2ZXEB

Crystal structure of the sodium - potassium pump in the e2.2k+.pi state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the sodium - potassium pump at 2.4 A resolution
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 51
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zxeB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 2zxeB02
3NXSA 2XU6A 4AQRD 1OWAA 1T2KC 1S9KE 2JJLA 1CSBA 2WT7A 2R5DA 3VTPC 3MGNA 1OXZA 3HE5A 3TNUB 1MV8A 1SLQA 5APQA 1SP4A 2R32A 5AVYB 2XZRA 2Z5IA 3M0DA 4DZOA 3NFQA 1X8YA 3KDPB 3V5BA 4C7NB 4B86A 1J2JB 5AVWB 5AW1B 5AVUB 3TYYA 5APWA 3LIEA 2BASA 2YO3A 1DH3A 3VN0A 4HYTB 2YNYA 1G2CB 3O8ZA 4JYBA 5AVSB 4XE5B 1FOSF 4LC1A 5AVTB 1CI6A 1HBWA 5APTA 2Q3IA 1HWTC 3NMDA 5AW4B 5AVZB 1A02J 5AW6B 1H88A 2P7JA 3VYIA 3HE5B 1GK4A 3IR9A 1A02F 2P67A 2R3CA 1T2KD 2C9LY 5APSA 2Z5HA 3T97A 5AW7B 2Q5UA 2ZXEB 1S9KD 1JNMA 3A7OA 3TNUA 4C46A 2E42A 5CMZA 1HUCA 2VRSA 2WTYA 2WPRA 3SWFA 4C7NA 5AW2B 2WPQA 5AW0B 3WGVB 2ZFCA 3WGUB 2XV5A 4RETB 3M0AA 1MUUA 4EOTA 1GD2E 1CZQA 2P2UA 3P7KA 1GZLA 1GU4A 3V4WA 3A5TA 3VMYA 1NWQA 1KQLA 5APXA 3HE4A 3I5CA 3VMZA 1JUNA 3OAKA 1GU5A 2E43A 3A2AA 3V4QA 3P8MC 4M3LA 1H8AA 2WWWA 3VMXA 2IPPA 2H7HA 1FAVA 3M06A 5APYA 2YO2A 3M9HA 5AVRB 3TK1A 2C9NY 5AW9B 1YYCA 4GKGA 4GT1A 3B8EB 2W6AA 3UIAA 2WT7B 4JYCA 2WPSA 1MFZA 3MD0A 3HE4B 3HTKA 5AW5B 3L35A 1CI6B 5AW3B 3A3YB 2R5BA 2W27A 5AVVB 4AYCA 1IO4A 1NAFA 3M9BA 5AW8B 4I6MC 4I2LC 4RESB 3L36A 1GK6A 5APUA 1H89A 5AVQB 3NTNA 3KQGA 5APVA 3M91A 2QM7A 3LIDA 2QM8A 4AUWA 5AVXB 2Q7CA 2N9BA 3L37A 4KHXA 3P32A 2KP8A 1HJBA 1GTWA 1FOSE
chains in the Genus database with same CATH superfamily
3WFDL 1WGVA 4EMZA 2L7EA 3LQZA 1MHEB 2ADIB 4FG4A 3L70J 1JIBA 2DIJA 4JPWL 1QPPA 3QG6A 4UQDA 4D0CA 1P0SE 5IK3A 3P9WB 4BWNA 1F4XH 1ZT7A 1VFOA 4HC1H 2VDRH 3LJ3A 4TUUA 5B21A 4D6TD 4MGXA 4ALAH 4AK1A 4L9DA 3BZEB 1S7SB 1MVYA 4FTVA 5A16B 1NTMD 5IQ9B 3IWUA 1MVUB 3KCPB 1URQB 1NC2A 4K8RC 5DJ8A 1J1OH 2MJWA 5JW4M 2KT6A 4Q2ZB 4YHIA 2OYIC 1FVCB 1U2YA 2BNQB 3KPQB 1A8JH 2F9BT 4FXGA 4PG9A 1U8LB 2PO6B 3NCYS 2O4EA 3DBXB 1A7RH 2NNFA 3GC3A 4PJIF 4D8PB 4HD5A 4Y1TA 3CFCL 4TQPA 3D48R 4WFEE 2ZP0T 3IDXH 5IMKA 2EXYC 2W0FA 2FH6A 1FCCA 1REIA 5EUOE 2ERJC 2F8OA 5FYKH 4C56D 3TIEA 1DJZA 1LEKA 1JTTA 4NWUL 1MWAA 1KZUB 3D9AL 3DJ9A 3LRGA 1ZMEC 2MOVA 3CPWO 3GF8A 2DI7A 3BMWA 1CE6A 2BP0B 2R29A 2VRSA 3FOMA 1IKFL 5TQ0H 3W68A 1E5UI 1ZT4A 3RPBA 2K6YA 4OZGA 1XH3B 2CDEB 1U8HA 1OY3B 5EU6A 4AYEC 1C16A 2XT1B 2K88A 4OV6F 3AECC 3H56A 2Q3AA 2GAZB 1ZW0A 3MHZA 4LBAA 4P9ML 4O4YL 5IJVB 1XT5A 1RE3A 4IIZA 1FBIL 3BWSA 3T6ZA 5EFWB 1YMME 2GJ6D 3VD3A 4E9WA 5D2NB 1KBGL 4D0CB 4YHLL 4BUHA 2K45A 1N26A 3MRFA 3U0TB 3NSCA 3V4UH 3GJFA 4OLWL 4YXHH 2EUXA 1U57A 1VQLP 2EEFA 5EUOB 4GO8A 3BDBA 3BLKA 3DHMA 2W81C 4IOIB 3U9PL 4QR7A 3GUFA 3F7VB 4MNGE 1JP5A 4YE0A 4IYKA 3SE3C 3CLEL 3WNJA 1A02N 2E74B 3FHQA 3OKMB 3QQDA 3QAZC 1MJJA 5B66H 2YIUC 2PO6A 3VD1A 3SPVA 2R2EA 1GTNA 3AT0A 1U92A 4MDIB 5CBNA 2H32A 1SYVB 2X5PA 1OGAE 4EN3D 2B14A 4GRWF 1KYUA 1JV5A 2IAMC 3QR1A 1WAAE 4PJBF 5ICZB 3ZJAA 5LXGL 4ZSOE 4AC4A 4N8CL 2W60B 1ITCA 4MAZA 3JVFC 3B43A 1RIHH 4BHUI 1PW3A 1UA6L 4IU2B 4P4KD 2YD1A 2H0PA 3DUSA 3KPMA 5EBWA 3OKDB 2FUTA 2P8PA 3B7RL 5EDXA 4DN4H 1KB5B 3SKOA 1TU2B 5T33L 5E0FA 2Z64C 4P4KC 4KUZH 3MKGA 4Z3JA 2WLNA 4BCXA 4TNGA 4M6OL 3FT1A 1HI6B 4RQQB 4KHTL 1JHLH 3IVKB 2R51A 4AZUA 1FNFA 3H1HG 4POYA 5B39A 2IZ1A 3TNUB 5J12C 2KZIA 3WLWC 5AYUH 2WUBH 4N4YB 3SBRA 4NO0D 2E7LC 5CEXA 5JMRA 2L5GB 4BJLA 3HB3B 4JO4H 3EZJB 1OCCB 4HH9B 5KLVD 2BP5M 5MEPA 1KYDA 3NK3A 5SWQB 4Y4KA 4K2UL 3BSZH 4I1PA 2YNYA 5HYSA 3PDGA 1KB9E 2B87A 5B1BB 4JPKL 1EFXA 2PNDA 3LN5B 3IDMB 5FC9A 3BSHA 3B1TA 4K3DH 1ZXGA 2DW5A 2H89C 1GGIH 2GSGB 3D0LA 4PCKA 1IC0A 4L0YA 1I8LC 5J9PB 4N5ED 2W95A 4YDNA 3OLDA 4J6IA 2PGDA 5BU5A 1O7DC 1KENH 5KYYA 4QRQA 1D9KB 1UENA 4K7PX 3L75J 2KLSA 1FDLH 3CZUB 2W60A 3MACH 5CCJA 2E9JA 4NUGH 2ZXBA 4JB9H 1SJEB 2Z3FA 3T0AA 5T3ZL 1A7RL 2A99A 1DVSA 1E9QA 1GHFL 4NDMA 4WU5A 1HJCA 1NFDF 1NCUA 3WJLA 4UTAH 2YD0A 4JY4B 3CHOA 2EIMB 2OMUB 1RQUA 3V4LA 2OQJA 2G2RB 2OAAA 4QHKJ 1R0AL 2IALA 4GKSB 3II3A 3BVDB 3QC6X 2X44D 5ABAA 3DX6A 2ATPB 4F58L 4WV1B 1S7QB 4GBXB 1WHPA 1YEDB 1JNHA 1WITA 4ONHB 2DQJL 3H42H 2ITDB 2JNZA 2VSMB 3I2CH 5BVZA 1JL8A 1L6ZA 4DAGH 1K8IA 1EJFA 2X38A 1C7TA 2CGRL 3SKMA 4IFFA 4E36A 4XPFH 5CD5C 5IOKA 2AEPL 2QQKH 4YNYA 3E9TA 1JZ3A 4LNVA 2C1PB 3O3EA 4PJ8C 3UG5A 1YN6A 1T7ZA 1U8CB 2VERA 2VDMB 4G8FA 2NSXA 1J9TA 3W1ZA 2R5BA 4JKKA 1HZHH 1N5YL 1XIWA 2ZJSH 1XR9A 1DUZB 3GMPB 5DURB 4DUWA 2DJ4A 4GRMA 1RH8A 3VQMA 4FEMA 1WA2X 3UYRH 1LNUB 4O02L 3VAEA 2AK4D 5D7HA 3ZZLA 3ARBB 1ZMYA 2FYUE 4H5SB 4MNGA 2VZSA 3OA7A 1G7MA 1XGTB 3ZKMC 3D71A 2QSVA 5KBPA 5LCVL 1DX7A 2CE6A 1YNLL 4DPBX 4NYLB 1SF3A 2Y2TA 3RDTA 4XODA 3P3TA 3NIGE 5DD5L 1XBRA 3GKZA 5D7JA 2V9RA 1LEIB 3ECUA 1QATA 4GRLB 4QO1A 2ZOKB 2O1AA 5DEGB 2F74B 4FNLL 3UJJH 4Z1PA 1QTPA 3VFGL 5DUML 2PWDA 2CDGA 4LEXL 3PNWB 2QFPA 3V5BA 3KPOA 3HRPA 1YEDA 3K6DA 1DBBH 4ZQTA 1J2JB 1DANT 1T20A 2GTQA 3A4DA 4O5LL 4X7SL 4XMPL 2MHAA 2QSQA 1ZRTE 2VDMH 5IB2A 4KOBA 4XC3L 4BRJA 3L71E 4LASL 4ZFOB 