2ZXEB

Crystal structure of the sodium - potassium pump in the e2.2k+.pi state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
b'RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium - potassium pump at 2.4 A resolution
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 51
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zxeB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 2zxeB02
5APSA 5APXA 1H88A 2XZRA 5AVVB 4AUWA 1JUNA 2XV5A 3HE4A 1A02J 2Q3IA 3M91A 5APYA 3TYYA 3HE5A 5APWA 1GU5A 3KQGA 3UIAA 5AVRB 3MD0A 5AVSB 3IR9A 3NFQA 4AQRD 1SLQA 2WTYA 5AVXB 5AVYB 1GK4A 3LIEA 3A7OA 3HE4B 3P7KA 1JNMA 1HJBA 2ZXEB 3OAKA 4GT1A 5AVZB 3MGNA 1NAFA 2P7JA 3HTKA 4HYTB 3HE5B 1GD2E 3I5CA 2WWWA 4I6MC 5AW5B 1GZLA 3VMYA 1NWQA 1HWTC 2VRSA 5AW9B 1HBWA 2YO2A 3A3YB 5AW3B 3TNUA 3VN0A 3V5BA 3SWFA 3L35A 1CI6A 2WPRA 2WPQA 4GKGA 4LC1A 2R3CA 3TK1A 5AVWB 3O8ZA 4JYCA 1T2KC 3P8MC 1GTWA 5AW6B 3VTPC 2H7HA 2Q5UA 3KDPB 2R32A 3M9BA 1X8YA 5APVA 1IO4A 1G2CB 3LIDA 5AW0B 2IPPA 2XU6A 3TNUB 1S9KD 1FOSE 1S9KE 2QM8A 2C9LY 1HUCA 4M3LA 5CMZA 1MUUA 3M06A 1YYCA 3T97A 3V4QA 4AYCA 1J2JB 4I2LC 1H8AA 1DH3A 1CZQA 3NXSA 4KHXA 3NTNA 2E43A 1FOSF 3L37A 1OWAA 4C46A 2Z5IA 3V4WA 3P32A 5AW8B 4XE5B 2KP8A 2P67A 3NMDA 5APUA 2P2UA 5AVUB 5AW1B 5APTA 2R5DA 2WT7A 5AW4B 5AW2B 4RETB 2E42A 5AVTB 3L36A 4C7NA 3WGUB 1CI6B 4EOTA 1FAVA 1GU4A 4DZOA 2Z5HA 2R5BA 3M9HA 3VMZA 2WPSA 2QM7A 1KQLA 5AVQB 1A02F 2WT7B 1MFZA 3A2AA 4C7NB 5AW7B 1H89A 3M0DA 1T2KD 2W27A 1MV8A 2BASA 2Q7CA 2ZFCA 2C9NY 1CSBA 3A5TA 2YNYA 2JJLA 2YO3A 4B86A 1SP4A 3VYIA 4JYBA 3M0AA 5APQA 2N9BA 3VMXA 1OXZA 3WGVB 4RESB 1GK6A 2W6AA 3B8EB
chains in the Genus database with same CATH superfamily
