4J3SA 2K7QA 4F8NA 43C9A 2J21A 2B0SL 4PGEB 1RZIB 1W8NA 1MV8A 4WNJA 1J87A 4AYBA 3Q6GL 3N50A 2AXGB 4O02A 2J5WA 4Y9CA 1FZFA 2O6FA 4OD2A 1KYFA 1MHHA 1D5BB 3KLAA 5I28A 3KJ6L 2VLRB 2PW1B 3CVBA 3RWFA 4YL4A 2DL2A 3LN9A 2DLFH 1URQB 2P5PA 2YAQA 2OYHC 4HCFA 4KKNA 5A2CA 5A7EA 5BV7H 3T97B 1G7JB 3S5YA 4QRPA 2XN9E 5JPMB 5KAFH 4X0KB 4LC1A 1I9JH 2QVKA 3ZBMA 5AOJA 4ZNEE 1CICA 2ERJB 3LX9A 1ACZA 1YEEH 3BIKA 1WIUA 1IM3D 3CMAP 5DMKA 1TZHB 3N40F 3WFDH 4AVIA 4GXVH 1N6QH 2FR4A 3BD4A 2WLIA 2EDTA 3V55A 2AMUA 2V7NB 4BH8A 1NTKG 2OR8A 5FCSH 2IQAB 2XKNB 3JSVC 2YPVA 3O0LA 2Q87A 1T89A 1E6JL 1DANT 1KV7A 2JQMA 3ZO0A 2JQAA 2OYIB 3SPIA 4OIAA 2IADB 4HHGA 2ZD0A 3VXNB 2EO9A 3JCUE 1XSKA 2I9LB 2VYRE 4UOQA 2W9DL 1RULL 4D9LH 5KW9L 2XIBA 5E1QA 4MA3B 2W0KA 3ILPB 3PWPA 4ELDA 4JFDB 4BFOA 5D71H 2WTYA 1AI1L 1LWRA 5IJBC 3GDBA 4I89A 1QSEB 1F86A 1FO0A 2A7BA 1MY7A 2FYNB 1A22B 4N3YB 1BGXL 2I8DA 5ITBH 2EDRA 2CO1A 4HJ0D 1QVOA 4UT9H 2XQBL 3MGTB 2ZG1A 3WYRA 3KPOA 4N26A 4NZ8A 1A1MB 5CFHA 3IDJA 4HP5A 5C0JA 1NAKH 4M7KH 5A7BA 3ECBB 5JR1H 2QL1A 5GGTL 3DMMC 2HFGH 1KIRB 2XU9A 4KTGA 3MXVL 4S1SH 1EZSA 1U7JA 3FT4A 4M9PA 5GS1C 2X9ZA 3MRQA 5FYJE 3OL2A 2DWXA 3RWJA 3VTAA 3M8OH 1LE9A 1MKMA 2Y6TE 1NWPA 1QYGH 3UTQA 1PZQA 1ADQH 5T3XD 5C09E 1ZTXH 2OK0H 3M46A 2VQUA 3SY0A 2XTJD 4MDRA 3PWVB 1FO0H 1AD0B 3GIZL 3ZDWA 4JKMA 2ZYRA 2EDBA 4BUGA 1PZUB 3CN1A 1RZJL 3QDJE 3RKPA 1HX0A 4URTB 1ONQA 4X6EA 1TQTA 1JHTB 2X2IA 1AHWC 1LNUB 1YEFH 5HY9B 4Z7UE 2WINB 4I0PA 3KMDA 1VFAA 1YYLL 1OAUH 5IVZB 4HGWA 3TJEH 5JIPA 3LS5L 4PJEA 4ANXA 1WHOA 3BSZL 5E6IB 1KYOJ 3TO2A 2O4EA 3S5ZA 1WUZA 2PPDA 3FO0H 3QUYC 3AE3C 2K8QA 2VM9A 4FL4C 1KIQB 1JZHA 2V2TA 5DU7A 3MNWB 1FDIA 4P23D 3PP3H 4DAGL 4LKCB 2NTFA 5T1JA 4YEEA 1HL8A 3CK0H 3CSFA 2NY6C 2QGBA 2BCKB 3IWVA 2V5RA 5FKAB 1Y18A 4K94C 3BCCJ 4OFYA 4RIRB 2EICA 2XCMC 1GGUA 5JIIA 1FZCA 3ZQ9A 2NQCA 4NERA 2FGWL 2G5RA 2QQLL 5KSAA 2WP3O 4JG1H 2BPBA 5KVEH 2VXUL 3T8XA 4AGMA 1LWUC 1J0KA 1SYVB 3FQWB 3H25A 5DJCA 3RKDD 3S37L 1URQC 2G9HB 3EO1B 2Z8SA 4YHIB 1V8HA 1WWBX 3INOA 4BKTC 4YSTA 3SDXA 4JO2H 3T09A 2GITA 4LCWB 3CLEH 2YSSB 1K4DA 1IEBB 1XFPA 3NMDA 1B2YA 4HKZH 1OVZA 4NQUA 5KSBA 1C9SA 5I8CA 3P3SA 2CMRL 2F9BT 3B2VH 3QQ3B 4HJ0C 1CLZH 4R4FH 2PUQT 3ZIMA 3FHEA 3H1LD 2GJPA 3ZKMC 1MNUH 3CWGA 4YBQC 2QGEA 3I6LD 4NNYA 1HGZA 2ITDB 4WEBH 2QPEB 1ORQB 3ET9F 1MFTA 4QXTB 3AROA 3UP6A 1J1EB 4O2EB 3UDWC 4WW2F 5DC0A 4K73A 2EE0A 1CYXA 1OGTA 3UAEA 1EDIA 1DDHA 3MBEB 1YJDH 3FQ2A 3KPMB 4LP5A 5B39G 4PJDF 1OAYH 1AKJA 3CQFA 1RUKH 3B9EA 3CFEB 1U2YA 4PG9B 3WNKA 4PAZA 2JF1A 4RDQG 4L8DA 5IESL 5KS9A 2C1OB 4UWQB 5FYKD 1HXYA 3WS3A 5ADPL 2F7IA 4JRXE 2CD0A 5T3ZE 3CIAA 5IB2B 1E8XA 3U82B 5KSUB 3VRIB 1OCRB 5KYXB 4G11A 3BH8A 2BEQD 2NZ9C 2P24B 4HMCA 4Z3GA 1ZOXA 3O4LD 4F58L 1L0LK 4IGBA 3RWIB 5SX4H 3QNXA 1KQGB 4F57L 2ZT9B 1AVAA 5CMAB 5DD0H 2R29A 1WLHA 1I8LC 4DKDC 3VXUD 2PCPA 4N6JA 4OGYH 1NCUA 2HVKA 3V4QA 4NCC2 4R2GC 3LEVH 1FAIL 1CFQA 2YR3A 2BVUA 2ZTBA 4FLSA 2R3SA 3EFDH 1CFMA 4PV1D 1EFQA 4YSCA 1PG7L 2R56L 1D7DA 1VDGA 4WVZA 2CXKA 3AQZA 2WSFJ 