1OLZA 2VN6A 3EG9B 3H6JA 3TA3C 2RB8A 1NM4A 3MLXH 4GW1B 4IIQC 4MNQB 4Y2DB 5C0AA 2JF1A 1E5WA 3GM0A 3OXSA 1JG9A 3ARGD 3NTCL 3BAXA 1S7RA 5BV7B 5JIMA 2C1PA 3OAYH 4HMDA 2R1WB 4MB1A 5DC2A 2Q8AL 2JCCE 5DD6A 4XNMB 3BN3B 5GRXG 2BVTA 3MFFA 2YN5A 2V4HA 4LDOB 4HK0B 4Z7VF 3ZKMD 4QF1B 1JVKA 4AVKA 1S9KD 4UT6H 1MFCH 4D0DA 2AK4E 2NMSA 1SQXG 3IN0A 5C71A 3IJ8A 1AHWA 1FYTA 3D25A 1NLBL 4MJIA 4W9GC 1OTTC 4J3OH 1XZWA 1Y07A 2A3TA 3PRZA 4ZOAA 4MAUL 2PYEB 4FQQA 1JRHL 1YEKH 1T3UA 3NSDA 3QQNA 3BSZA 4LLWB 4WCYH 2AQPA 3QRBA 3S4SA 2B4CL 4Y4KC 1VQ6P 3SBWC 1JNNL 2YMTA 4WW2F 2EJ1A 3KYNB 3P4OA 1HZKA 5EZPA 2JK5B 3Q6GL 1OPGL 4J12A 4C4UA 4LKXA 1JZ6A 1EDKA 5BUPA 2WAHA 2WNGA 3TEUA 2NY5C 4JG1H 1BX2A 3O4LE 2E76C 1AXTL 4WI3A 3CN1A 2X6CA 1ZSDA 3L1EA 3GMQA 3FU0A 1S1CX 4XA4A 4JYCA 2XIDA 4KVPA 4NKOA 3G4SP 4ZUWA 2V4LA 2W8CA 1WP6A 4WF7A 2ICCA 2CQVA 3SY0A 2WLZA 1OT2A 3KWWB 4HF5H 4KX8A 2OW6A 4IBQA 1A64A 1FE6A 1AGCB 4ICWA 2CK2A 3ULUL 1BGXL 3L81A 4O51A 2FBJH 5C9JA 3TEWA 5I1CH 5IB1A 5IBLC 2WANA 4U4IA 5FOJA 3RZCC 3EH1A 2YXVA 1JY2O 3E1F1 3FL7A 2AXJA 3J27A 3N6YA 2NUTB 1T0OA 4LK4A 5CUSL 2DQIL 1QACA 5DHDA 1HJBC 3BDXA 4PJ7E 4OZFG 2N9BA 3QUMB 2IZ0A 3D8MA 3EIFA 1XGUB 2E9WA 3MJWA 4D0BB 4W4OA 1H8SA 4UB0L 1AHWB 4L3EA 5JXEC 3BKCH 2FQGA 3HRZC 1JPEA 2PYEA 2O5XL 4FQQB 3AM8C 5F70A 2AFNA 1SLQA 4RMVA 1C1EH 1TVDA 5DHEA 4JW3A 1WAPA 1PZAA 5JXED 5FKPB 4B86A 4ODUB 1HHIB 2O01N 3HE7C 2X9XA 4MSWA 4M6MH 2RMNA 4ZXBA 3HUJE 1SQPK 4NQQA 4DO5A 4XXDA 4U33A 1E4XL 1IARB 1NCNA 4LSTL 3DIFB 1OF2B 2HVJA 4PRPE 4D9QD 3W9EA 5EPMA 4PGDA 3EFDL 2NLJA 3H9SB 3NPSC 1H3PH 3D2UA 5HYJA 5D7JD 3M17A 1CI6A 2RKLA 4N6RB 3IFMA 3ML8A 1IO4C 1Q0XH 4JFQB 4YDVB 3TWYA 1M2VB 5LGHH 4TL5A 3GS0A 4N2MA 3MRRA 3VFNA 4JKPL 2XKMA 2X4PB 5C7XL 4MCYA 1OAUL 1Y1UA 3SYOA 2YPLA 2BSTB 1PYWA 3FONB 4NIKB 5GGSB 3U9PH 5IHHA 3VI3B 5FCUL 3VH8A 3WU1A 1O7SA 3WD5L 3IU4H 4MS8D 1TZGH 2C4XA 2ENYA 4RAHA 2YAEA 3MRMA 4X4ZA 3KGUA 2VABA 4ZFQA 4LBEB 3I9GH 5FUCC 4PB0L 3C2AH 5D4IA 4G2AA 1SXBA 1OGAD 3HUJB 3FZUD 3UZQB 2D31B 4D0BA 2VIRA 4P59H 2QMKA 4L3EB 3HN8A 1MF2H 3C8VA 4WEEA 3QW9A 1N2RB 2GUYA 4JFOA 1UUSA 4FTVE 4HP5A 4JHWH 1KPRB 1T0PB 3I9AA 4XN1A 5MEND 1DVZA 5C08D 1F42A 4UF7C 2VC2H 3S37X 2J20A 3S3PA 2DICA 3KH3A 1WIUA 1HHIA 3SEPA 5DS1A 4MA1B 5KAIE 1XGQB 4YHOH 4OCYL 4Y4FB 4P3CH 2M5AA 1BJ1J 1N7ML 4Y5XA 1NHLA 2HUHA 2ZXAA 4ZX4A 2KQMA 1L4AB 1YMMD 2GJ6E 2R9HD 3L13A 4YDVA 1M56B 2R23A 5MP6L 4LGDE 3AREC 5BOJA 4UMSA 5GS0L 1AGBA 3HD7C 5IFJB 4LXFA 1CLZL 5JZ7D 3GJFH 4F8NA 1BFVL 5EEXA 1IGFH 3K2IA 2NPSD 2VR4A 1G7HA 4ZW3A 3VG0H 2EDJA 3P02A 3QPQD 4CRPA 1I8LA 3TTYA 2CKBH 4J3SA 4U1MB 5IJKA 1F58H 4OZ4A 3NJMA 3CJJA 4C56E 3H2QA 3QJUB 4G6ML 2C1OB 2CLRB 1MRCH 2HCZX 1B6DA 3V9FA 4B9GA 4HJJH 1JVOA 3QI9C 3EYSH 2AK1H 1KCUL 4D7PA 3BE1H 2DZEA 3CX5E 4ZMOA 5AVYB 3M0DA 3KLAA 1OTUD 2PYFB 4CC4C 1MFAH 2WINA 3OKYA 1G4RA 5E6SB 5FX3A 1YUHA 4IL6X 3MV7B 5GS0C 1EGJL 2KLVA 1IGCL 2E75C 3MO1B 5EU6D 1TZAA 1GYWA 5JIDA 4MZRA 5E1AA 5EUKA 3ZSSA 5SWSA 3HMXA 3QO1A 5G4OA 3P4NA 5D6DA 3X12B 3MV8D 4P46C 3RKPA 4UQCA 4A68A 4R4NC 3TURA 4MBOA 4NKQB 4RZCB 1VAHA 2AEIT 2PTTA 3N40P 1IZKA 1RE4A 4FFZL 4LDCA 3ARPA 4ZDHB 1W8NA 4L4TA 1Q90D 3W0WE 5F1SA 4E41B 4MKMA 3U7AA 5TFSH 2DTSA 4H2CA 3WV0A 4GJTB 3FQRB 3AS2A 4PJ8A 4NEHB 1XX9C 5GGVY 4P5RA 1ZHBB 3O2WL 1FZKB 4XB7A 1MCPH 3EOTL 1FFQA 3MZGB 3WGUB 4EUPA 3HPJA 3ABVC 4JN1H 3UABA 1GH7A 3DXAB 5EBMB 2AGJH 4QHLA 2ODHA 3MMEB 4YUEH 5HDOA 4XHJC 3V2RA 4XCCL 1JTHB 1XGRA 2QQNH 3K1KC 1RUKH 4QAWA 1OM3H 3SGDI 4CSTA 1G9NC 4XNBA 2OTPA 2A06G 2JJTA 1U93B 2FSEA 3ASWA 3DTXA 1GL2C 3LRMA 4RA0C 3VA2C 1AVYA 3FAWA 2D2CD 3OMAB 1YJDH 3TU6A 4TTDC 7FABL 4TLFA 3OL2A 4JFDA 4PS4L 3HB3D 4LQFL 4Y16B 4XT1C 1LK3L 3TZVB 3DX2A 3TGUD 3HI1A 3KWXA 4PJHF 4DKFH 1ZIAA 1CGXA 4RAUA 4EI5A 1HWGB 3B9KC 3TJEL 3SGDH 2FUQA 4MQXC 4TSCL 3HE6C 5CEZL 1MFZA 3BQVA 1NYHA 4K94H 2IJ0C 1AQ8A 3MBXL 1TNNA 4ZZFA 5IUCA 5H35B 5EIVA 3TNMB 1J1XH 2XXFA 2XI9A 3SYAA 5AW8B 4AY0A 2RBLA 3MLZH 4ZOCA 1YRKA 5I1DB 2CBOA 2FEDC 1X5KA 3CZEA 2P1JA 5JNYB 4LARL 1WAAA 2NW3A 1GPOL 1M6UA 3FO9B 3TP4A 4X4ME 3TYFA 3CUPA 4EN3C 1DQLH 3CVBA 2YMXH 2ZXCA 4WWKB 5L88L 1IGIH 1SFCA 3N9GH 1JPGB 43CAB 2UZYB 2EXTA 4KBPA 4UNIA 3RA7H 2ZWKA 1D5RA 2NR6C 3DXAA 5EBMA 1LO3H 3VXUD 3N85H 4G7SB 3VSQA 4L74A 4OLZL 2VXVL 4TV3A 4AXWB 3TNNA 4J3XA 1SQVJ 4L37B 3WJMA 1EO8L 1AYOA 3T9WA 2X4RB 5AKSA 5TE7L 4JPIA 2R32A 4G5AA 4P2OD 5GSRB 1EJOL 1ZS8A 4TTDD 3IJEA 2X1XR 1GL2B 4A67A 4P4KA 5JLZA 2AQQA 4BKTC 1MHHB 4KRLB 2BJML 5DQJB 4K5MA 1L9PA 4AQ1A 1MIEL 1KLUB 5CCGD 3IT8D 2D03H 1IV8A 5F1IB 3BASA 1FV1A 2X10A 4LCIH 4RAUB 1KTBA 4KK6C 1WSST 3LKRB 3P0VH 1K4CA 3UTZA 5BVJA 3P3UA 4ZJ9A 4AEEA 2P5EB 2ZCLH 2NDGA 4MJ2A 5AOJA 3LEVH 1H88A 4DTGL 1HILA 1R3IL 5EN2A 2CCVA 1N19A 3UTTE 2E9GA 4OD3L 1AO7E 2ZCLL 5KVDL 3KYMB 1NCAL 2C9QA 2TSAA 3AUWB 2CK0H 4NO3A 2BWDA 4ZYKB 3WE6A 4Z7OB 3UZEA 4PJ5A 3A7OA 3OKLB 1YYML 2F6AA 4OR1A 3CFBB 3OHXA 4YO0A 3H1HE 2DQEH 4KTYA 4YHOL 1E43A 2WMPB 1UWGL 3QFGA 2YSSA 4WHYH 4RGOH 2H2PD 3D18B 1T5XA 3WUWA 5A43C 1A6UH 3V4WA 1Z9NA 2J1YA 3GHPA 3MPCA 3Q5OA 4BRYB 3ZZSA 2Q8BH 2ZYRA 1I82A 2DLTA 4F8PA 4ELMF 3QDJB 3SIKA 