1NMCC 5E2JA 5T5FH 2XBTA 3IEAA 1MF2L 1IGIL 2A5UA 2J55A 1JN6A 4TKWA 3SPCA 4UB6E 2BINA 4LEXL 2HTLC 3M1BB 4MCMA 2W1NA 5BU5A 5E99H 1DBJH 2H2SD 1H3TA 5DI8B 1C08A 5DT1L 4DVBB 5E2TL 5T1KB 2K8QA 2YMXH 1XDTT 4WCYH 4L3CB 3STZB 1JNMA 1WFTA 1U3YA 4UTBH 1AGDA 1X5JA 2CE6A 2ZCHL 1OLLA 3WO3B 2OMYA 2Y2TA 1ZE3H 3QJTB 2E3VA 1IZKA 1AGBB 1UURA 3DDFA 5D2NA 1RVFH 1GJIA 4KXZI 1UZGA 2YO2A 3BLKA 3O9WC 4WI0A 4E41E 1K04A 5J0BA 2OMZB 3X1GA 4PGDA 4G9FE 3JQOB 4QXUL 1TFPA 3W0WD 4O9BA 3VTPC 3MRLA 4FFVC 2FATL 5INDA 4PBWD 3FB6B 5I0XA 2YPLB 4FI7A 4G43B 1FZCA 2Q3ZA 4NJAH 1DCLA 1BGYG 4MJHA 3NRQA 4GOFA 4NQDB 4R4ND 2CA4A 5CBEB 5FM5M 4AV4A 4XPTH 3B4NA 5GRVL 5FR3A 5CEYB 1J0KA 2O6CA 3P30H 2FJFA 2EUZA 1NFKA 2HKHH 1BQRA 2W0LA 3QG6B 5E7BA 2YK1H 3VI3F 2WM0A 1HZHL 2BOCB 3TF4A 5AZEL 1TVBB 1FH2A 3T1WA 2W92A 4I2LC 4JDEA 1OCWL 4GIPD 5BZDA 3U4AA 4U31A 2VLKA 2QEXP 2XQBL 3H3BC 2PGDA 2UZYB 5IY5B 1MDTA 1LO5B 2ICWJ 3DX2A 1JG9A 1T1YA 2K4WA 3AMLA 5C9JA 5ISZB 1JWSA 3RTLA 2XJKA 4PJCE 2P5ED 2X9ZA 5BO1H 5DFVD 1OOWA 5A2IH 2XNAA 4N0UA 5APTA 4A38A 1KB5B 4PB0H 2YD4A 1NZRA 2VXSH 1FZBA 3ZDYF 3PDDA 4X7DC 2RCSH 3QJUB 4K9EL 1JOCA 2XZCH 3BIAX 4K7PH 2QJYB 1B4JL 4NQXB 1R1CA 1SM3L 2ZX6A 5G4MA 3WTUA 1IAMA 1IJNA 1T1ZB 4FFTA 4P57B 3VH8G 4YDJB 5IBTH 2ZQKA 1A2YA 1MRCH 1NU1D 2Q8BL 3MUUA 1J86A 3NOIA 4IL6X 3CZEA 4XOCA 4GSXA 4XMXA 3TJPA 2NX5B 2NUPA 3RGHA 3CFBA 3NA9L 4U6YA 4L2YA 4BSVA 5EC1B 2BZDA 4E5XB 3UIZA 3SO3C 2QTVA 1YPZA 3M88A 1SY6A 3PP3K 1OP5H 5BU8B 3S3JA 2CJSA 1JRHI 4PW9A 5HTSA 5F7MC 4BRYB 5I2IB 2JCWA 2X09A 2HVJA 3ATFA 2WMPB 5CD5D 2DLHA 5AEAA 1HU8A 4FEMA 3U4EA 4D0BA 1AACA 3JWNH 2EYRB 2V2XA 3L3IA 2QQNL 2OYHB 2WGNB 1QFHA 3OKOA 2CLVA 2F19H 4MLSA 2Q3IA 2ED8A 2ZP9A 3RX8A 1S5LX 5DJ8B 1NGQL 