2YBRB 1KQFB 4Y4FA 1RQ5A 3BAXA 4HKXA 4PQXA 5JPMC 2KL6A 2DPKA 3Q8BA 1AHMA 5CP7B 3ESOA 2XBTA 4V11A 3CPLA 3DLQR 5CGMA 4EI6B 4YHLL 4ZK8A 3CLEL 2B59A 3UZEA 2O3JA 4H20L 4F7TB 3HC3H 5DLMH 1ILUA 2GVYA 4JYCA 2YD4A 1MHCB 5EIIB 4DGIL 3VTTA 3PJSA 3PIQA 3QR0A 5DK0B 4BH7A 3MBWB 3TO4D 3QH3B 1JZ7A 4XWOC 1BMGA 1LO4L 2I1KA 4MXVF 2P8LA 4M6OH 3IKCA 5ID1A 5C1MB 4K2UH 3MUDC 1GOHA 4GBXC 4YFLI 5BZDB 2A9AA 4JN1L 1VQPP 3QDME 3LN5B 2XZQL 3P0VH 3WJJC 4R5XA 3V0AC 4KJQC 2ICEC 5EN3A 1T3JA 3VUAA 3AS0A 4P23A 4KTEH 4FQXA 2HTLD 4X6DF 4OM0L 2VR5A 1DQIA 4Z76B 2CO7B 4JK0D 3MRGB 1A4CA 4UYQA 1RSFA 4MXWL 4RMTA 1YPZF 2WP3T 4U4IA 4BQCA 3JWDH 2Z5HA 1MQKL 4GQQA 4UILL 5DTFA 4WTWA 4AQ8A 2FEEI 1PZBA 3MC0A 3FNKA 1WICA 4ZODA 4AQEB 4DN3L 1J2JB 2FO8A 3HE5A 1T1XA 2ORBL 1WCBA 4NPYB 2Y9ZA 2X4NA 3UAJC 1OCCB 1N5AA 5M1BA 3GBNL 1NCHA 3K3QA 3O2DA 4OBSA 4X6FB 3NA9H 1OAQH 3GXPA 3BVNA 1AR1C 1CR9L 3IU3A 3MO1B 4P46D 3F04A 5FUZL 2O5ZH 5L8KB 1KBKA 1YNTB 5F9WC 3ZTJH 4FNLL 4EDXB 4FJYA 5IB5A 3O6KL 4JDVB 4H88L 4TVPH 2BASA 1MFMA 4NRYA 5AL0A 3QEQB 1ZJBA 3QXUA 4G80A 2PTTB 5D7JA 1OCOB 3JZYA 2JTDA 3ECUA 3UP1A 3QHFL 1S5HA 4ZT1A 1XSOA 2B1AL 3T3ME 2HLAA 3L71D 5GS2H 4KQ4H 1NL0H 1O6SB 1NGWB 3PWJA 1LEIB 2FLMA 4KH2A 4UQIM 3VFPB 3AS2A 1WZAA 4JO1L 1MFDH 5ICZB 1QBML 3RILA 1MPAL 3S35H 4QMAA 2QADD 2XX0A 4H1LB 2CCVA 2YXRB 2BY2A 2DWEA 1P2CB 1NU1J 3CCUP 1QVGO 4MA1B 3DRQA 35C8L 2VB5A 1II4E 1VZIA 4JN2B 2FUQA 2MQ0A 5FYLD 1N2RA 4L73A 2F6AA 3BQUA 1OE3A 3L08A 4LSTL 4X80L 1MCKA 5DMYA 2YIUB 4QRSB 2HP4A 4X42A 4Q52A 3HPJB 1J18A 5E2UL 3R2PA 2OQJA 5EPMB 3SKUD 3GXIA 5ISZD 4Z0BH 5SX4I 1G4RA 3H32B 1GL4B 5HHME 3HE7A 2A6JB 2OTKE 4IOSD 3D50A 2LXBA 5HJ3A 3EGSA 2JCCB 4LP8A 3LKRA 4OJFL 3BUPA 4WFED 3VI3E 3K5BA 1AI1H 1IJ9A 1UB5B 4ZUVA 1N73A 3WHXB 3NTNA 3RWGA 3HD7A 1DVZA 4WFHE 1GSKA 4AIXA 3L3JB 3T0ED 4PCSA 2NY4C 2NY7L 3KDPB 1IAIM 5TDPA 2Y2WA 1OE1A 1JFHA 1K3IA 1NJIQ 3IGFA 4KTYA 2HT4D 3D6YA 3R8BB 1IJNA 4TSCL 1RUPL 3C6LC 5DRWA 5K93A 3AE7C 3MYJA 4BDVA 3QI9A 3KPRB 3PAYA 1J12A 1MRFL 2Q5UA 4DCQB 1EZVI 5I5MA 5DRZA 4FLRA 5F88B 3HHMA 3EYVA 4B50A 2ODHA 3MLSL 1U3HC 1AQDB 1XR9B 2Y5TA 2V4LA 5AOKA 5JYMA 2BNQA 1NPUA 3BZFB 1DN0B 5A2BA 5ILTH 4JNXA 1RLWA 4Y2DB 3LH2H 2N1TE 3K0WA 4OV5A 4TSCH 4JLRA 3WJJA 2OQQA 1N86A 1LD9B 1XGTB 2O5YH 5IB1B 3C60A 3F6JA 2WIIA 3HB3C 3NG5A 1FSKB 2VAAA 4LCVA 2WJ7A 1HH9A 3L72D 3JCUH 5PCYA 4G6KL 2C4XA 4ATTA 2A0LD 1ZE3C 1VRSA 3KD4A 1A8ZA 5DVNA 4HEPA 5AVYB 2WITA 2MCG1 2BY3A 3DYPA 3S34H 3VFOB 3WIAA 4ZFQA 2I60L 3IGAB 3QORC 4JY6B 1QZ1A 3VGFA 3G6JE 5C0GB 3BAEH 1EXUB 5ABDE 3QJSB 5GS0C 3ZKNC 4U7KA 5D1ZA 4HCRA 1V3KA 1NMCC 5CCGD 2J57A 2ZKXA 5JQHC 3TF7C 3CZLA 1T3FB 1KSRA 3T8VA 3BPCB 3L73D 3EYFA 4PJAE 5GJSL 3TVMD 3VXOB 1TNNA 4X5PA 1WZLA 5ENWA 5I1JH 1LNQA 2YEQA 2WNWA 3GSOA 4YDKL 4K8RC 3BWUF 5GZOC 3HE6A 3PGFL 3QZLA 5E79E 1SJMA 2BY0A 5CP3A 2CR6A 3PUCA 1Y47A 1WFIA 4NRXB 1QR1A 4ZUWB 2AEFA 1R75A 1FI8C 2C4FT 1GW4A 1NGZB 3DTDA 3Q1SL 5ISZE 4G8GB 3T2QA 2NW2A 3BDYH 5KYYA 3PQYB 4G5ZL 4WWKA 2I07A 4WAFA 5HHOA 3AJ7A 1TPXB 3C6LB 3MV8E 4CSSA 4DUXA 