1RULL 1A6UL 2D7NA 3MOQA 2WUCH 3O6FD 3QIUB 2X2YA 4P57A 4P2QB 5HDRA 4WZ9A 1J5OH 1ZDQA 4F3FA 2AMUA 3H1IE 4WO4B 2WQYC 1OAXL 1OX3A 3ARFC 5FGRA 2XWCA 1IGFL 4HAGA 1U4FA 3FNKA 3GSUB 3QI9B 2HG5A 3LB6D 1SQBJ 4UB0H 5K9QI 3ZHFA 4K3HA 3IWVA 3WELA 4ZTPH 5B8CA 1ETJA 3ROLA 3S3DB 4KO9A 2ARWA 1UJ3B 1UKTA 1X4ZA 3A6BL 3GK8L 4PS4H 5JIIA 4KI5E 5FYLE 1IFJA 3M9BA 2RTTA 5FKAA 4NP4H 4AEIH 4I2LC 3E6HB 1FDMA 1KG0A 5MENE 4E5XB 1BSNA 4UM8B 5CJ5A 4EI2A 2VM3A 3VXMD 2Z8VC 3ZDWA 5HI4D 3EJTA 3ATDA 2GJPA 1FZCA 4XO9A 2RH0A 4MCZA 5TE4L 4HGWB 8PAZA 4N1EA 3PREA 4S1RH 2N3JA 1OAQL 4GSQA 1XMEB 4Z7AA 4WY4D 2VDNB 4PJDE 1ZLVH 1KFAH 3THML 1LNQA 1LTBC 4UQ3B 3PAVA 5F3BB 3GIZH 1IJDB 4A7VA 3GWJA 1KJ2B 3TBYA 3DVGA 4F80A 3GMLB 3LZQA 2F7IA 4PRHD 4Y4FC 3CX5K 4PBXA 2XXCB 5KLIC 1JXGA 5E5UB 5C1MB 4GQQA 3O2DH 4G72B 3RDTC 4WY7L 2FEEL 2G3MA 3CN2A 3ZSTA 1G87A 2YEZA 3NFQA 4K3EL 4HLEA 1VFUA 2KPNA 4W7ZA 4GXUN 3W39B 1INQA 3M0DC 1TEFA 3BKYH 1LT9A 4ZOEA 5AVUB 5E9NA 1SOQA 1TJXA 4WFHD 1NFDE 3OF6A 1AZZC 4N2OA 3RURA 1G7JA 4MCNA 4YZFE 1H6UA 1FN4A 1OZUA 4MA7L 2H43A 3BO8A 3LVEA 5C09A 1BEYH 1MW1A 4EVNA 2V5TA 3ELAT 1JWMA 2YOAA 3K5SA 1QFWL 4PRHA 2A1WL 4JZOB 1NH6A 4JG0L 4C4KT 2KC0A 1PFOA 1R3KB 1AD9B 4GB9A 2DY2A 4ZFZB 3WJJA 1DVTA 3H1JJ 2D7QA 4GRWH 2XN9A 5DFWH 2J56A 1E4KC 3EW3B 3IAPA 3GTTA 3T97A 3FCSB 4EIUA 4HDIA 3IPFA 3ZHNA 4WTXA 4FFWD 4QTIL 1IFIA 2QJKC 1NOLA 4JHAL 3O0LA 3NCJH 1ED3B 4FQLH 5MEOB 1I85A 2FX7H 4B27A 4ZMQA 4CVZA 2WQAA 3LQAL 1OCZB 3R1GL 1JMBA 3EYQD 5FS5A 5T3ZE 2PLTA 1X22A 2HPCA 4F2FA 4X5WA 4XVTH 3QIBC 5EO0B 2OSXA 1QSZA 1T5WA 5FGSA 1U3HD 3K74B 1HIML 3C6LD 4QHMA 1AVOA 2JJUA 3RVTD 2ROXA 2IWFA 3C60C 1OAKH 1P4BH 3EDFA 4CU8A 4AM0B 5GRWA 1L4AD 1KBGH 2XLLA 1H3GA 3ZHDA 1R46A 2KZWA 2HPTA 4LL1A 1D3CA 1ZXQA 2HT3D 1X5YA 1S2EA 4TNFA 3LIUA 4GSDL 1B4JL 1QHQA 3HC0B 3B8SA 2IQ9L 2KHAA 4FFYL 2EYRA 5F88B 1DSFH 1YNTF 2COQA 4NO5B 4U1HB 3SOBH 3MLSL 4R7LA 2MCMA 4I7ZB 5IMKB 1PP9D 1HKLL 4LRIA 3T0ED 1L2PA 5DEZA 1LWRA 3UYOD 43C9B 3RZCB 1JERA 5T1LD 1IEAB 2R1XB 4P46A 1NMAL 3ZLQC 2RD0A 1XD0A 1W91A 4CDHA 3P1VA 3L6FB 4AIZA 2IWKA 1CE6B 2V9QA 1IGTB 3SJVB 3F62A 4XMKH 1XAUA 5CSBA 3UERA 1WBXA 1AQTA 3FN9A 2K9UA 4J3OF 1GW3A 3TBVB 2H1LM 5B3JE 3RP1A 1YTZI 4JM0A 1S9KE 1RLWA 2OSWA 1G9MC 4KJQD 3SDAB 2R5DA 3WKNA 4D94A 3TYGH 2HR3A 3H54A 3B37A 3L5HA 1NA8A 4R84A 1MJUH 2DQJH 3H42L 4GDOA 2CRZA 3JVGC 3QEQE 3QAQA 2OK0L 1N10A 4HBCL 4ISVB 3G6EP 5AW1B 1G1KA 1BOGB 1K4DA 1YG9A 3QDMA 1QBLH 2VJ0A 1JI2A 1E42A 3RWFB 1T1XA 1SS1A 1O9ZA 1KDIA 2NOYA 4GAGL 4PRNA 4FP8L 1WZKA 3ZDYB 2BW5A 3L1OL 1OAYL 3ARVA 1GC1C 1KDJA 4OKDA 3QWRA 3MDJA 4GEJA 4LEEA 2YZ1A 3L9BA 4ACPA 8FABA 3FGAD 2YKLL 2YPKA 2PXYA 2BSBA 5CN1A 4F7TB 4OJFL 2V2XB 2GUSA 2HFFA 2ZXDA 5IVOA 3SY6A 2VR3A 3RL1B 3ZE0B 4AL8L 2OZ4L 2F5BH 3B34A 3TN0D 1PVHA 3UTSA 2RGSA 4E0RA 43C9A 3I85A 3CHQA 3ZKSD 2Q5UA 2E5EA 1J48A 1FPTL 5GGTA 2VCOA 1X3DA 5IBUG 1P1ZB 4G7YL 1U6AH 4BXSV 2NW2B 5HGHB 3OKDA 4Q9QH 2ZWYA 3B8YA 3FX0A 3IJYB 4JPKH 5JPNC 1OVUA 2AQ2A 4JRXD 4NQEA 1TFPA 4WI5A 2EC8A 3HE4A 1ZK9A 3QK0A 3MV9D 3CFNA 2H26B 1NJ9A 4UOQA 3NQIA 3IVKA 5IQLA 4F7CA 3ULVE 3MU3A 1I53A 4AQOA 4KVNH 2G30A 5F9WB 2BDNH 3BIKA 5D8JH 4BDVB 2VLJE 3LKNA 4PJFE 4H4NA 1QNZL 4MA8L 2HSIA 1N7SB 1DVYA 3Q1EA 4M7KL 3AB0B 2FHFA 2XNAA 2FB4L 4KRPB 4XAKE 2IVFC 2P80A 4XTRD 4YDJA 4POZC 2WXHA 2A4ZA 4EKXA 5JIPA 1SJHA 1HC1A 2CHNA 3V9EA 5L7XH 4XWGH 4JQVA 4H8WH 5AW5B 4AQEA 4EQ3A 3WFZA 1QSEA 4KGLA 5FYJH 4K07A 3DX7B 5G4NA 2QG4A 1F3DJ 5HHMD 4CNIB 4DP5X 5FO8B 3H3PL 1SQBE 1T1ZA 1BQRA 1AZNA 2IXQA 4NX0A 4F92B 3FQUB 1VB9A 3T3ME 5LAXA 1GOHA 5APUA 1PD0A 2HFFB 4HIHA 4I2XE 4LT7A 4P5KB 5I74B 3ARBC 1DSWA 3HTLX 2NZ9C 3IPBA 2MNJB 1JY3P 2PWFA 1J5IA 2XA3A 4TVPD 3QSKB 3GO1H 3RDJA 2BSRB 3VI4E 2OX5B 4QUOA 4KJPC 2K3HA 5I18H 3SDAD 4DHLA 4P04A 4RMWA 1FBIH 1L9RA 3RZWA 3WOVA 1NCCH 3T4AA 1AV1A 4DT0A 3CLEH 3NAAL 3UH8A 1YNTA 1AIFB 3KJ4C 4FNQA 2ENPA 2W65B 3L75E 3HS9A 3MRCA 5FHAL 1S5HA 1JZ4A 1R3HB 5CZVH 4LMQI 3HNVL 1VEMA 1BD2E 1MAML 2WSEJ 4Y9BA 3U6RB 4KT0J 5F7HA 5J56B 4ECNA 2VL5B 3CVDA 4NPDA 3E2HC 3D51A 1NTKE 4WTZG 2XWRA 2N1TC 4O2CA 4H40A 4ZS6C 3JYBA 3OKNA 5D7LD 1SLXA 5D1XD 3KDMB 1AZBA 3H1KD 1RIUL 3W56A 5C0GB 1YHQP 1A9BB 1U8NA 4XC3H 4U1SA 3VI4B 2EE2A 5AVZB 1CW5A 5FPIA 3V5KA 4YR6B 1VSCA 4L9LC 5LBSL 3FWNA 2AABL 1DUZA 3GMPA 3TPKA 5ALCL 5HDQL 1CICC 2CUHA 4OVNF 3TO4C 1AQKH 1T22B 2N7BA 5CN3A 5H4ZA 5E99L 4JFHE 2ZAEB 1CGYA 3JUYA 5IGXH 3K6IA 4YHYC 5JXAL 4V1DB 1UT9A 4TUOA 1QTYT 2OYLA 3JWOC 3O4LA 5H37H 4XZUA 9PCYA 2O01H 1NC4B 3M7FB 4Q56A 4ZNCA 1ZOXA 5JOPD 3RE0A 4XVSH 1JUFB 2P5WB 4TNWK 3U1QA 3E6FB 3FUIA 3MOBL 4ZO6A 3S3JA 2RQEA 3MBWB 3V9CA 5CAYB 1CG9A 1JHLL 4PS7A 4FS0A 5C0JA 3BW9B 2JDIH 3SDCD 1P84H 3BYYA 4GRLA 1X5AA 5K1JA 2VXUL 1Y0LB 4N86A 4XP6L 4E9LA 4JG9A 4YSQA 4DW2H 1Q90A 2VB5A 3O3DB 1S5HB 3P8MC 2OTWA 2CBTA 1MI5B 3G9RA 2E6JA 1BAGA 3HZKB 4GSUA 1JVLA 3NIFF 4HWZA 2E56A 3ZUNC 2OJZL 5CR1A 2IAMA 4M7LL 3FFCE 1Q9WB 5F7UA 2FGWH 2W83C 4NQEE 3AE4C 4TLTA 2BVEA 1M53A 2XKNA 4JM4L 4W93A 1YVLA 3UBXG 5TDPA 4RGMC 2BSED 2UWJE 5KS9F 1OLLA 1FZBA 1OSZB 3FB6B 5FUOH 4R4ND 1EO7A 1P6FA 3CH1A 3UTTA 2XWJB 3V0GA 3KR3L 