1EZVE 1OP3K 3C9IA 1NUGA 3BPNB 1XCXA 3NFQA 1GL2B 1AO7E 4LP4A 4RMBA 4CGUB 3RGBA 1NDGB 2Y1AA 1J48A 2FZ3B 3D39B 5FA3B 1VLXA 5JOPE 3DMMA 4GKLA 5CGTA 3X12A 5C0AD 2EIEA 3MJ7A 4FG6D 2MNWA 2P24A 1HWTC 1OP9A 1Q72L 3CXDL 5ANMA 4P04A 4I77H 1U8IB 4JF7A 2G60L 4OCYH 5I30H 5ITBH 3LMJH 1T6BX 1CE6B 4XVTH 1EEUA 2NY0D 1EZVY 4ZZKA 4AYGA 4GQZA 2YFOA 3U83A 2E27H 3PAYA 1FIGH 2L3BA 2UV3A 5CGBA 4GQ9H 3ZJAA 5JPMC 3BZDA 3ARFB 2BCKA 2AJYL 5HGAA 5DU7A 4XXWC 1L0LE 1URQC 3OX8A 2OK0L 2LGNA 2AHIA 5F9JA 3FO1B 3V0WL 2GPZA 2UY7B 2EACA 4PRDA 5JA9A 5F97E 2XPGA 1IGCH 4WV1B 4MJ5A 5INCB 1PKQE 1HX0A 2HT2C 3DX3A 5BV7C 4XN8A 4ZAKC 5LBSL 4JNXA 2K9YA 4G6FD 3UAJD 3QI9D 3UTTD 2K6WA 2OW6A 4C4KO 2H0JA 4FQLH 3O8XC 4XP4L 4WZ9A 1FNEA 4N9GA 3RL0C 3KPPA 1LP1B 1DANT 4JKPL 5E6ID 2N1KA 1PTZA 3IN6A 1S46A 3DURA 4UAOB 1P6WA 2F2HA 4FXKC 5I26A 3U4BH 3OKNB 4PJXB 4OGAC 1NM4A 3V7MA 1GTNA 3CCJP 1ZDSA 3AY4A 4I2XB 4KRPB 3ILPB 4PLKD 3DWTA 2BIOA 3LSOB 1KORA 2AQ2A 4PJCF 2VH5L 3JV4A 1Z5HA 1WCBB 2QKSA 2CGRH 2X3CA 3DK2A 2VABA 2JKSA 2Y2YA 5DWPA 3L3KA 4QF1B 5C3TA 5A6MA 1GW0A 4KKNA 2VR6A 3Q6GL 1J18A 2QVMA 4YDVB 4UT6A 4M93C 1X3DA 2DQGH 1U8HB 1CD8A 3QUGA 3KXFE 2E75B 3RDTD 3DHUA 1PZ3A 3GBML 1JE6A 1S9XB 2N7BA 4XMWA 2XNXA 4PD4D 5C9KA 1SHWA 5DFTA 3CCQP 3FT1A 1VQOP 4UZGA 2DPKA 3GIVB 1IGIH 2YUZA 4W4OC 4N5UA 3IJYB 4DVBA 4LEXH 1N18A 3RA7L 5A7BA 1I8KB 5T1KA 3NRPA 5HY9B 1I7ZB 1TQCB 4L3CA 3STZA 5DT1H 5EOTB 2ZOKB 5H4ZA 3MYJB 4FG2A 5E2TH 2D03L 1RY3A 2A45G 2I5YL 5HVGB 4XBEL 4R4LA 1AGBA 5ILTL 4F7EB 1HYSC 2WLJA 2XY2A 4UB6H 3UTPD 1MWOA 3K5SA 2ZCHH 3IMTA 1ZOXA 2OMZA 5DZOA 3IMBA 2J1YA 2DM2A 4W9LC 4AIOA 1ORQB 1WEJL 1H0TB 2PXYB 2ENQA 3FB6A 5AW5B 5DMGC 2YPLA 3DIFB 4QXUH 2IEPA 3X13B 2E7BA 2FATH 1KILC 