4JO4L 3H4FA 4X98B 3N04A 3PGDA 4RNRA 5E6SB 4IKNA 2IANE 4LAJH 2BINA 1FYTE 2XQYK 4UANA 3QDMA 1F8TL 4KTDL 2H5UA 4MCZA 4ZO8A 5MEPA 3T0AA 4NM8L 1YJ9P 3WFEL 2HJLB 2XYBA 5EN2B 4U1NA 3MUGA 2DTMH 4HFUL 1EQ7A 3ECWA 1U8MB 2CG9X 3CXDH 1IC7H 4G5ZH 4YWGL 4DKEH 2VIRA 3HD7C 1F4AA 4XVTH 5IROC 4XB8A 2VLKA 1A7PH 2ARJB 2JKSA 2Q2LA 2YMYA 1DVQA 2XFGB 1D5MB 2X5PA 1S7SB 3Q5OA 4PBVC 1L6PA 3FN0L 4UAOC 3MV8A 1IBGH 1RP8A 2YIUC 3GSNL 3BRGC 1XD1A 3F5WB 2Y07H 5KJ7D 3BOVA 4V33A 3H1HD 1W72A 4Q8BA 1SFCC 2GUVA 2LLLA 4YGVB 5DLLA 3T4YB 3WAKA 4W9DC 5IW3A 4ZTPH 1TU2A 3M88A 1YYLH 4WUKL 3WFHA 1BOYA 2NX5E 1LK2A 3TWYA 1DBKH 2FJFB 1HT6A 2R1XB 2ENPA 1OMIA 2UVFA 4X7CC 3MLUH 2WXIA 1OALA 2DMBA 1HIMH 2Z0BA 5HHPB 3IN6A 1JMZA 3JV4B 3JBG7 1OO2A 1AZBA 1UYWL 4XNXL 3B9AA 4UIKL 2E75D 5F0PB 4ASWA 4RX4D 4BZYA 1GRWA 1DANU 4R3SB 1KC5H 5KLIB 1A14L 2AW2A 4FTVA 3GIVB 4XN9A 3GI8L 2RTTA 4CKQA 3D70A 5FYJU 4BFFA 4KXCA 5F9OH 4F8OA 4PUBH 4JJ5B 4KX9A 4AEFA 1SUHA 1JE6A 4HLJA 3VDAA 3SOBL 8CGTA 2P43B 3CZFB 4AT6A 5ETUB 1GK4A 1R3KA 3JYBA 1KGYE 3H9YA 4RGOL 1EO7A 5JPNA 2WO2B 3SBPA 3QNFA 2XWTA 2NR6C 2YXVA 4L29A 4PJ7A 2B1HL 3ZQXA 4AV5A 3FOMB 1OSZB 3KZIE 4ZD3H 1QEWA 3NIFF 5IHUH 1KCUH 4KROB 3P11H 2Z6FA 1H3XA 2E9IA 4HV8B 4NPJA 5DS1A 1D6VH 4L3EA 3W5NA 4L18A 3K2IA 4A2GA 5J3HC 2CLVA 1VQKP 4P9HC 3L72J 1J5OL 3PV6A 1LO0L 2ICWJ 2QJKC 2XU6A 3FMGL 4B7LA 4EO5A 4WO4A 1BE3J 5LG1A 4UTAA 4MA1C 4P5TC 3TV8A 3A0HE 2VWEE 3ATBA 1RJZA 3V2NA 4HH8A 3HI6H 2VLLA 3OKEB 4U0QB 4IOFC 3V0GA 4Z7NE 1OAYL 4O51B 4J7RA 4ZS6C 5EORH 1C5CL 3WD5L 4K3JL 1FGNH 4OZ4A 2CK3H 3IJEA 3VXMB 3ARWA 3VSTA 3HBZA 4BFBD 1SN0A 3OKKA 4BXLA 4P3CH 3SQBA 3OGCB 5EUKB 1E27B 3FFCD 3NJXA 5DK2B 3N6YA 1TZAA 3O8XD 1RZGB 3TFKC 5T1LD 1K5NA 5AKVA 4OGQC 5EBLB 5B5EH 1BVOA 5I1DB 5A16A 2W8ZA 3RTQA 2H26B 3QULA 2G5BB 5I17B 1KXVA 4MQXD 4AQAA 5IVOA 4PVBA 1GGBH 1KBGH 2IWFA 1A6AA 2UXTA 4JGMA 5EC1A 5E03A 2W81C 4OJFH 5IGXH 1KTLB 2ZJSE 4FQLH 3P4OA 5FOJA 4AUYA 1P4IL 4GPVA 4RCAA 4B9YA 5CEZH 4QXVA 2NT1A 3TEXA 4N9GB 5A2KH 3I3EA 3TXAA 3O81A 5FUCE 3I6LE 5C9KA 3WSQH 2FO4B 3GSXB 4KJYB 4PJ7F 1ULVA 2C3GA 3MACL 5I6NA 4P2RA 3OAUH 2PWFA 1BCCD 1NCWL 4NN7C 4XC1L 3TYFA 3N0AA 4WJG3 5BRQA 1W6LA 1HN1A 4OWFA 2AKRB 3LYRA 3AREB 3QDJA 4NO0B 4P4KA 2EDWA 1EQWA 3NDYE 2FX7L 5FO2A 5B3JE 3GSVB 4FOMA 2QV4A 4O4YH 3SKOB 2DQEL 4GSRA 4PRID 4WI0A 2MQ3A 5AW8B 3H7LA 4TULH 2B1AH 2FH6A 1YNLL 2MFNA 2JLLA 4APXA 3UTSA 2PETA 2ALAA 2J8UE 1WD9A 1EFXB 1FYTB 4P9MH 1QW9A 3RVWC 4OGXH 3UG5A 5DJ0A 5KBPA 2N01B 1HHHA 1HH0A 2XKSA 4K5MA 4PJXF 3V2QA 1XMEB 5C2BH 3S4SA 4X5QA 4ZQKA 4O9HL 1VQ7P 1UIXA 4AQOA 5I75C 2YEZA 3GJEB 5C6TH 4NB7A 4A7PA 1L9PA 3HCVB 3VXPB 3BCCG 2XBZA 5ACZA 4OJEH 2J72A 1W0YT 1ZVSB 4N90D 1M3IA 4DP2X 3A4FA 3EAKA 5G5DA 4P57A 1G1YA 3WJLA 3EH5B 1V3LA 3CVHL 1JGDA 3VTMA 2GTZA 4B9CA 1NCIA 3C87A 3CBRA 3APCA 4FXLA 3US0A 1U41A 2LHAA 2GTQA 2J56A 4G7SB 4ZBJA 1I7ZA 4P5SA 4XXCC 4PRPB 3CVIH 3V6ZA 4HUWA 2GSIB 1RZFH 5EU4B 2APBA 3P73A 1QX8A 4MAYA 2Y7QB 1LGHB 1MXDA 1F3DH 5KAFE 1G9EA 3RJDA 2O72A 1YN7A 2YPVH 2GCYA 3W11C 2A83B 4P59H 