4TQEH 2XPYA 2JO1A 4B7IA 4DZBB 4XNMA 1SQPD 3EYUH 1PX8A 3TF7C 1TYJA 3UIZA 4ZQKB 1I7ZA 4Y4HD 1X9RA 4ZAKB 2BEQD 5I6KA 3L17A 2PWGA 2OMXB 1CYGA 3SCMB 3L4TA 2EO1A 4X0KA 1ZAGA 5KJ4A 7PAZA 2YIUB 3HG1D 1ZKAA 3BKYL 3TFBA 3L95A 4Y4HC 4HWNA 2PO6D 4BELD 4IOFC 5B1JC 4ZUVB 2G60H 1I3RA 1XFPA 4F58H 2DLFL 1D5MB 4QNPF 4H13B 4XVUC 2NRGA 3IE9A 5BJTA 5FV2A 4BKLB 4BQ9A 1BGXH 2EINB 3DOHA 3S4SB 3GO1L 2CKBB 5C8JB 3GTVA 5F9AC 1G6RB 5D4QA 4JY6B 4DP2X 2XQYK 4GUOA 3OKMA 2DYRB 1G7LA 1Q1JL 3PRJA 5AKRA 5J3HD 1G9ML 1ET8A 4LQFH 2AJUL 3N0PB 3GSWB 3PWPE 4KOCA 4YVNA 2JKWA 2BY3A 5HVHC 4JCLA 1DDTA 3LNIA 4QCIA 5TPWH 1DSYA 3DPBA 5GS0D 2BWQA 2X87A 1F2XK 4QPEA 3TBCA 2Y24A 1ZRUA 1ZTXE 3DURB 5CP3H 5DJ6B 5KKZB 3DX4A 4FQLL 2D7TH 1T80A 2FO4B 2GIYA 4UTBA 3TTSA 4K3DL 4PW4A 1JD7A 3LH8A 1A22B 2AXFA 5C0RH 3BP5B 2XQYA 1IAOA 2G5RA 3S6CA 1KB5L 1T3FA 4LRIC 4GAAA 4Z77B 3P54A 3WGVB 5AWNL 1IBGH 5HYEA 2PO6C 3Q2VA 4MFHA 1NANH 4WJ5B 2FIKB 2VDPB 5AB1A 3UAJA 4PD4H 5INDA 1YJDC 2ZAHA 4ZUVA 2GTWB 3LPWA 1WCQA 3GHBL 4JFHD 1ODAA 1R0AH 1MAMH 2O01J 2WNKA 3SDYL 4UBDD 1YQVL 3FWLA 1ACYL 2PCFB 4Z7UA 1S9WB 1H8AA 3V0FA 4GEIA 4YHZH 7TAAA 1N2DC 3H6AA 4JFUA 3OWEA 1A9EB 3SDDD 2WXRA 2CMRL 4KH9A 2CXKA 4W9DC 1LO3L 4GAJH 1P4IH 2CUIA 4JO3H 2EKSB 3O0RH 4LSQH 2B39A 5I1JL 3N41B 5DLLA 1ZV9A 2XN9E 2YPLE 5IF0A 4ZMXA 1SQXD 2I24N 1YDPA 2JLLA 5EMYA 4RWYH 1PJ9A 3PDDA 4C59B 1S9XA 5D6CA 4MMXB 3JV4A 3LEVL 4QIRA 1BD2D 2FYUK 2HJFA 1XHHA 5KYXB 2PP7A 1PYWB 3FONA 1ACZA 3UBXI 2X53A 2DWYA 3TEYA 2XWBA 3LPPA 3GJFK 4J4PC 4LCIL 2G2RA 4NBZB 3S9OA 3SDDA 5HDBB 2FXPA 4KROB 2H2SD 3SDCB 4GXFA 1OE3A 1UKSA 3DI2B 4OZGF 4PJIE 2G3AA 4F7PB 4MB4A 1F1AA 2L7UA 2Y6TE 1Q38A 3HUJA 5CU9A 3WFCH 2ZKYA 2PXYD 1TTFA 3EFFA 3MXVL 2GT9B 3H8NA 3CSBA 1JF1B 1GL2D 2V6HA 2GITB 3AWEA 3HE5A 3QCVL 5F97E 1N4XL 3QE5A 2EEDA 3OBAA 4XBGA 1KILA 3WEOA 1UXMA 1X8YA 5C0DB 5DQ9B 1E5ZA 3MBEA 3VRJA 5ADOL 5DHYA 3RJOA 4Y9GA 4FQ1L 1BGYE 1UVQB 2FEJA 1USZA 3NQKA 4JFTA 2JKIS 2BK8A 5LVEA 1KTDA 1V54B 2J8HA 3UBXA 3B2MA 4A2FA 2F7RA 5FYLH 4OWFA 2V9TA 2NXZB 4H1LH 4PCSA 1S9YA 2Y36H 4JG5A 3K4AA 4I8DA 5EU7C 5LBSH 1THCA 4OBRA 1MRCL 3R7QA 3WFEH 4WW2C 4H0LD 1P7BA 2EE9A 2O30A 1NGPH 4OT1H 3VE0B 1DO6A 2JKVA 4Y0GA 2JV6A 3QG7H 5HVHB 1QL1A 3SKJH 3PWPA 4HUWB 4NQDE 2DJSA 2SPZA 5APSA 4L3CB 1AGBB 1PL5A 4C58B 2R8SH 5L8JB 4BK8A 5JIHA 4TT3H 1JK8B 1XH0A 2H8PD 4Y19B 2KXPB 1U8MB 2VN5A 4YS4A 1LTJA 5I8CB 5JA8B 3ZRFC 2ZOLB 2NY0C 4ZFFA 3JCUE 2WIIB 1RSYA 2VLME 3K2UL 2HYMA 2ZX5A 1HHKB 5E79H 2IX7C 3CHPA 4L2LA 4ZS7L 1N67A 3F8UB 5TK2A 5I8EB 3LTVA 4MXQD 4A2MA 1PZUB 3B2VL 3VXRE 4PBWD 3L71G 5KG9A 3VD4A 1FLRL 3ROOA 4Z76A 1SXAA 4UYPA 1ETZB 4XNYH 4E68A 1Q0XL 3IFOA 1LGHB 1DN0B 1NTMK 1YQ4C 4YUEL 3AT9A 5FW7A 1HU8A 3CI9A 3PWLB 5T3XH 3US1A 1KFAL 3THMH 1TNMA 5EC1B 3SBPA 4A2DA 1EEYB 2XN0A 4XO8A 4YL9A 2BMKB 4BGDA 3DPDA 4X4YB 2Y3AA 3H32A 1RERA 3MXWL 3F85A 5LUMA 4H13D 1INEL 4WUUA 5DD3H 1UD2A 2BNUB 4HETA 4OVUA 1UA7A 2IQAB 3HG3A 4WK4B 5DGQA 5IW3A 5CIPA 3QNZA 4RGMB 3I75B 3ZQ9A 1IC5L 4F24A 4ONFH 1JGVH 1S5LH 1UZ6F 3KBHE 4AGNA 4IOIH 3ALWA 5FW8A 1S7VB 3K71A 2Y3NA 1IC5H 1MCIA 3BPOC 3RGVC 3S5LA 2JJTC 4ONFL 1S7SA 2XTSA 2APFA 1CGSL 5DEJA 5E4EC 4IIQA 1D6EB 3ZKND 2DWEB 4YZFF 3BN9D 1QBAA 4O02A 2Q9OA 4S2SA 4K94L 4AW4A 1IFMA 1J0ZA 3A23A 1HCVA 1UT2A 4K35A 1OEZW 2VRKA 4H8WC 4KQ3H 4LLYA 4MXQC 5ERWA 3B71A 5AB0A 4GAFB 3OAYK 1PEZA 5AL0A 4JDZB 3DTDA 2VXTH 1CB4A 3CWBD 3FRUA 5D1ZD 5IFHL 5DZNA 3FC8A 2FLRT 1VQ5P 2VYRE 2IWEA 1ZS2A 3UTSD 3KXDA 4DCQB 4QKTA 4I1RA 5I82A 4PBDA 4RMQA 2AKRB 5BS0B 1B4LA 3CVHA 3CSYA 4ONGL 2AC0A 1WD8A 3R19A 4CL7A 3FT4A 2OCJA 2MCPL 3CFIC 3V2PA 4BUQA 2G8YA 1NC4D 1WT6A 1PX3A 4OCLC 3JT0A 5EU3A 4DKDC 3K71B 2XQBL 3C5SA 1WZ1L 5DD5H 1J1PL 3T2NH 5GGUA 2ID5A 2CJUH 3PHOA 5DS8B 1EFQA 1U3HC 2CM5A 4EDWH 1ML0A 3C6LC 2PYED 5FEBA 3HBPA 3V4UL 2JKXA 4FTDA 3WSQH 5ABZA 5HYJE 2HYNA 1KLGB 1QL2A 1NAYA 1THAA 4LSRL 3NA9L 3AQXA 4XE0A 4ZW5A 1FORH 4N2KA 4DKAA 1AMYA 3U9UA 2H3NB 5HVFB 5FB8B 2E42A 1CLCA 2EDKA 2VW7A 2YK1L 3B2UD 2B8OT 1CFTB 5IKCA 1TKWA 3EYOA 3D6YA 5IWLA 2IBZX 1DJSA 2JQAA 4XI5C 1J11A 1R24B 1KCUH 2FSDA 1L0LK 3NG5A 4UI2A 3SJVD 3U79A 4LLUA 2AEFA 2JIXB 3MCG1 4RGOL 4W68A 2Q0ZX 2JWAA 1UOWA 1NCBH 1PG7X 1AE6L 3D3VE 3AEGC 5I71C 2MKLC 2GSGA 2PPCA 4QD2E 4BM7A 3AAZA 4JE0A 2Y7OA 4LSVL 3VSVA 4GLRH 4J3OC 5IROC 4L75A 3V0HA 1WC7A 4Q9RL 4I18C 4PW9A 3Q2CA 2Z31B 1Q9OB 2FDBP 3EBAA 5MHSE 2Q87A 1OAQH 4LFHD 2C4FT 3CD4A 4QYOA 4RDQG 1KORA 3P0VL 4HAFA 4JY4A 3SYQA 2IMNA 1QLED 5GGSA 5IQ7H 2PPDA 1WRGA 3H9SD 1SZNA 5IHBA 3OPZH 1CDJA 4AGOA 4L8SA 5JXAH 2HJLB 2VLRA 4QRRD 1S7XB 3SOTA 3HHRB 4PJCA 1BHGA 3AB0C 5I5MA 4NO3B 1PL3A 1YN7A 3BQUB 3FTVA 2VQ1B 4RRPM 4UU9B 4Z8FH 4JHAH 4R0LA 1S7QA 3JVGA 3UZQA 1NC2D 3GBNH 4M62L 3MOBH 1AI1L 4KHXA 1SEQL 1MCHA 2IV9A 1MXGA 1XF5B 1F3JB 1XZ0B 1T21A 1MDAA 2B87B 2OMNA 4ADJA 1YMMA 3FTWA 3OZKA 5I24A 4PJAF 3PFQA 2BNRA 1UH3A 2HFTA 4AKQA 5DC4B 2R3SA 2ICWI 3VTPC 2KKQA 4G7QB 4WGKA 5JPNB 1ZLWK 3QYCA 1V7NL 1TCRB 1TU3F 2L7QA 4UNUA 5AAWA 1I4FA 1IQDA 5KW9H 1XR9B 3RVVD 4CA4A 1WQVT 4G6KL 4QRPE 3NJGA 4JRYD 2XWEA 1ANUA 4WEBL 2N7AA 3PL6C 5I1KL 2CO4A 1XF3A 2BASA 3CDGB 