4NQDA 2KNCB 5CBEA 2OMWB 5EA0L 5CEYA 5JW3L 4X8JB 3S4SB 1IJDB 1UUSA 2AEPH 3CPLB 3QG6A 1MN4A 1USEA 4G7VL 1JZ3A 1OW0C 35C8L 3VW3L 2WN2A 1DEEB 4G5AA 1N7LA 4LPYA 1KCSL 3RIFK 1TVBA 2E5YA 2XDHA 2CWRA 3FB8B 4R7VA 4K23L 1Q90D 4NPDA 5J11B 1HZHH 2Q86B 4X6CB 3SDAB 3FWLA 2UZYA 1MFEL 3GZPA 1LO5A 1RIUL 4Y1TA 1BSIA 3II1A 1OCWH 5ISZA 3RB5A 3NZHL 4GFXA 2XQBH 2EDEA 1JZJA 3DIDA 1TJGH 2YIHA 1T04B 4LSTL 4H1LB 3R7RA 3S34L 3Q5PA 1JCVA 5I82A 1J9TA 1KB5A 4GRWE 1GC1C 4R3SB 2DMCA 1DZ0A 4ZRGA 2MJWA 25C8L 2XVBA 5ABAA 1LTTC 2NY1C 3H1HD 4HGMA 3Q1MA 2PUQT 1LT1A 3ARQA 4NQXA 4K35A 5IFAH 4U7JA 4PJAB 1IX2A 1ES0B 1B4TA 1EO7A 3VFNA 1YJ9P 1IC0A 1T1ZA 4K9EH 4P57A 4YDJA 1T7XA 1SM3H 1WZKA 4XX5A 2K9JB 4KKPA 1MY5A 1WD9A 5FGBA 4G7SB 5I74C 4NAMA 5F7KC 3TEWA 2JIXD 2NX5A 5A2KH 1SQPK 2KZKA 3HIZA 4UOJA 2Q8BH 5AD0B 2PWHA 5EC1A 4E5XA 3QS3A 3F64A 4P2OB 1WP6A 4O58H 3V2NA 2YGPA 4BRYA 3NA9H 2AJZB 4Q58C 5TF1L 4BWWA 5I2IA 3VXSA 1CL7L 5LN8A 2WMPA 1CSBA 3F05A 4R8WH 5E1QA 4BELD 1T20B 2EYRA 2WQXA 4JKLA 2OYHA 2Y69B 4KX9A 3OSVA 3D07A 4RFOL 1OX3A 4P2QE 1UA6H 4PRHA 2Y4SA 5BMFL 2FK9A 5DJ8A 4L4TE 3T08A 3EH4B 2EE6A 43CAB 4QRPB 1GL2A 1NGQH 5HHPB 5CSBA 1NDGA 3FAWA 2FZ3A 3VMNA 1AKPA 5FA3A 1EWHA 3TBWA 5G55A 2XI9A 1WG3A 1I1RA 1IFRA 2Z64C 2VLJE 3CVBA 5D55A 4AEEA 5JXEC 2YXMA 1SQBD 1C12B 2ZXDA 5I16B 1U8IA 3NK3A 4KMTL 4KK8C 2ZG3A 3HBZA 4M7ZC 1MHEB 2VN6A 3CX2A 1CE6A 1BCIA 1Q72H 3CXDH 3FT2B 4NZRL 2CLRB 2G60H 4ZO7A 4C56E 4QRUB 4W70A 2O01N 5CO1A 1SN0A 5TE7L 5TK4A 3ARFA 3WG7B 1RZ8B 2KPNA 2YKQA 2WQ8A 5KAQF 4ZO6A 5D1ZA 3TVMD 2LVCA 4LBEB 1QI4A 3NUKA 3FO1A 1EJ6A 2AJYH 3L3OB 3GI8L 2AVFA 2UY7A 3RK2D 1EXUB 4OAWB 1KXVC 4BWTA 2OK0H 5K9JL 1WRGA 4NQCE 1SF5A 5INCA 3EDKA 2OR7A 4K7FA 3D48R 