3SCMC 3NSCA 1NGMB 5IJDC 1Q9KB 2APSA 1BVKA 2V0AA 1YJWP 5FAAA 2AEPH 4S1RL 5IEHA 3U4BL 3MLYL 1JZEA 4NYLA 3RWDB 3GSRB 3MRIB 1ZHBB 1WFTA 3KNBA 4XODA 1M4KA 3L71G 3FUIA 1GC1H 2N9YB 1X9LA 5ID0B 3EZ8A 1JV2B 3K8KA 4YHML 2B0SH 1HXKA 1EJOL 1QI5A 1K6QL 1OK0A 4FQ1H 2DIEA 1AQ8A 3M0DC 1OHZA 1TTCA 1HEJC 1X0TA 3VG0H 2APWA 5I18H 4L3CB 3EYSL 1BFTA 1KT2B 4JM4H 3IMWA 2KNCB 3UROR 1DBJL 4LDOB 4AVKA 2F54B 4QTFA 1HWHB 1TZ8A 3ULVL 2ZCHH 1I31A 2JKTM 1PPJD 3HUJB 2IFMA 4LNRB 3VVWA 3WOVA 3UMNA 1T03L 5CEYA 4JW3A 3D69A 4ZZKA 4MJIB 3CZSA 4P4RA 1BECA 2O6EA 1EGJL 4HUMB 4XVJH 2WM0A 3VM7A 3ZTEA 2IXQA 3HAEG 4TNEA 4K7FB 1IAII 3ALWA 2BVQB 4OF8A 4OZGE 3U6RA 1KB9H 5AAMC 4C56A 3DPDA 5FO7A 3NH7H 3APMA 5L4MA 4L3EE 1TTBA 5IOPA 1D6EB 5K5YA 3C75A 4J3BA 4X9BA 2DWTA 1PKQE 2F7OA 1GPOH 1Z5LA 5A1AA 3CU7A 1BXAA 3FFDB 5E2TH 2H0PA 2OYMA 2Y0EA 4KHXA 5DJ6A 4B6ZA 1JY3O 1PS3A 1VFOA 4HH2A 2RCSH 2R29H 3GRGA 5EULV 2NSXA 3MOBH 1PL3A 1COBA 3CXFA 3EYOB 5IMOA 2XETA 3H1HE 3TA4D 3ABGA 3V7MA 1HINH 1JGVL 3V7AG 4ZAKD 2C3WA 1JPST 2FBJH 3GINA 4V1DD 4XNQB 4C4KO 1KTBA 1PY9A 4NQEA 3T3MB 2ZF9A 3PL6A 1RE4C 3F12A 1TZGL 4PJCE 2EH7H 3OXRB 4OI9A 5TDOA 4NFCA 1MCIA 1R33A 1L4IA 2B1HH 3DGCR 3E1RA 2JJTC 2PLTA 3DX8B 4RFEA 1USQA 4UZSA 3QEQE 4XAWH 2X10A 1UA6L 2RQ8A 1L9TA 2WAQA 5T1LB 3FQUA 3MRNA 4AC2A 2OJZL 1DVSA 4M7KL 5EZPA 2FBJL 4HULB 3M0AA 3L3OA 4XP4L 4AENB 5I1HH 1OAKL 1DR9A 4IBTA 4P04A 5E6ZA 5BV7L 5FM5M 2EH7L 5ANMA 4Z3HA 3QFJB 4BK5C 4CGUB 1NCGA 4IU2B 4Z7VE 4DTGH 1AZCA 3CQQA 1WMKA 1MCWW 4KH9A 5DFVD 4U2YA 3FTUA 4KPHL 5KJ7E 4Y19B 5KVEE 4LF3A 4U6VL 2FQGA 2W91A 5EUOF 2GUOA 4AYSA 4UT6A 1YQ4C 1BQRA 1JTPA 4TVPD 3TBSB 1E42A 2L7JA 1RF1A 3P9WB 2WXPA 3LNIA 3PWPD 1D7CA 3B3IA 1KJ2A 3GXNA 1MCWM 1DVTA 4LCWD 4A63A 1OL0A 3S8GB 1P6WA 2F68X 1ZHNA 1NCCL 3CWBD 2PYEB 3O45A 1BD2A 2W88A 5I6XB 1A4BA 2A74B 1YTZI 3T4AA 3CZNA 2EDYA 5FV1L 1OZTG 4QAMB 1ZXQA 1HZHH 2BOCA 2VT0A 1EAQA 2CU9A 5FA3A 1LT1A 2CUAA 3VFRB 3IDGA 4KXZH 1MW2A 4D7PA 1U42A 3QT2A 5G4NA 4NUMA 3OXSA 2CJUH 4GW1A 4X83A 1MFZA 2B9AA 5FGRA 3CXDL 4KK8C 4PV9B 4X8CA 3I3DA 4TLUA 2BSRB 5M94B 4ETYA 3VW3L 1OOWA 1G84A 4L9DA 1JGVH 3VWJB 1USZA 5E5UB 3RGBA 4UT6H 4LCUB 3FT3B 1QW8A 4U1SA 4P06A 4UT9A 4F7PA 3D3VD 5EFWB 2Q5BA 1HI6A 4MMYB 4YHPB 4PJFB 5MHSD 4KK9C 1M2VA 7PAZA 3KL0A 2J7LA 3VW3H 4Y2OB 4LGSB 3IFLH 3APFA 4ZTPL 4B3VA 2MTPA 4QCIA 3BE1H 4OLYL 4W9EC 2OJZH 3RY6C 4ODXB 4GKNB 4GRLA 4QR7A 3FAWA 3P8CD 4DQAA 3B2DC 4UI2A 3MLUL 2BP3A 3UXFA 1E9QB 5I6PA 4I3RL 1RUAH 3WFBL 2P7TA 1C08B 4HDIA 4MLSA 1SJHB 3D4GA 2YA1A 3TZVA 3V5DB 1SNRA 4IFMA 2APTA 3K6DA 1EAJA 2LAAA 3L5WB 4N1CA 3UGEA 4Z7WF 3M06A 4IRJB 5C0CD 1BDCA 3K2UL 1I9RH 1W72L 4LAQH 4J8RB 3F00A 5CKAA 1JF5A 2W9DH 4D9LL 2KIKA 3T3PF 2DMGA 4OLUL 4OGQD 1Q0XL 2X6AA 3ESPA 1MFEH 1FZEA 4XP1L 4RWHA 4Y1AD 4X7SH 1RE4A 1XH3B 4ACTA 5APXA 3GF3A 3J8F7 1KILA 3FOLB 5LAXB 3AB0C 3CX2A 4YEFA 2F1BA 4XHQA 5GHWH 2HJFA 3CUPA 5I30H 3WY2A 1UC6A 2ZSWA 2GHZA 2FWOB 3RWHA 3BP5A 3CH8A 2G3XA 2V9UA 2VLKE 1XF3B 2K6WA 4ODSL 1D7FA 5SV3A 2EKJA 3CH1B 3NIFE 4H26A 1WRGA 3DXAA 