4HA1A 2OYMA 4ZPTB 1KGCE 3DOIA 4YTPC 3NZ8A 1A6VH 3RLSA 3AY2A 2A06E 2R23B 3BGMA 3PFUA 1OAJA 4FCHA 3FZUC 4MHHG 5LB1A 5I6NA 3P69A 4HCFA 2ED7A 2IANE 4XFJA 3MV9B 4I18B 4K9JA 1W80A 3S36L 3OJDA 2J1WA 3VU1A 5FM4A 3H1ID 5L8RJ 1BQLL 5AWNH 1I1FA 3UAEA 3I3EA 2KS1B 2Z7UA 4UQEA 1I1AD 2UWEE 1ZA6B 2ATPA 4G6FB 5KVFE 2F1EA 2P52A 1LO2L 2ZCKH 2BSDA 4XP5H 5ITBH 2NZ9D 1YEJH 2AJXL 3D33A 3HKFA 3ULAB 1K8DA 1E8WA 3O0RL 2A9ML 1AVAA 3CFJA 4FKHA 5EG6C 3ILQD 4BWTA 3US9A 3T6QC 3H6PA 4X9GA 4YIQB 1JZGA 1MN4A 3D4GA 2ZYAA 3NJLA 5F8RC 4EE2A 1C12B 4DEPC 3DVNB 3N42B 2J12B 1BQKA 2UUDK 5GSVA 5DWUL 4XCFH 3U48A 3VW3L 3H9HA 1COBA 5FECA 1RF1A 3QWNA 5JW3H 1CLOL 2Z31D 1Y6KR 4U1IB 5EV7A 5EBLB 2HP4A 4JJOA 2X6MA 5FUZH 1NKZB 4R97C 2YUXA 1G7MB 1FVEA 2DBJA 3P4NB 1EDLA 4BZYA 4HKXA 5DYFA 4GW4A 1AY1L 5EZJB 3HOGA 4PVNA 1QYGL 2O1KA 4L1TA 3ULVL 3CFKB 1A3RH 4HKZB 2F15A 3LNEA 2WYTA 3AXLA 3FUHA 4EDWL 5DSCB 4L8CA 4AQAB 1CPUA 2EDRA 3BWUC 4X7TB 5E00B 5ACZA 3LMJH 4XHQA 2JP3A 4MJIB 3RU8H 2WCSA 2EDNA 3D39A 3J2PA 1J1XL 4GAYB 1FNSL 3IS1X 1DE4A 1Y7VA 2A0LD 1ACCA 1F6FB 1NMBL 4HUVA 3RK2D 1MNUH 2H6PB 3L4FA 3SE8H 2Q7CA 1II4E 5D4JA 2CO3A 3MKKA 4UB6H 2R44A 3CFCH 3QQ9C 3MNZB 1ZK5A 2D0GA 1XBDA 5MEOA 1T66D 3NXSA 3L3KB 3Q7JA 1S3KL 1ZCRA 2LT9A 4M5TA 1T2KC 3RGVB 2VDNL 3B5GA 3S34L 2NQCA 1KCVL 3GB7A 3GMQB 4FQ2L 1Z9SA 4HXAH 4YHML 1IC7L 1DDHB 2BP0A 2YFNA 3FOMB 3SHSA 5C2BL 1NMCC 2DI9A 3CFQA 1EWHA 1LP1A 3IRZA 4Y99C 4B9YA 4ZW8A 2BNRE 2DKSA 3TYGL 1WWBX 3TEXA 1BVZA 1OALA 4JMXA 4JO2L 4QRFA 3AC0A 5CN2A 5KJ7C 1AQDA 4IGBD 5IW1B 4HW6A 3CQFA 1S9VB 4PAZA 2VRQA 4JZJC 1VQMP 1AD0B 3ARXA 1FYTD 3E80A 3WI9A 3QUZA 1IFPA 1BE3E 5JNYA 2BSCA 2W91A 2GJ6B 4DFHA 1GK4A 1F5WA 2WM0A 3QS2A 5I1GL 4MRCA 1MCOL 4QRSB 4TQEL 2WSCJ 1JWUB 3D39B 2QEXP 1G7IB 4HZLA 3NEEA 4IK6A 1TUPA 2X7LA 3FRPB 1W0VB 5FDWA 1KT2A 4JRYA 4APQD 2N56A 5IHZB 1EIBA 2OPCA 2WPRA 4FFZA 4L5FL 3WUWG 5L2KE 1HKFA 1I7UB 1KC5L 5ACMA 3RL0C 3K4DA 3E8UL 3ARDC 3U30B 2NY0B 4MSWB 4NQSB 4XMKL 4EI6A 2FCBA 5CP3A 3P7KA 5TF1L 2RQ8A 5KS9E 3L3KA 1RUQL 2ITCB 4KJWD 3M1CA 5CXPA 5E4OA 3NOIA 4AVHA 1FNEB 3MA7A 2CO6A 2QLYA 1KJMA 4M9PA 3QIWC 1SHXA 4NO2A 2CCLA 1J1EC 1MHHA 1IBBA 1Q2NA 5CLWA 1D2PA 5IMOB 2P8PB 3JV5A 4GP5B 1KYOJ 5IBTH 3MUDC 1RZ7L 1VQKP 1CK0H 1KYOD 5KAQG 5KJRL 1DFXA 4N1HB 4B95C 4QMAA 3IF1A 4WW2B 4XMLL 3WUUA 2A6JA 1JGVL 4BFEA 4NQCE 3QULB 3DRTB 1T1XB 3UJTL 4LCYB 3MV7E 3QUMA 4HJSA 4LHUG 4OGAC 3QUYC 4PJGF 4OZGE 5EU6E 3CWGA 4PWGA 2BOBB 4D2NA 1FL5B 3RWDB 3ZTJG 1CE1H 4WTWA 4JREC 5I15L 3EOYG 4PRDB 5DZ9A 3E3QE 5KEZA 2VABB 1EXHA 4OGQD 3U0PB 4QT5A 1X5GA 3QVAA 5GS1C 3C09B 4KK5D 4KY2A 4JFZH 1A3LH 4F1SA 4ZO7A 3OR6B 4JM2F 1T5KA 2YPVH 2YSSB 2QA4P 1O7VA 1URLA 2C9VA 3H7LA 4JFZL 4X6FA 3D2TA 1G7QA 1FFPB 1NANI 3MRKB 5FM5O 3VWJA 2CJ3A 1CDBA 1NGXB 5FGBC 5J4MA 4OCSH 2DLEA 5MEQB 1BM3H 1HOEA 5L7XL 4Q0XL 3IXAA 4G1EA 5JOFB 1YA5A 5GRZA 2J73A 4F7MB 1OWAA 3LS4H 3QISA 4FQJH 2HWZH 3S0PA 2MH4A 2FVNA 5F0JB 1F3DH 3EYFA 2NXZD 4XZ4A 4F3FB 3GMNB 2O72A 3CWBJ 4P5TA 5ADPH 4OLWH 4RNRB 1XB3A 3H4HA 1N73B 3EJYD 4R7NB 3T8XB 1LE9B 3OJAB 3FB5B 4JFFD 4XNZB 1NBZA 2BIHA 3FK3A 4OGAD 4YDJB 4RMUA 1J88A 4P23B 3GMOB 2CM6A 2X12A 3EH4B 4S1DD 1G2CB 4CKQA 2VMEA 4IDJL 2F7PA 5H8DA 4AOFA 5AVTB 1DQJA 1PPJE 3WD5H 1ZWIB 2C5DC 1NTZJ 2C7UA 1GY1A 2GJZA 1A6AB 5K5GB 3KPPA 3OJMB 5DHVB 3AVEA 5DYOA 3ZTNH 1H8LA 1VADA 3PV7A 5M95B 3VW3H 1ASQA 2EDLA 3GLMA 4JFOB 4R4FH 1T03H 3AM8A 3V6OA 1AOHA 4LPWA 2ZCHL 2BFVH 1OMIA 5A7BA 4FG6C 5JQ6L 3UO1L 1ZLLA 4UTCA 1DYZA 3BZ4B 3M07A 1NU1J 1IM3D 3L4UA 3L74E 2EDWA 2HJKB 4MVBD 1NUNB 1BD2B 1A4JB 1ILSA 2I5YL 3Q13A 4F2MB 3D09A 4IRJD 3L9EA 4YLCA 3GYRA 2VLJA 1BZDA 4KAQL 3FFCA 2RALA 3S1KA 3PWNA 1EAQA 4GAGH 3L3GB 1OZHA 4MYWB 3SFEC 2ADJA 5SWSB 3KLDA 4XVSL 3NT0A 5J1TC 3VFRA 5CCHD 2BRRL 3MGTB 2UWEF 4JPSA 2QJYB 2KLTA 5DJ8B 3MQIA 2QADB 2FHCA 3IFPB 5IFJA 2QIWA 2KS0A 2PP8A 2H8PA 3UDWA 4UBDC 3NH7H 3TK1A 2FE0A 1JDCA 3ILPB 2MCG1 1MFEL 2AEQH 5DK0B 4OI7A 2Q3XA 1HHHA 4IRSB 5CZXD 2OJ1A 4U6XB 5HGAA 4NZTL 3ZYJA 1J0JA 2NT1A 1CGWA 2B3IA 2QJYC 4LLDB 3FMGL 2CLRA 3FUMA 3Q2LA 2W27A 4U1SB 3VI4A 3B4NA 2K1MA 1BZ7B 4WUUE 3V5KB 3FU3A 3L3JA 5D5MB 5I1GH 1GK6A 2X1WL 4D9RD 2YJQA 3U82B 5CILL 4IL6E 1JTHA 2EYTA 1A1MA 1HHGA 2IMMA 2NX5B 1YECL 3M6DA 3EYSL 3MREB 4MMZC 1DLFL 1BVKA 2V5RA 2Y36L 3EJRA 4WI0A 4XNUH 3H85A 4Y5VC 5CZKA 5D7LA 1T0MB 3REWA 1O6TA 4UTBH 2DTML 4DP4X 5BNXD 5I5RA 1NC4A 2HPCB 1XWVA 4UT9A 3WKMH 4LU5L 1OGAB 2IH8A 1MCKA 4J8RB 3SCMC 2WV3A 1JMZA 4OZIB 4A7QA 3POHA 2V2TB 1P7KA 1SXSA 4J6RH 5ILTH 2OYHA 3TPUA 5ANHA 3DUHA 2A38A 4OI8A 2HX8A 4K71B 4DW2L 1EDJA 1CU4L 3F7VA 1WUNT 1MDTA 2WQSA 2PXYC 4LL9A 2BS71 2FLMA 5DVLA 1MI5A 4M1CD 1MCNA 3R4YA 5FOBB 2R15A 5I1DA 1DANU 1KNOB 5JHLH 1HCYA 3F12A 4LSQL 3MRQB 4PJXE 2J8UE 2QZQA 1QVFO 1FI8C 5LGHL 4NQED 4J5VA 1N86A 2YUVA 5IVXF 3A0HE 4X5PA 3RIFK 1OSZA 2A9MH 2EDOA 1VEPA 4P46B 3T6WA 1H3PL 4J1UA 2ESVA 1AMXA 3LS5L 1FG2B 1QFUL 1NGZA 4ANXA 1JAEA 2E75B 3UTPD 1H3XA 3MLWH 3Q5YA 2BIMA 2HFGL 3FQXA 3MCYA 3V4PA 4ADIA 5TJWK 3AG1B 1W2BO 3DYPA 1N5AB 3DHPA 2DQGH 2Y0DA 1MQKH 5E8PB 3A4AA 1KIQB 2NTSP 4PMFA 5DJXA 3BAWA 5DQDL 5IBUB 1TJMA 3PXJA 