5TK2A 4OF7A 5T3XD 4H2CA 4ZFZB 4IRJB 1RP9A 1FVDB 5LBSH 2EDYA 5CMZA 1JHLL 4QNPE 3DI3B 3OZ9L 2CUMA 1LP1A 2WWKO 4PWKA 3PAZA 1XBRA 3MLTB 4XP4H 2CDGB 1N3NB 1JVLA 3OKNA 3F04A 3L9RB 4PJXA 1LEIB 1RLBA 2Z35B 2FE0A 4I4WB 4PS8A 2Z5IA 4I2XA 1DHKA 3ILPA 1RH5B 3HKZA 3LSOA 5ICYB 4U6XB 1IBDA 4HKXB 1P9MC 1WCBA 4NZFA 1SQVD 4CNIB 5L4IA 4L1TA 4OZFG 3O4LB 4RZKA 4QF1A 4Y19D 4BDVA 3H3PH 4FKEA 1THAA 4GRWF 1TJMA 2ZOUA 1BQLL 2GSGB 3FS9A 2KLVA 5I1AB 1U8NB 1U8HA 2PTTB 4UDTB 4FQ2L 1RZKL 4WO0A 3B2MA 3Q6GH 4UOQA 4MA7H 3KLHD 4NKIL 1S9XA 3G9RA 1FYHB 3MNVB 1B9KA 1J8RA 3BKML 4YHZH 2WSEJ 3D3VE 3GBMH 4M6NL 3H25A 3GIVA 3ZZ1A 4O2FB 3L74J 4LP8A 3OC8A 3CLFH 2P45B 2XN9E 4GBXB 4TVPH 2EIMB 1EH9A 2LR4A 4Z0XB 2OTKE 1I8KA 4BE6A 1Z9LA 2EXWC 5HY9A 1I7ZA 1UOKA 2X4UB 3HUJE 5KWYC 1N7SD 5EOTA 4C57C 2ZOKA 1RK7A 3MYJA 4FDWA 4GQPH 3RA7H 3WEXB 4WFFD 4DFHA 1X9QA 1Z7JA 2X4RB 2VQ4A 2HLOA 1YA5A 4F7EA 3TGUD 2YR3A 3KL5A 4MAUH 2XYBA 2I5YH 4JG9A 1PLBA 1I82A 2A4ZA 5D7SL 1YHQP 3RTQB 3IJ7A 5ILTH 1D5MB 3NZ8B 3F65A 3TN0C 5I6LA 1F42A 1IKNC 4YIQB 1ORQA 4FYTA 4HJ0D 1H0TA 1OALA 4HJTA 1T2QH 1M9SA 2B20A 3DXAD 3W9EB 1RZJL 3HNVL 2NY2C 3DDGA 3X13A 1PPJD 1WEJH 5KTEL 3R4RA 2KNCA 2MQCA 4LF3B 5I1EL 5CCGD 2NSQA 3AREC 5FDWB 3IDUA 4BZ2L 3O2VL 1UXLA 3QR0A 3S4SA 3H3KA 3VU1A 3V2RA 1PGJA 4ZFOB 4CDGC 5SWSE 3QO0B 3AM8A 4G1EB 5EA0H 4B9IA 1AGEB 4D6TD 1DEEA 3GBNL 5JW3H 1HVXA 3ARZA 5DO2D 3MLWL 4XI5C 1GMJA 4LU5L 3FB8A 5GS0D 2GTQA 4G7VH 3H9SD 3BCFA 1AIFB 35C8H 3GIZL 4NO5B 3TK1A 4ELKB 3L71E 2Q86A 1KCSH 4X6CA 1Z9NA 3SDAA 1T0PB 3UJIL 1TQVA 1HCYA 4FL4C 4FLHA 2MOQA 3QA3A 1P1ZB 3T6XA 1BXVA 5EO1B 5DRXB 1T04A 1VFMA 1MFEH 1RIUH 3U36B 1OGAD 4H1LA 1WUNT 5DVOA 4IBLT 4LSTH 3P8CE 2X9YA 1KGYE 3S34H 2EDMA 2QM8A 