3B9KA 1V3JA 1H8SA 3H2WA 1KJ3L 1I7TA 2X12A 4OUUA 1JCVA 4NUPA 1E90A 4NKOB 1S5LH 1DZ0A 1KCSH 1S9YA 3OKNA 2XY2A 1M1XA 3EJYD 3PG2A 5HPOA 1E7VA 4TKWA 4UQEA 5DVOA 2ZXEB 4XMLL 2R56H 3C5JB 1A3ZA 1YMMB 4NPEA 5FA4B 4OUOA 1KYOI 1UOWA 4R4FL 1KNOA 1L7IH 1ACXA 3POHA 5EZIL 3DOSB 1KJ3H 2P5EA 4Y1AE 5H2BA 5SX5H 5T1DL 3VTPC 5HD8C 1ZA3A 3ELQA 5E9DB 3GK8H 3UADA 2P58A 3RDTD 1MFBL 4URKA 3T08A 1W0VB 2Z91B 4WNQA 3EO0A 1XGRB 1A1NA 5JIKA 1CG9A 1DQQA 1HYRC 4JR9L 1FC2C 4MJ6A 2VXQL 3BKJL 1X5GA 1T2QL 2AQRA 2W07B 2DQ6A 3HE7D 3L4ZA 3PPEA 3VXSD 4YSQA 4XCCH 5C8JB 4GRWF 4DSYA 3FK3A 1A6UH 3HRPA 3CMOL 1XB8A 5L2KE 2NMSA 5E8EB 8FABB 5K9OB 3OB8A 4YLQT 2WT7B 4PGBB 5J13C 3AG2B 3QJHB 5JUEL 3UBFA 5LG6A 4BBWA 3NCFB 3SE9L 1M7UA 1M6OA 1DTUA 1E30A 1M9SA 1NCAH 4DQOH 5K9QI 3FQNA 4LAQL 3ZE1E 4ZAKA 5L2JB 2OSLB 3LV3A 4PP2A 3H1JE 4ERSL 1RURL 4U3FE 1QRNB 2Z0UA 3RNKA 1HSAB 1KGWA 1EIBA 4QHUB 4UM9B 1ORSB 2Y69B 4FADA 3BP6A 1A9EB 4JQIA 5LGYA 5C97A 1L2PA 2IGTA 3ARGA 3HZVA 5EOCL 3A0BH 4IK6A 1KLUA 3L7EB 3OHXB 1WUNT 3SSUA 1U8KA 4B0MB 3RIFF 3D18B 5H94A 3D09A 5F9JB 4OF0A 1BBJA 1CLCA 1UH4A 3ETBJ 1E28B 5CZRA 5F7MC 2O6CA 4HUUA 1UG9A 2QVIA 4MB4A 3NOIA 4YK4B 5FDWA 3V6OC 3TURA 4D0CA 3VQLA 1B2WH 5CR1A 2N4IA 1U33A 4QTIL 5IV2B 4UU9B 2UX6A 3OMNB 3S3CB 2XG5A 4RMSA 3GKZA 5BRZD 3LNHA 5GISL 3STZB 4HA1A 2OA9A 4JRXA 4BSVA 3P54A 4ODUA 1N18A 3DMMB 3S5LG 3L1OL 3TJPA 3EJSA 4TF4A 3F6IA 4HPYL 2MPAH 1WD8A 4LLUB 3OQ3B 5H8DA 2R23A 2ZWLT 5KVDH 4M43H 1G7IB 1MXGA 4NRZB 3KM2A 1C5BL 1VA9A 5EEUA 5LUMA 3D51A 5GISH 4WVRA 3ZMNA 3KJ6H 2WLYA 4ZG1A 4QRRB 4ZMTA 3SJVE 4ELME 2WXJA 4JPKL 1RJCA 5FW7A 3NP4A 4G72B 3NPZB 4Q97A 1GTNA 3E2HC 1GCFA 2QADC 2CNZA 4UV7H 4M5YL 3W0WA 1DQLH 3Q2LA 1I1CA 1MHEB 4LIQE 4JZOA 5E2TL 3SYPA 2HTKD 3O3EB 3Q5YA 1B0IA 1RK7A 1U8JB 4K8RH 2W5PA 4I0PD 3VMYA 2W65B 4J1UA 1PY4A 2R29L 4RGNC 1Q72H 4FFZL 4HXAL 4GLRI 4MD5B 3Q6GH 4P5RA 4YL9A 3IXAA 5SWQA 3RRQA 3SGDH 5DYOA 3EFDL 1DJYA 4NJAL 1UUNA 2R69L 3MTRA 3G9AB 4FE9A 4GKOA 4JKKA 3TTYA 1WEJL 1BLNB 3EIFA 3T6ZA 1IZNB 3LEYL 2J8UB 3LNDA 2P3YA 3MMEA 2KQNA 3F64A 4H0HB 5GRYA 5DJUB 1VPOH 1RUPH 4L8SB 1YUHB 5CCHA 3D2UA 1FVEA 1TQBB 3EYSH 3MRFB 3QZWG 5DHYB 3TIEA 4ADIA 4GQ9L 5H35A 4NEHB 4OZFA 3US9A 1ZT4A 3LZLA 1GL2C 1B3IA 4G7YH 1MEXH 3GJFK 4O02H 1R1CA 3RGVB 2VGLM 3RDTA 2AEQH 4KKBC 1F13A 4DO5A 5T1KD 1GGIL 5T33H 1NFDB 5TGBB 3DSFL 4ZPTB 3LD8C 1SLWA 3MKGA 1QL1A 1F4WL 4M5ZH 5JYLA 3II6A 1LO4H 4HS8H 4MMXC 4CMMA 4DP5X 5BQ7A 2IYOA 4ATWA 1T5KA 4XOAA 1H6EA 5F7AA 4DGYH 3CXHH 2XN0A 3MLZH 3Q5RA 2WWWA 3CDGA 1LO3H 4NS0A 1Q0YH 4G6KH 3TBYA 3WCYA 4PR5A 5EF1A 3DI3B 4B53A 4IBLT 1LP1A 4BA8A 4BZ2L 3FUDA 1MVUA 4TNVF 2FVNA 2H0EA 5I1KH 4N2NA 2FTAA 4PMEA 4XWOD 4YDVB 2F15A 5GS0L 5CCHC 1AAJA 3WMPA 3U0TA 2HLFC 4O5LL 1NAMH 3S96A 1CDYA 1SXNA 2XICA 3VRLF 5JNYB 1UD5A 3Q3DA 4A6YH 2YFOA 1PP9J 1MFUA 2MHAB 5HDBB 4G5AA 4UINL 5CJXC 3EJRA 1UM5H 4BFEA 1IGIL 4N0RA 1SEBB 1CF1A 2ZUVA 4AQ1B 5AWNH 2HA1A 3W0WE 3O3DB 1WFJA 2EYTB 4PJXB 1Q72L 2QSCH 4XBMA 1H9DA 1AQMA 1NBCA 2IFFH 2VABA 1E8ZA 4H88H 3ISRA 1EVUA 2MOGA 4TNVK 