1TVHB 2ICEC 2VMFA 4NCC2 4L48A 5K1NA 5GS1B 1USEA 3F7YB 1D5MA 4LEXH 5D2LE 4PGZA 1HX0A 1IE5A 4TN9A 4ZUTA 3RIFF 3IFLH 2UZXB 3KJ6H 4LE8A 3MV7D 1GSMA 1J10A 3HC4H 3LQAH 5GZOA 5E9AA 4HG4J 1UYWL 3GJEA 1M05A 4WTZA 3CUPB 1E9PA 2I9LA 1TJHL 1KYOE 5HDWA 2EADA 4GG8B 2ARJQ 1L0LG 3MJ8A 4PJIA 4LHUA 3KLLA 4K9EC 4MTMA 4LPTA 2YGVA 1PZQA 4ODHH 4PJHB 4PRBA 1FZGA 1Y6MR 1I7TB 5CGTA 4X42A 3GDBA 1CJYA 2Y5EA 4W9LC 1HH9A 2D7TL 1PLGH 5FO9B 3BD3A 4YFEA 4KV5E 3H3PH 4PCTA 1QVOA 1M7IB 2MMXA 1ZS8B 3FHEA 2NPSB 3BP5A 3HE7A 4WNJA 3EJPA 3II2A 4JFXB 3WMSA 3QRGL 4LP8A 2LLLA 4MMZA 2N01B 4WU7A 2B20A 2OMTA 4LCCB 2HRLA 4XPGL 3QUXA 4MA3A 1MREH 2N1TA 4JHUA 2DBLH 4M43H 3U1SH 5F9OH 4GBXA 3RRQA 3VVWA 3BP7B 2XBDA 4FXGC 4GKNA 4JO2H 3RPKA 4PBVC 4U6YB 1Y18A 4UDUB 1JPSH 1E4KA 1HNFA 1JGUL 2EEXA 1EEZA 3VI3A 4K9EL 3B3IA 5PAZA 5H37A 2OARA 5H94A 4MNHB 5HBBA 3HNTH 4YSPA 1F86A 1HQRA 3KNBA 5IFAL 4N20A 4AEHH 3N44F 1HVVA 2DYSB 3VFSA 1TZOA 4X7DC 4ZUUA 1RIHL 1U95A 4PR5A 4JRWA 5D1XB 4GSRA 2F1BA 1VA9A 5DJ2B 3Q3DA 5JW5A 4P3DB 3BEVB 4XAKD 1NMCB 1UQSA 3TX4A 1SYSB 4KJYA 3QJSB 4L3ED 2BIQA 2Q86B 5TTRA 1RUML 2DQEL 4L73A 2H7WA 3WNPA 4ASWA 2AXGA 1ZVHA 35C8L 3DMMB 4UT9H 4RVBA 3ZN6A 3NPSB 3MLUL 2YBRB 5KSUB 1Y47A 4P57B 3F84A 2R29H 3AY4A 4Y4FA 1KEML 2YHGA 1BVOA 3W9DB 1JFQH 4XMLH 4HB1A 3V4PH 1T4WA 4JEGB 4Z78A 4DH2A 5CJ0A 2WQWA 3B7YA 2GC7C 3NZHL 1MW2A 5ISZA 1OP3K 5IESH 3D08A 4KDTA 2NT0A 4CVUA 5KANG 3V4PL 1OPOA 2AP2A 4Z7OF 2HG5B 1A7OL 4NRZA 3E3QC 4PJCF 1CQKA 5IQ9A 25C8H 3MV8A 3HRZB 1MOEA 3AG4B 3KPSD 2OI9B 4G6FD 2WAQA 1AHWC 3D69B 1XB8A 2JI3A 3V0WL 2WY3B 3GMRA 5E94B 1C9SA 3KHOA 4OIFA 2EEBA 1MFTA 3FUFA 1K05A 4X6EB 1ND0A 4PJEF 4BSJA 3GMMB 2AK4B 2YXQB 1X4YA 2F53B 2SODB 4Q9QL 1VFAB 5E2VH 3VXMA 3VFOB 4YZWA 4JVPA 1PU0A 1LEKB 3HEIB 3OHMB 1F6AB 4Q89A 1J8KA 3T65B 1M1JA 3VWKD 2B3RA 3RWCA 4ZMPA 5F7BA 2QLVB 1H5BB 1T83C 3B2XA 4ANVA 3DJZA 1A1NA 4YXKL 4FQIH 4HDIB 4LOUD 2FYUJ 4UCFA 1GC1H 1NZRA 1EZVY 5KLVE 3CC5B 5LNDA 1G1YA 4NQDA 3BEVA 2X4OA 3X3FH 4A63A 4M5YH 1OP5H 4X6DF 3KLAB 4KKNA 1C16B 4PMEA 2Y7LA 1ZV8A 4HS8L 3MRJA 4XTRC 3U83A 3TA3A 1SQBK 2APVA 1JN6B 3O4LB 1T1WB 4NSKA 1EHLH 5CHNA 2YA0A 3SOBL 4X5WB 2LU4A 1SQQJ 2X3CA 3W9DA 4UTAL 2YQGA 2WO3B 4Y19A 2MQGA 4WY7H 1ECZA 2Y5TB 1QLFA 2Y69B 4AGPA 3D50A 4PB0H 3FH5A 2MCPH 1V7ML 4ZFFB 3BQUD 3WEAA 5AFAA 2NY7L 5D1QA 4BKSC 4YLBA 4FADA 1ZE3H 4RMRA 3BRDA 1E6OH 2ZX9A 2EQDA 2ZJSE 3EWKA 4YFDB 1GY2A 3VMNA 2E7LA 3CXHJ 1I1AC 2JK5A 4M1DH 4KKLD 2CJUL 4OJCA 3GMRB 3IM1A 5E94A 1H8NA 5CBAA 2K78A 1AD9A 2K8QA 5APQA 3GF7A 1R9FA 4HS3B 2A06D 1DN0A 2EIEA 1NFDB 3QPXH 4YBQD 5CP7B 3VTAA 3D6ZA 4GQRA 1TOXA 1KJ2H 4CN1A 1MG3C 3V10A 3PL6B 1BG1A 2H47C 3B3BA 3DO3A 2A9BA 2F8IA 3KL5A 3ZY7A 4XVJH 1OM3L 1ED3A 4H8VA 5D1QD 3SY0B 1IKNA 3LPOA 2ZE0A 4ODHL 2OMZB 4DPRA 3JXAA 4NJ9L 3NMDA 1CZ8L 3LKQA 4XOCA 5D55A 5EEZA 1P7QD 3W2DL 4GT0A 1S7TB 1RK1A 1I7ZB 1XD1A 2H5UA 4WKZA 5GIRA 4PY7A 3TA3B 2NXYC 1E3ZA 2ADFL 3F00A 1BPLB 1KELL 2A0LC 5FLVA 1SM3H 1YSOA 3TNUA 4WBAA 1KIUB 3CZNA 3DMMC 4LCWB 4Z7QB 2GI7A 1MAKA 3CD6P 1I7RB 2KDYA 2L7JA 2B59B 2FFDC 1S5IH 2CDFA 1CBJA 3T2NL 3DI3B 4QRRE 2QJKB 5C7ZA 1QW9A 3H1KG 1S78D 3HLAA 2Q10A 1QKZL 2Y06L 4KUZL 4XPBH 1AIZA 1AFVL 2E8ZA 3EDEA 2C0XA 4JDZA 5I1CL 3NBNA 3BUDA 1KFNA 5J8OA 2HKFL 4UT6A 2IEPA 1OV8A 4Q58C 3PJLA 4HS3A 3OLEA 3IDJB 4YDMA 2WUCL 2JMRA 1IK7A 2XG5B 3BVNB 2FFDA 1JCDA 4EDXA 5ES4B 1HTLC 5HYSG 2Z31C 2IPTH 2AXHA 1X7TA 1M2VA 2D9QB 1KXQA 3FB8A 1SJEA 3GD1C 4XAWH 3X1FA 3VFVA 3Q44A 3BVXA 4HEME 1VIWA 4PJ7B 3DJTA 3KPSA 2WZ7A 4LHJB 4PGEB 4MMYB 3EUUA 2QHRH 3T2LA 2AXFB 1LO4H 4HZAA 3GS7A 2RJMA 2RCSH 1P2CA 5DK2A 4NI3A 2OK0H 3B6SB 1F6LL 3VG0L 1LVEA 3O3BB 1RK1B 3Q43A 4OF8A 2NPSC 1KXTA 4CDGC 3TF5A 3GK8H 4MHHI 3WS3A 1CYWA 5I2IB 1FV1B 3LNHA 4KRMB 3RWJA 3LRHA 4FP8H 4PJ0E 2KSJA 3ZVVA 2FIKA 1CU4H 3KYOB 3IAGC 3OX8B 3CC2P 1I7RA 3A22A 3U4BH 4X8JA 3NCWA 4BEIA 4HWBH 4UNTA 1JGDB 2COVD 5DI8A 1OWRM 2K7PA 4X7EC 3NEOA 4IFMA 3IJSB 4G43A 3BYTA 4YNYB 1L7IL 1RUQH 4ZYKA 1Z3GL 3U7WL 4Z7VB 1A9EA 1P7HL 2ZYDA 3OJVC 4KO5A 5J9PA 4L1LA 4F7EA 2J4WH 4YWGH 1Q94B 3BPNB 4CNIA 4C7NB 1W8EA 5D1QE 1T1ZB 2IXQB 1FPTH 4OCWL 4Y5XB 2G4EA 4C56B 3FYIB 2J4WL 3LEXA 4YWGL 4JFPA 5E6ZA 1F45A 2OJEB 3U1AA 6FABH 2ICEB 2A6IA 2VTFA 5AAMC 3QDJA 1BXXA 4JG0H 4LNRA 5F6HJ 3MBXH 3QDGD 4QRTB 1MHCA 1E9OB 1YEFL 3ARFB 1AC6A 2OX5A 3MBEC 2W9EL 3QXVA 1A02J 1C5BL 2DDQH 2WVTA 3VP9A 1HXKA 1F8TL 2V17H 1HNYA 1FZAA 3MGAA 5C0EB 3UAFA 2DDQL 3H1IG 4N2LA 3T0WA 3MBED 1GZHC 3PDOA 3X1BA 3HB3C 3OZ9H 5E4AA 4ZD3L 3EADA 3SKJL 6CGTA 3U6RA 5E4EB 5E8DH 1UOVA 4LVEA 3LZOA 2BOCA 4YQXH 1EXJA 2BX5A 2VGLM 1E0OB 3BPOB 3NACL 1L0NJ 4WI8A 5DHVH 3A21A 4LSTH 4FXKA 1YN6B 1HIMH 1G1IA 1MUJB 2IBZE 4GIFA 4ZMZA 1BE3G 3FFOA 1S6NA 4PREA 4QRPA 1TITA 3WMQA 3HZVA 2EDMA 4NWUH 4MQTB 1AO7D 4R4BB 2CIIB 4H8UA 2V7HB 3UYPA 6TAAA 5DWUH 3JTTA 1I31A 4XNQA 5T5FA 4ALAC 1MWAH 5FF6B 1YZZA 4WFGD 3F64A 2Z4QB 4K71C 5EZIH 5K1VA 3U36A 2YQ3A 5F3BA 1FFNA 1SMAA 2WSSH 1J12A 3GRWA 3CXHH 1W6LA 1HZLA 3WN5C 4NYLA 3LDBC 2WT7B 4AMXA 4IRZH 5MERB 1FC1A 2CWRA 2HB0A 1TTRA 3U7YH 2XKSA 1LXMA 2AJZA 5FHAH 2YEZB 4LF3A 4KZDL 3QAZB 4GNKB 4DOHB 