4A2MA 1YSOA 3K2KA 1H19A 4JFYB 1KMIZ 2WXQA 2C9UA 3PWNA 1M7DA 4D8OA 5CN2A 3K6FA 5ERWA 4FXKA 4NZTH 4YPJA 5SWSA 3G6EP 3KPSA 3AEAC 3MOAL 3VE0B 3DJSA 5GTIH 3LIZL 1GZLA 4AK1A 3VFMA 4MX7A 3MV9A 2KZIA 4D6TJ 5IWLC 1KYUA 1XEDA 2W27A 1OLLA 2E8YA 3QG6A 4PGDA 4M48L 1KXHA 1WZ1L 1ZHKB 2FLBT 4M56A 5JQ6H 3QUHA 5H4ZA 1JF1A 3R18A 1E3XA 4G59C 4W4OA 1KCRL 1I8IB 4ZW3A 3U9WA 3IGKA 1OSPL 1SVFA 5DHDA 5DJAA 5TPWH 2QHRL 1AO7A 3RA7H 3DSNB 2HJKB 3D33A 5DC9B 2XY1A 3QISA 4JPWL 4CC1A 4OW6A 1X6NA 3C60D 3PXJA 4ES9A 5EZLA 1HL9A 1KTDA 1KIPA 4IMLB 3G04B 4KNUA 4PJCF 4XXDB 4B5ZA 4C47A 2WV3A 3ZHFA 4GAGH 5MENE 2XA8H 2KUBA 4KROD 5DZLA 5IFJA 4QRQB 1IL1B 3A4EA 5K39B 3TK1A 3VFNB 4XP1H 4J4PD 5DZVA 1RZJH 1YA5A 1HIML 3SGKC 4YBQD 4ELMB 2KZ1B 4MNGB 4TPRH 4ZFOA 3EFFA 5F6HI 3C09B 3ARZA 1QSFE 3QI9C 1SQQD 1U4EA 5HJGA 4PJ9C 1WBZB 3CZEA 1KLFA 3V5KA 1WCQA 1MG2C 3RL0D 1IBDA 5GSRB 1B0RB 2ED8A 2YK1H 1YN6A 4PHZA 2KERA 5GSVA 4IBYA 2ZOOA 3OZLA 1J0HA 1QZNA 1MRFH 3L95B 5CJOL 1FZOB 3CV5A 5CZVH 12E8L 1A6ZB 2PAJA 4XO9A 3KYOA 1GS7A 3RP1A 2L4OA 2E76B 1W2KT 1GMJA 3CWBJ 5I19H 3JZ7A 3QS3A 3EYQD 2A77H 3CX5K 3HNSH 1PP9G 3GM0A 2Q3XA 4PJGB 2BOLA 4FQ2H 2DTML 5JHLA 1UB6B 4XP9L 4HG4J 1EA9C 4ADJA 4F7CA 5C6PB 5IVXB 4PRDA 3OLGA 4IJ3B 2G2RA 4XMKL 4FNSA 3SGKA 3RGUA 1F2XK 4AG4L 1E4WL 5DD3L 1A02J 2GJ6B 1SBBA 3EOAB 1MFBH 1H8OA 4O00A 4DHLA 1Y8AA 2OTLP 4KI5E 3VGBA 1DQDH 3NZ8A 3NBNA 2VR6A 1D3CA 1TCRB 3HAEA 3L8QA 3U1QA 1TCMA 2WUBL 4XZUB 3CN2A 3WO4B 4DOHE 1UADC 5DHXB 4CU7A 4HIEB 4MJ2A 1ADQA 3EYUL 1JZ6A 4JFDD 2YD8A 3ZW3A 2CLZA 1C5BH 2EEXA 1JTTA 2IDUA 1TZIB 5KSAC 1WITA 4PYHA 1IKOP 5LBGA 1AGBB 4GJTB 4H8VA 1YEWA 2GIXA 3BGAA 3ZDMA 2VSMB 3LVTA 4GYBA 3WE6B 1CT8B 4UIKH 5IREA 4X7TA 5IVXA 2BP0A 3TF4A 2PP8A 1EXIA 3IAQA 3RZWA 4P3CL 1SQ2N 5FC9A 8PAZA 2OYKA 1XGPB 2KPNA 4XWGL 2IH9A 3V9CA 2XPZA 3WMM0 4JMNA 5BVJA 4Z8FH 4N8VA 1Y9BA 4PD4I 3K6OA 5D8JL 1LE5A 4JANB 3SGEI 3BZ4A 3H0TA 5IBLC 2KP8A 2YKKA 1G7PA 4X5XA 3L81A 1JZ8A 1AGEB 1NU1K 3CFMA 4Q9QL 3WFEH 1CXLA 1M1SA 4Q6IA 4HUVB 5CMZA 3RWCA 1YN6B 1ILSA 2PR4L 1B0RA 1DBBL 2AP2A 5GSRA 2HRHA 3O2VH 4IEFB 4BELD 3K4ZA 4JY4B 5I15L 2QQLH 3ZDZF 4L1SA 3D87B 3LEYH 1FBIH 1IK9A 2OCJA 2RMNA 3FUNA 4FQCH 2FHCA 2MQCA 2JJLA 2VN7A 1MWAL 4GEJA 1JNLL 3T2OA 3DX7B 5EWIH 3FB7B 1EUTA 3Q6FA 4GQ9H 1CTOA 3PYCA 4G3YH 2A2QT 1SFHA 5IKCB 3KBEA 2JO1A 4LBEA 2WLLA 1EEYA 2M8XA 4GY4A 4TULL 3G5YA 4M6NH 5HI4D 3W56A 3IE9A 3K6SB 4KTEL 1SOSA 3CX5H 3EW3B 3JTBA 5BZXA 2HKHL 2PXYB 4LLQA 1GJIA 1A6UL 1QLRB 3DSNA 3CMOH 1EC5A 3MFGB 5IB1A 4JM2D 5D4QA 1SQVG 4QXUH 5EORL 3TIDA 2QZQA 3JWOC 4H8UA 1I8IA 2JJWA 1MCHA 3ELAT 3CCRP 3A0HH 3SO3C 3QRGL 1A1OA 4DKTA 1J5CA 3GMRA 2ZXGA 1QLFB 1HL5A 1TOXA 1P7BA 4N87A 4PGDB 4JKLA 1CPUA 3LPFA 4IGBD 4FQJL 1N0XH 1V27A 2HODA 4JE0A 5DURB 5C0BD 4P5TA 3MJ8B 2XT1B 4Q9CA 3D0VB 5TE7H 4A04A 1K9MQ 4FXKB 4N90E 1AS6A 5DJXB 3WIFB 1QWHA 1XF1A 3PHSA 4GFTB 4G1EA 2R1YA 2GHWB 2B14A 4FC3E 3D52A 2XVKA 3U25A 5IGXL 5F1SA 1DFBH 1YEKL 2ZG2A 5SX5K 1HCFX 1R6VA 3NFNA 1W91A 4KZEH 1ES0A 3REVB 3MYZA 3K6IA 4CN6A 2WQVA 4Z1MH 1FORH 