1NKRA 1SOKA 3RUGB 3QARA 3FH7A 3WU2E 3FUKA 1KELH 2EXYD 1JXKA 4BINA 1EGJH 1J8HB 2A4EA 1QSFD 1JNLH 1CXIA 3ARUA 1L0LD 3JSVC 3CCMP 1RH5B 3KPOB 3PDOB 3N7NA 4N5UA 3T77A 3UROR 4KX9A 1UTDA 4CC1A 5TQ2L 4G9FA 4CGUB 1P84I 4H0GA 4WWKC 1A6ZA 1Z9OA 3D06A 3ZDZB 1MJJB 1QLRB 2B9AA 2Q7AA 3ABLB 4EN3B 1FSKB 3KVPA 1DZBA 3L72E 1MWAB 4FXKB 4X8GA 2XKNB 5IZ7A 3DGGB 2QV4A 2QKIB 2W1NA 4Z0XA 2VZOA 4PLNC 4N6JA 2Y1YA 4L05A 4XO5A 4L3EE 5EORH 3T1WA 4FERA 1UACH 1UADC 4QMEA 3X17A 3CDZA 5B8CC 3CXHE 3H32B 2DQDL 3VYOA 4PV8B 4Y9CA 1R5SA 3RUGE 3ULUC 1NOAA 2V5YA 4G8GA 2BNUA 5IVXA 2J7LA 3DIDA 1SQVD 3X14A 2WMMA 4PI0A 1AR1C 4M6AA 4JKWA 4RX4D 1R3IH 4Z8FL 2NUTA 1UH4A 1ZTXH 2F58L 1FH5L 3LNFA 1EAPA 2WIMA 4P2RB 3GHEL 3KHQA 1UXWA 2AERT 1RK0A 1FZOA 3A0BH 1SEBB 1TQTA 5KOMC 1DFBH 1EZUA 3B5TA 4ORGA 1FH5H 4LF3B 4AE0A 1E5BA 1Z5HA 4RKUJ 2MCAA 1DD4A 2GB2A 3GEWB 1IAKB 2WJ5A 4DO4A 3QDMD 3QDHA 1DE4B 4MQXD 2VSKB 2XCMC 2NY1D 2W38A 3BH8B 3BZFA 5DFAA 5CNHA 2Q8BL 3V6BR 4JM4H 2K70A 2W9EH 3JUZA 5KW9L 2FRGP 3LEYH 1LP9B 1MJ8H 2J8OA 4D8OA 3M0AA 2EO9A 1SYVA 4HEPG 3MNWA 5T33H 1IGCH 3EBGA 5FYKE 4MVBC 2CR3A 3IMUA 3MLXL 1AO7B 5F89A 3QNYA 4JPIB 1OF2A 4JUSA 3ARQA 1JUNA 2X09A 4XNZC 3H9SA 2E43A 1WBYB 3CBJB 3I3DA 2O6CA 2JB6B 3CSYB 1CCZA 2WXJA 1ADQA 5DC0A 3QWOC 2XN9D 3ETSA 1MRDL 3FT4B 1IGTA 3I50L 4ODXB 1XF4A 4IS6B 2K7QA 4MQ7B 3WAKA 3A47A 3KS0H 5CWSA 5SV3A 3IPEA 3WFBL 4BA0A 1I8KA 3VFMA 2WZPA 1JDDA 2V8LA 3ZKNC 3D39E 2XV2A 1OAZH 3LX9A 3MYJB 5FXCH 1A7PH 3NIFB 3SDAA 2VITB 4N9OB 1FO0B 2IALB 4XMVA 3C6SA 4GKZA 4NNYA 2PRRA 2UV3A 1DLHA 3DXAD 1Q9KB 5ESQA 2EYSB 1KCRL 2FD6H 2NX5E 5AG9A 4OAWB 1EJOH 2HTLD 4AZ8B 1HL9A 5KS9B 1JFQL 1H3TA 4YO0B 3ULUF 4ZK8A 2HKAA 4IEFB 5EEYA 4M4RA 1QNIA 4PJFF 3W0WB 4YX2H 2LLGA 4HZLB 1RFDL 5I76A 3F3HA 3OG6B 3SKMB 2ZYIA 3ZDMA 2E0PA 1NCDH 4AJ0A 3UJIH 4XOEA 3O4OB 1BCIA 3CMAP 2M8XA 3WIHH 4NZUH 3QPKA 5B4MC 3DPBB 3IDIA 4L76A 3STLB 4FQXA 4R2GB 4U3HA 3CHXA 4DP6X 3N43B 1D5ZA 1E40A 4L8DB 1WC7B 3O2VH 4JFSA 5IF0B 4NDMB 2JB6A 4WGWB 4JVWA 3FKUS 2VOTA 1IEBA 1WT5A 2WBJA 1HGZA 4IOSA 4MQ7A 2O6DA 3QQ3A 4PD4K 3MUZ1 1KBKA 1O9VA 3QIWB 5JW4N 2EIBA 3TYYA 4OJAA 2A6JB 4GOEA 1OSPH 3NJHA 1UC6A 2O6PA 2QPUA 3E1ZA 4Z7OE 2O5NA 1NJ9B 3OLGA 1ORSB 1V5JA 1INDH 1AP2A 1JD9A 4JKLA 3C6SB 3ARDB 4GKZB 4NNYB 3T4YB 3SDCA 4IGBB 4DK6A 2P58A 4WY4C 3P0YL 2Q7YB 2ITDA 4IMLB 4A7SA 4AENB 5C6TL 5TGBB 1AJ7H 1ZIBA 3BCFA 1VF5B 1AKJD 1HAWA 1I8UA 3C12A 5DO2C 3BGFB 1G0DA 4DGVH 2KQNA 3OR6A 1H6TA 2DM3A 3R8BB 3W0WA 1XR8B 5CSZA 2DMHA 2X1QA 3LZFL 5H4YA 3SWFA 5A2IH 2A9DA 1LTJC 2Y07H 5HPMA 4M3JA 2XWZA 1BECA 4TUJA 5ENWB 4Y8AA 4WEUD 3EYVB 4F8LA 5LDUA 2A73B 2DQCH 4JZJB 3VD2A 1D7DA 1QRNE 2W92A 3TIDA 5I23A 3BSZL 3IBOA 4YGVB 1PPIA 3GS4A 3QFJE 1QSFB 5GRUH 4QJ5B 5KVGH 4YSCA 1SMOA 2XTJD 3RK2B 2EICA 2TAAA 3IF4A 1KBPA 1AKJA 2VDKL 1RP9A 3LEYL 5D96C 4JZNA 4C4KO 2IPPA 1ESOA 5FUCE 2ICWJ 3H1LE 1N73A 1T3JA 2POHA 3II1A 1P5UA 1Y8AA 3NFNA 4R7NA 4XPGH 3CFTA 4I0KA 5MENB 2EIZB 1RL1A 3UP1A 2C9NY 3HI5L 3NABH 5E5MA 1JXDA 1U8OB 5ANMB 5IMLB 4G5ZH 5DJDB 4R26H 3HG4A 4W9CC 4J3TA 1PFCA 3EYUL 5AVVB 2KI6A 4EUPB 2EH8H 4YE4L 1CICA 1PCXA 5IQNA 2QGBA 3PQYB 3MXWH 1NFAA 2XZAL 3WG7B 4P8QA 1VQNP 1OGTB 3VXSD 3WNNA 1XF2A 3FMGH 1DQML 3RVVC 1JGEB 1ZLUK 4LVHB 5D72L 5L8LB 2IBZG 2FAUA 3TIEB 3OXSB 1U42A 1EUUA 4HIXL 1UXSB 3FN3A 2C3XA 4AQ8C 4JFDB 1ZVSB 4NKOB 4FQ1H 4XCEB 1JZHA 3VXOB 3JWNC 3WS6A 4AV0A 5HDBF 4GI8A 3MFFB 3O8XC 3TIDB 3S8WA 4TOYL 3BATA 1PG7L 1CTMA 3MLYL 2GAZA 3JTBA 1NUFA 1RV6X 1E4WL 3B5HA 2G3XA 2I7OA 4WRLA 1QNZH 4HUCA 4MA8H 5MP6H 3BCCJ 3W5MA 5ALBL 1NIDA 3BCCD 2NY3D 1O6SA 3UYRL 2HT4D 2D8KA 4ZT1A 4I89A 2YAHA 4LLWA 2NY4D 1I3GH 2X2HA 3L7EB 4QHNB 2ZT9D 5CFHA 2E6PA 5BO1H 1XCQB 2BINA 3UAJD 3ZKXC 1G1JA 3CE1A 5KVGE 4K4KA 1UM4L 1T7VA 3HNSH 3EFDH 5JHLA 3KJ4B 4G8IB 3HC3L 5AZEL 1RMFL 3VQ1C 1AAJA 3KZIH 1IFNA 1DP0A 2NZ1A 3SPVB 3LHPH 5D7SL 4NUPA 3I6SA 3UAJC 4ZMVA 4FNPA 4Y28J 1XF2B 4M6ML 1PTZA 4N0FA 4XNAA 1JNMA 3NZSA 1JV5B 5D2NE 2B1OA 3RY6C 3VWKB 4W9KC 4TVPE 1ICTA 4QXVA 2JKSA 4LGPB 4XMZA 4W7YA 3W9EB 2G4GA 4N0YH 1MCBA 3FTUA 3L9RB 3B9EA 2AKRA 4WWID 2JKJA 3IGAA 5T1DH 3SE4A 1G84A 5HD8C 4O51B 4JR9H 2HRGA 1TU2A 3MRNA 5E9DB 3X11A 4M7KH 3HUSC 2HRPH 4GRWE 4NS0A 4JF7A 2OCFD 4PSPA 3O3UN 4KGJA 4C57C 3S9DB 2X4UA 1P5VA 3GSNL 3K6SB 1KZYA 5GTIH 2YO2A 3BDYL 4CMMB 5ELIA 4N68A 3QXDB 5AW9B 5JPMA 4IIQB 4WNQA 1FCGA 3O6KH 4OFIA 5KSAA 1NCGA 1X5ZA 5J7CC 2JCCB 4RO0A 4OF3A 5F9WC 1NEPA 5B1AB 5IR1B 5HHOE 4HWUA 4GXUM 1U21A 4EI5C 4O02H 5I1JH 3VXTA 2XY2A 2BP8A 4HPOL 1TYRA 3RTLA 2Q3EA 4BRYA 5JO5A 3CFUA 2OMVA 1BF8A 1UD6A 2BLFA 3EF7A 4L1DA 1YBKA 4JFDD 1ZR2A 5IJBC 4ATTA 1BQUA 3MRGB 5HY9B 4K7PL 5A6MA 4OU3A 3PTZA 3QEUA 3VWKA 1IC1A 1I9IH 3LN4B 3T0XA 1H6EA 2LTQC 1KLUA 4RX4A 2H26A 5F96H 4AH2A 1HYSD 2GBAA 2HKHH 3BHBB 5I8OL 3V4VB 2K9JB 1OARH 2OXHA 3FTXA 4BWUA 4Y2DD 4YXLL 4NZJA 2ARJA 4J3UA 3TA3D 4UM9B 4FQHB 5BS0E 3IF1B 1ZHNB 1X5JA 4YXLH 5I71B 1EGJA 4Z3FA 2FQDA 4FKKA 1A6TA 1QTSA 1NTZG 4ODSL 2BRQA 4DF9A 3U9UB 1JTPA 3NRPA 1Z9MA 5CINL 4FD0A 3I74A 5SWZA 1WJ3A 2IDCA 1BJ1H 3D05A 3RNKB 2YMOA 2Y07L 3CSGA 5K59E 1YN7B 3BQUA 4L4TE 1AJYA 2Q8AH 1JXFA 3DO4A 3WKPA 4PJ9A 4X5LA 2VRAA 4M48L 1ZA3B 1RURH 1RUPH 5BMFL 4JQIH 3QEHA 2HAZA 1FS0E 2XQ0A 3SDAC 5JHDE 5GRUL 1F90H 2PWEA 2CLZA 3F5WA 1BJ8A 4WV1C 1FNGB 3L5XL 4HFUL 1T2KD 1FFPA 3MRKA 3GMLA 2R4RL 4M02A 4LCWE 1F4YH 4Z7QE 3QZPA 1ECYA 1V05A 2J6WA 2VSCA 3MV7A 4G1EB 1ODUA 2DJMA 2B88A 1WFOA 1XCTA 1L4AA 2J55A 3C6LB 5E8NB 1PAZA 2WZPD 2FGZA 5J5EA 4M7LH 1YQ2A 3I6LE 1YNTB 5KBLA 2A6KA 1FLRH 2HN7A 1A25A 5D7EA 3PWJB 3LZPA 4I5BA 2F8VA 2D03L 2G9HA 2K6WA 2PTTB 3R06A 4LCCA 5DJUB 2DLFH 3OPZL 2WOYA 5F9DC 1JY3N 3V4VL 3D3VB 4HG4K 3PV6A 1FFOA 4HJIA 1ZVYA 1A7OH 2XG4A 1ZANL 4FZ8H 5D1ZB 4WKXA 3TGUJ 1OTSC 5FKAB 1KGXA 4O2CB 1TSRA 1KQSO 2FJFA 3DV6A 5DD0H 3EJUA 4GIAA 2C4FU 3IDNA 4JGUA 1JRHI 2KSEA 2OTLP 1FZKA 3HZMA 4MJ5B 4AKPA 5KN5A 4LVHC 4I2XB 3BUYA 3DROA 4O9HH 1O75A 2OL3A 5KWYC 1KB9D 1BBDL 3MGOB 1YEGH 1A9VA 5SWZB 5BRZB 4PJDF 2R39A 2QVTA 4D3CH 3NCEB 5KSBB 4O2FA 5DS2A 4HF5L 2OFQA 4U6TA 3WL9A 5K9OB 1QUNA 3QCVH 3HS0A 4AC2A 3RFZB 1LJMA 4J8QA 3NCCB 2EO7A 4GW1A 3A67L 1NGYA 3FCTA 3V2NA 1RPKA 3F58H 1N59B 3TA4D 2FSEB 4XXCA 1AZRA 4IKJA 3E9UA 3I9IA 1BZ9A 4G7RB 2OGUA 3E1IA 5T5FL 1R19A 5JORB 5KVDE 1OVZA 2IF7A 5EUKB 4HSAC 4MBRA 3MLZL 3G6JF 1RIUH 2BP3A 4KI1A 1JE6A 3N5AA 3GXPA 3IRPX 2NCMA 4ZD3H 2LFGA 1F00I 2EILB 1XF3B 3CDGA 5GTHE 2AF2A 5HTSA 4B3EA 4M56A 5B22A 4N8VB 5L2KB 2Q76A 1OSYA 4LSPH 4E41A 1F8TH 3O6QB 1B0RA 1J1OL 1R3JB 1QWNA 3CXFA 5BRZE 3CFKA 2VUYA 4ENZA 4ANWA 5F0LB 1U33A 3BPLC 3KPRA 2IAND 5I73C 1HN1A 2IAMB 3RY6A 1KGJA 3AQYA 5GGRB 5T1LA 2ZOLA 5F7YC 2AK4A 4J3BA 4DFIA 1WWCA 4XCYB 3ZL4H 3T97B 5CJQH 3EXLA 3VXMB 2FYUG 2YMKA 4X98A 5HGAB 2CKNA 3QUKA 1QFOA 1UH2A 3LNDA 1AR2A 5L88H 1EXIA 1VF5C 3CCLP 2OL3B 3GI9H 4XAWL 2K37A 5EO1A 5F7DA 4PJ6A 3L5JA 1D5IH 1RMFH 2HX9A 1XEUA 3O45B 1X7QA 4Q7DA 1BX2B 3Q5PA 5T1DL 3CC5A 2VR6A 3BIBX 3EH5B 3SJVA 1GMJA 3FO1A 2VXVH 4QHUA 4N2CA 1DCLA 3S4RA 4XBMA 3D30A 1X5XA 4TM9A 1QRND 1N59A 1NIBA 1M6OB 3D4YA 3HI1B 4Y5YA 3RGVA 4ZMAT 3F7PC 5CU5A 2RAMA 1G1OA 4K9EH 1JZIA 3RGBA 3DUSB 3RYMA 1GMIA 1MFBH 5HXMA 3V6IA 1M9SA 4WDIA 2GHZA 1F41A 1BXUA 1JV2A 2J25A 4ILDA 4R26L 5GRYA 3I55P 3WJLC 3MLSH 4AIOA 3VXME 4RRPG 1EEUA 1EZVI 1LWHA 1U58B 1QW8A 4NHUB 2R69L 2XRAL 5E08L 3O6QA 5DZJA 3P11L 5F1NA 3OVUB 4S0HA 1ZEAL 2QHRL 1BSHA 3QH3B 4PD4E 1MZZA 4BHUA 1UJ3C 1FGNL 4JFEA 2MOGA 2ZOUA 1AHKA 4K5OA 3WE6B 5IJDC 4K8RL 1IEAA 1NU1D 2R1XA 4HIXH 1IM3A 2YKPA 4NKDB 4RCAA 5A6LA 4XCYA 2BIPA 1CFMA 1U7JA 2YWZA 3NJFA 4ZO8A 4EIJA 3JWNE 3UTSB 4E0RB 2LABA 4OCMC 2C9RA 2O61B 3B5NC 3V6FA 4GSXA 2QKSA 1MNUL 2OL3L 1RUPL 35C8H 2L91A 4JBZA 3ZRCC 2FX7L 2QQLH 1AFVH 5C6TH 3CIAA 4EI6B 3TN0C 3SDXA 9CGTA 4G8EB 3IGKA 3KVDD 4I6MC 4FYQA 2YR3A 1A7NL 5J3HC 4QXGH 1MFEH 2AEQL 5F7KC 1BJMA 3QGVA 4WO4A 1N3NB 3CN4A 4M1CC 1PPJG 4IOSD 4HT1H 3L1OH 1TXKA 4M6NH 4NOBA 3UG3A 5E6UB 2NNAA 2WSFJ 3MI6A 3VGAC 1TT6A 1Q82Q 3TGXA 5I17B 4U0QB 4XGZA 2XNAB 3ZQWA 3ULUH 1CTOA 1CL7L 1S9WA 1B0IA 2PCPB 1G9NH 3A4EA 1CSBA 4P23D 2C26A 2BNQD 4KI5F 2VO8A 4RFNB 3ECBB 4G6KH 3H3BC 3GJEB 5I1IL 3PWVA 4KV5F 2L0DA 3LKSB 4OLUH 3AADB 1N2RA 3PUUA 3UTQA 3BAJA 2XWTA 2YIHA 4Z7WB 5B3NA 4LVNB 4EDXB 4LLUB 1BCCD 3BUIA 4DJMA 3RPIA 4UDTB 4X6FB 4BH8A 2ADIA 2X3AA 4P2QA 2HUEA 1DQLL 2HJFB 3SQRA 3L3HA 3KG5A 3H7BB 5DEFA 2KLRA 4OCXH 4NO2B 5T5NG 1GYAA 4PJAA 1KIRA 2Z31A 4XMWA 2C9LY 4HQQL 1KTRL 4G42A 1BQLH 3NUKA 4GS7C 4M9OA 4POUB 3W39A 2CUMA 3TS8A 5J6GB 1C5DA 2MQ0A 1L6PA 4ZX6A 1N3NA 3IAQA 4FG6D 5F7FA 5B8CB 1G0XA 1PG7W 3R4RA 2EUWA 4RRPA 4HHGA 4YHIB 4NFBA 2GT9A 3QZLA 2XV5A 3DRTA 4H8QA 1KFMA 2VDQL 3FT3A 3GSXB 1BWWA 2DQ6A 3PJSA 1U9KA 4FXKC 5ESVB 4HISA 4HWBA 4PFEA 3KPEA 1HQRB 4MB5A 2FYYA 3RY5A 3TBWB 1R5IB 3AREA 3TT1L 1SVFA 3ARFD 3LN9A 3ZT5A 4I3RL 1Z1WA 3UGEA 4LEBA 3DWTA 2ZJSL 2EDQA 3HG1B 3LXAA 3TGUE 1WS7A 1XZ0A 4ZW7A 4H13C 2HFGH 4APQB 2OA9A 4IRSD 3AEDC 2XKUA 3PABB 1LT9C 3EFFK 1IU1A 4Y4HB 2GJRA 4ZAKD 1WD9A 2VNCA 1KGYE 1U8QB 5HDBE 3BXNB 1MFDL 3QR2A 4UUJA 5EC2A 3PWPB 5CZVL 3BT2L 4AYCA 1SQQG 5DD6B 4MX7B 4K5LA 3H3KA 5CUSH 5DDHA 4P59L 4GSDH 4Z78B 3MRCB 5L4FA 2VUKA 3IDXL 4JFED 2P4AB 1GTFA 1T1YA 2MSPA 1KCKA 1W9XA 4NNPH 5DD1L 4BE6A 4Z7NB 3BEWB 4G42B 2VLMD 2ADJB 2VL5A 4J2QA 2WIIA 4KNUA 1BCCG 3LRSB 1CGUA 4IOIA 4CVWA 5HSFA 4PJ9C 1HHKA 4XO4A 5EOQL 3KLQA 3FN0H 3HD7D 5AVXB 1EMTH 5DMIL 1XQ4A 3QORB 5ADPL 1EZVD 4Z6AT 5ESAA 3ZMRA 1TQBB 1PD6A 4PY8J 1NBZB 4FFWC 1SBBA 1QBML 5HHVL 3T3PF 4DO6A 3AE9C 3QQXA 4L2YA 5AYTA 5IVXE 4PJ9D 4NQDD 3TFKC 4HXBL 3PJSB 1RVFL 2YAFA 3R1GH 4F5CA 1FIGL 4BH7B 2A74C 3HPJB 3ABKB 2GY5A 3LIZA 4B60A 5CEYA 4KNQA 1M56D 5JQ6H 4L4VB 1VCBC 3NSFA 3HZVB 3MMEA 4FFYA 3UPAA 5EU5B 4DZOA 3CFJB 5D2LB 4RWYL 5LDSA 4HSCX 2J3SA 2HH0L 1BV8A 1ZT1A 4LHQB 4FKEA 4NQDB 3GI8H 2HVKB 3L70E 4CU6A 5IG7A 3A0HH 4CBZA 4JANB 4E42A 3LIZH 4RDBA 4ZUWB 2GK0B 5DFTA 1YYLH 5MERA 4HIEB 3VYNA 1NPUA 5T1JA 3GXTA 4BSVA 4KZ0A 1SMDA 3VYIA 5AOIA 3Q1MA 5DJ0B 2OYPA 3LW5H 2X70B 1TZGL 3VMPA 2GCYA 2AQTA 3T8MA 4YDIL 2A9NH 1QQDB 2QSIA 1FYHB 3L2MA 1U8KA 4GT7A 4OD2B 4OKVB 1L0NG 32C2B 2JKLA 2Z1KA 2L4OA 4Y5XC 4NC0B 4L9LB 3SYCA 4UZGA 1NLDH 4LCWD 3RI5F 2BZCA 5AW0B 1J9RA 2QTEA 4AQAA 4AQ8A 5I19H 3KZ8A 3FQTB 1KC8Q 3EGXB 1P5UC 3ESMA