1O7DC 2HRGA 2IGLA 1NTMK 4OCSH 5IFHH 5TE6H 1R3LA 2W6JH 2EYTA 1NU1G 2FL5A 5DA0B 4PD4D 1UKQA 4JFOB 1AS7A 2FBRA 4J3OC 5KN5A 1SEBA 5GGTA 4HZAA 3UTSD 3IDNB 4YTPC 4I88A 1CGSH 1I7UB 4PS7A 5CILH 2WWMC 3B9KD 4MB5A 3HS0A 4AW7A 1HCVA 4F2ME 4P05A 1KXVC 5CUSL 5L2KD 2Y36H 4KJWC 4PJDB 4OZHF 1UT9A 3VI4B 2PO6D 1NLDL 4KKAD 3AITA 2O26U 1PZ2A 4CVXA 2EDLA 4L4VB 2XQYG 3Q5PA 3VM5A 3GW6A 1J88A 2WZ5A 2O61B 2A06D 2ATKA 5CJBA 3HFFA 3AU0A 5E08H 2WO3B 1MH5A 1FV1B 2XX1A 2ZUSA 4PR5B 4FMVA 3CFUA 4KV5E 4YXHL 5CUSH 3CDGB 3TBYB 5DSCB 1EJFA 2W95A 4BFKA 3WTVA 5FFGA 1HC1A 4ABWA 5BUGA 3MBXL 1ZA6A 1UZ8B 5H37G 1R5SA 1WAAF 3LRSA 1YY8A 1NAFA 4TYUA 1BW8A 2AITA 3CVHB 5IUSA 4JZJC 4YZWA 5I74B 2WQXA 1OTTD 3VXUB 4XNYH 1KMGA 2VC2B 5HPMB 4HKBB 4BWUA 2ENJA 3LKOA 3EJJX 4EQ2A 4PRAA 3S9OA 1DSFH 1A02F 1F00I 2EYSB 3T77A 3X3FH 2A6KB 4DIXA 4X6DA 5KANG 4GS7B 5B38B 3S88H 2HYNA 1H3UA 1NBVL 2QE7H 4L3ED 2Q7NA 3NRPA 5F9DC 3TJHC 4G9FA 5JOPD 5FEBA 1EV2E 2AEWA 3GBEA 2OXHA 3TCLA 3D9AH 3OG4B 4LOEA 4M93B 3IFNH 2IBZD 5CCGE 1PCSA 4S1RH 4X7FC 1U95B 5GGRB 2R0ZL 3X3FL 3I9GL 2CJTA 4S2SB 1EEZA 1NMAH 1TG8A 2YMKA 1CR9H 2JELH 2PGDA 1P5UA 3PWLB 4E9XA 4G8FB 2LT9A 2A77L 2BVTA 3DX0A 2BOBB 2P46B 3LVEA 2A5UA 1MJ8L 4PJAA 1IC5L 1NEZA 2WQWA 1BE3E 1OB0A 5F7NC 3VAEA 1SOQA 3L4XA 1RJLB 4N2OA 2CMRH 3B2VL 4P2YA 5E8DH 3UJJL 3MRBA 4GB9A 4I3SL 4LLDB 5TK4A 1TNMA 2EJ1A 3NZUA 4K5OA 3H1HJ 5A43C 4IRZA 3R7RA 2JWDA 1MJJA 4BK5A 3GBDA 3A4AA 2IAMB 3KYNB 5FYKL 1OF0A 5ISZA 1G7IA 5IUCA 2QZ5A 5IQ7H 3FO1B 3HZKA 4XVTL 2F2HA 1N5YH 4GBXB 1Z3RA 2C3VB 1AIFA 3DRTA 1NBYA 1QTSA 1UVQB 3U0WL 5HGBB 2QVAA 4JRXB 1DVFA 1ZT1A 3D39B 1N67A 1IB5A 3RDJA 4P4KC 4PSPA 4R0LB 4NT6A 1U7MA 1J9TA 2XG5B 2DD8L 4P5KB 1CQKA 4L4VE 3WXWH 2NW3B 1S4IA 1XCTA 3UTSE 3WNMA 5IQ9B 2WQYC 4EZJA 5IBUG 2YOCA 4PJIF 3AGVA 4HUKB 2KZBA 4DH2A 2X38A 1KB9E 4XBGA 1E28A 1BDDA 2YGNA 2G5UA 1AR2A 2CPBA 3D6ZA 2FZ3A 1VF5D 2PXYD 1IC7L 3CVDA 4ZTOH 4YWGH 2O30A 3IB4A 1V7MH 4IGBC 1UXSA 3V0FA 3N7NA 3OHXA 4TSAL 1TITA 4XAKE 3HZVB 2C26A 3WXWL 1J1OL 3UH8A 2X0VA 4OTXH 1DVXA 1I4FA 2VMFA 1NEUA 4JAMB 5CHNB 3UG4A 2LLNA 4L75A 4ODBD 2V9RA 4ODTH 2CALA 5FFLA 3V10A 4OVVA 4N86A 3DJTA 3L36A 2X6CA 1I3RA 3WJLC 1DJWA 4M7LL 2GSMB 3GFUA 2OSLA 3LV3B 1X5MA 5C0BB 2D7PA 3EG9A 1S7WA 5LNEA 1MRDL 2YEVB 4TT3H 4H25B 3FUEA 5SWZB 4Y1AB 2H1PL 5I6MA 2OMUA 2ESVA 1VHPA 5TQ0L 3L3DA 3UTOA 1QSFA 5E8EA 4WU7B 3SDXF 1E5YA 3AT0A 3DJ9A 2HWZL 1IBFA 3OAZK 4W4OC 5D7LD 4JO8A 4Y88A 3GXMA 4OLZH 3V5HB 1G1CA 2FYUD 2CO6B 3QPXH 4EI5D 4ZUSB 2NYYD 5AZ2H 4GKSB 5JDSA 2Y7MA 5HTSA 3OJMB 4L4TB 3RIAF 3GHGB 3EO0B 1OP4A 4M29A 4W7ZA 4D6TD 4W9LC 1K8IB 3QORA 5C0AB 2P67A 3FSOA 4GAJL 3DOSA 1TPXC 2BSSB 1S9VA 2LXCB 1U8QB 3SOBH 3TA3B 4C83A 5C0FA 5MENB 2OL3H 5IBLD 1XF5A 2KS0A 3QAZC 3ZDYB 1QUNB 3WL9A 3KCWA 1XGUB 3U2JA 2IQ9L 3COOA 1J48A 1P4LA 3FSVA 1IQDA 4Z95L 2DH3A 4OLUH 1WTGT 4NKOA 4WHTB 1VB9A 5CJXA 2BK8A 3AAZA 1D7MA 2PTUA 2ZUWA 4WTZG 2HG5A 3FQYA 4Y2DD 2WTPA 4TNFA 3UPRB 5KTBA 2AV1B 5JXED 1S3KH 3QDAA 2X2UA 1XF3A 3NESA 4RSYA 4Y16D 1FPTL 3MV9E 3QUYD 4LCCC 1FFPA 2VDMB 2FWOA 4N2KA 4XAWL 1N73C 4GT0A 4TSAH 4K55A 4YDMA 3IFOA 1ZS2A 5F9OL 1ZLSH 1NTKJ 1J0IA 1UT1A 1UKTA 5I1HL 2R7EA 4MB1A 1RAMA 3A22A 3TNUB 4OJDH 2OMTB 5B3JF 4AW4A 5MEQA 3DV6B 3MZGB 2ZNXA 4V2BA 3WL9B 3LKPB 4Z7UA 3TVMB 1JEKA 1OT4A 1QUNA 4FQIH 5JTWA 1G5AA 3LPGA 1XF5B 2F74B 5D6CA 4JB9H 4JUSA 3DX9A 4LE8A 4Z0XA 1SGKA 1L4AC 2K9JA 3Q13A 1QRND 4FABL 3OZ9H 4QHNB 5J12B 3L5WA 3HAEH 3CLQA 1U92B 5F2FA 3OF6A 5HDBF 2WD0A 3VFWA 2KDGA 1MHPH 1QSEE 3AACA 4PRBA 3HZYB 3JUYA 3L3KB 3DURB 1C08A 3OLDA 4HDIB 4X4YA 4MGXA 4W9FC 1QQDA 2DIJA 2OR9L 1MLCB 2HZHA 3EYQC 4GKSA 1VKXB 1WT5C 3CLWA 4AKPA 4HUXB 5TE4L 4KHXH 2JK5B 1DLFL 4XCYA 4KK6D 1PZDA 1W72H 4HYTB 1UT2A 4CMHB 2E4FA 2HRLA 4PWFA 2UXGA 3IJYB 3MTXA 3BN9D 4Y2NA 3RZCA 4MD0B 4JJOA 2P80D 1UIIA 2ESVB 1R3HB 2OYLA 5BRZE 1A7RL 3HI5H 2WANA 3FC8A 4AIEA 4H25A 5HYQA 5IJVB 3H1HG 4JFXA 3O6FA 3U59A 1JVLA 2NT0A 3ARUA 4L8SC 3O6ML 4ZOCA 2DYSB 2BJMH 2YD3A 3NJVA 4BV1A 3KWVA 1BM3L 3S97C 3PE9A 3H3KA 4O4YL 3D3VE 4U1HA 2A06G 4G7VH 1FORL 4OCMC 3P0YL 4H44B 5F0MB 3U6XS 4Y7OC 5CHNA 4FHBD 4YHMH 2ZUUA 4M9OA 4PWEA 5J89A 2ZWKA 2BOCB 1R3JB 2DLHA 5JLZB 5I18L 5JOEA 2PCFA 2XNAB 2K0RA 4YPCA 4KJPC 2PYEA 4Q14A 3DTUB 2EUZA 1T3UA 2BNRE 4J2QA 4XNUH 4KHTL 3Q01A 1KJ2B 3KHUA 1I7RB 1R5VA 2Q86A 3QUZD 3EH1A 2Q8AH 1L6ZA 2YC1B 3TBSA 4R0LA 4AOFA 1LHZA 1ZCRA 4FNTA 4PVLA 3TCTA 3VD7A 4HK0B 3KW7A 4I18B 5JZ7D 3QDGB 1UVQA 4LF3B 4NM4H 3EDDA 1GHFL 1TO4A 2DLIA 1GKOA 4B9ZA 4BJLA 1RJYA 2NNAB 3PLYA 4L0PB 3KYNA 1MZ9A 5DDHA 4OLVH 4K3JH 1KACB 3L71E 1RK0A 1F58L 4ZS7H 4FYSA 1SQPG 4UTBA 4ZOEA 2R8SH 1ZRTD 2NSQA 1T1WA 1BP3B 3FHAA 4ZXBB 3A6BH 2GAZA 3NEEA 2BW5A 2BDNH 1NMBL 4DPAX 4ODHH 2ZVOB 1CI6B 2BVPB 2ZP8A 3MROA 4N0FA 3VGAB 2OYPA 1NZRA 3DX8A 3SZ6A 2H43A 1BYNA 4KUCF 3KL3A 3NYKA 4J3OD 4RAVA 5D2NA 2D9CA 2CR3A 1JK9B 1NAMB 2HN7B 5EMYA 1WA1X 4XNQA 2EVIA 3O4LA 1WQVT 5L2KA 3QQ9D 1NC4D 4MJ4A 5ESQB 3CCQP 3F84A 3KL5A 3KXFE 1IFGA 3W1ZA 2IOIA 4I2LC 4J3XA 4OLXL 2VMDA 4Y4KC 4OCRH 4B9PA 2ZCLH 1NCWH 4XC1H 4AIZA 2N1TC 3VSQA 2CLRB 5INCB 3W57A 2WB1A 3NSJA 5DHVA 1OT1A 1FG2A 1IGMH 1T21A 3TP4A 3VXMD 3VU2A 2CQVA 3FTYA 3TH4T 2GBUA 3JWNH 4PRAB 3QUZC 1Z56A 1KGIA 2FX8H 4KDTC 4TM9A 2DLFL 1CFBA 3QUXB 5DS2A 4ZSOA 4Z3EA 2O6PA 5IP4A 5GZNA 2AEMA 2ED9A 1ZR4A 2Q3ZA 3F5HA 3NJNA 5E6ID 5LDSA 2AQ2A 4A2DA 1LJ2A 3FZUC 2MCPH 3LRSB 3EFFK 4GP8B 1JNMA 5J6GA 2D7OA 3PHOB 4XNYL 4EIGB 3IVKA 2VR7A 3T0BA 1HNYA 5HHOE 3HUJA 3U9UA 1SBSL 5DRNB 1DJIA 2E6QA 4AYFB 3K7UA 1FV1A 5BOZG 1AS8A 1NGYA 3MOQA 3WXVL 4ICWA 3U7WL 4WWOA 2N1TA 4WGWB 1IT9L 3ARGC 5C71A 4BFIA 1F58H 3F83A 5CGYD 1S7RA 1TJHH 1USEA 3UTTB 4DO6A 2AJSH 4P2OA 2ZJSH 2NSMA 2X4QB 3FQ1A 4FYQA 4RGND 4E9LA 2JKLA 3LRKA 3PDGA 3L7FB 5TH2B 5HYFA 1FIGL 3LMJL 3LCYA 5L4JA 5IK3B 1K9TA 3QIUC 1BIIA 5DMGD 4YXLH 3ZKSD 1IAKA 1I9IL 2CCWA 1ZLVK 1E4XI 2ZWYA 3QA3B 2WCSA 4IS6B 4LLWA 2FJUB 5TFSH 1Q9KA 1R3LB 4M4RA 4M7JL 4GI8A 3MGNA 1E8YA 2JB5H 1Q86Q 1DJHA 2N1TB 1JXGA 4QRPD 2QMKA 1MCOH 5AVVB 1UWEL 3CFKB 3NJJA 5DR5H 5HHVH 1DUYA 1E8WA 4FTVE 4GP5B 2IYPA 4MDIA 5CGTA 2DQDL 3ARYA 1NGYB 4YDLB