3X3GL 1BD2E 4NBZB 4P9HC 1JIBA 1JZFA 1GW4A 25C8H 3ZTNL 1ZP0C 2XNDH 2Y0EA 3OHXB 3W68A 4G8GE 4PJAA 1NTZE 3W38A 3WY1A 4PW4A 3T2PA 4MAYB 3HW7A 4Q2ZB 4HHWA 1QUNA 4A2EA 2K9JA 3DRTB 3E38A 2L7UA 1U2YA 3VM7A 1NLDL 4GRWH 1BYOA 4MZIA 4TLSA 4M29A 4QNPF 2LTQB 3CXHK 5MP6H 4DGYL 3ZE1E 5AD0A 1A6TB 2VJ8A 1IC4H 4PSPA 4Q6IC 4G6KL 4LOVA 1DQTA 3FO0H 4P2OA 4CMHC 2A99A 4WIQA 3KWWB 2AJZA 1AS8A 5I5IA 4B9YA 1JPSL 1T20A 4X5QA 2JCCE 3BI9X 5TF1H 3N7NA 3RVTC 5EF1A 5IHZA 3WMPA 1QSFD 4GKOA 4Y5XA 4XWOD 5T1DL 4WU7B 3LB6C 3FTGB 4KK9D 2Q9IA 3QIUC 1V8HA 3K2MC 3QDAA 2BIPA 2VDQL 3U7YH 3HG1E 3BMWA 2HMID 4UI2A 43CAA 5HHXL 4QRPA 3WFBL 5BMFH 5CCKL 3F6IA 3M45A 4JFEB 3RZCC 1SXBA 1UENA 4JG0L 2IMNA 5HHNB 1EUUA 3KPRB 1BCCD 5IQ7L 1C12A 2CGYA 4JVUA 4TV3A 5I16A 1H3PL 5B8CB 3LN4B 1JZIA 4YHPB 4GRMB 2ATKB 4MBRA 4FKHA 4F37F 3HUJF 3KBFA 3GSNA 3FT2A 4QTHB 3RAJL 4S1DD 4QRUA 3NEXA 3ZDWA 1KELL 2OP4L 2K1AA 4NZRH 3V0DA 3NJFA 1XMWA 1H8OA 3MTXA 5TE4L 1NANI 1EERB 4LBEA 4KX8A 4Q6KA 5TE7H 4G11A 4BQ8A 3L3OA 4YXHL 1AJ7L 1EXUA 4NWTL 5EEZA 2LFGA 4OAWA 5FF6B 2IQ9L 1V7NL 2EVGA 5F89B 4ZMLA 2HRHA 5E03A 3GEFA 3GI8H 3PU7A 1V54B 2Z1KA 5ES4B 2R0WH 5K9JH 1ROCA 3N40F 4ZFZA 3MRCB 2FX7L 1WK0A 3BUYA 3HI5L 1YG9A 4IRJA 1UG9A 1FVDA 2IAAC 2XG5B 3SKNB 4W9KC 3UBXI 1F58L 1PZ2A 1F4XL 1PZAA 1YEWA 1AY1L 3ARRA 4PREB 5AAMA 1JK9B 1ZT4B 3MLTA 2CDGA 3LH2L 1JHLH 1FYTB 1JTPA 2ZSWB 3OZ9H 3L9RA 5GZNA 1LEIA 2Z35A 2EE2A 4I4WA 1S5IH 2D7MA 2VDKB 4FZEL 1SS1A 4PJIF 4Q14A 5ICYA 4KVPA 3NJHA 4OCRL 5B38B 4U6XA 4Q4IA 4HKXA 4NQUA 4JRWA 4CNIA 4WF7A 3O4LA 4B96A 1G5AA 5BPPA 3NA4A 3BP5A 4LVHB 2F08A 4MJ4A 2GSGA 3B56A 2BS9A 2EIKB 1AD0B 3L5HA 1RUPH 5I1AA 1QG3A 1U8NA 3N1GC 4R2GD 5J57B 4NN7B 1KUMA 4NFCA 2PTTA 3BISA 4YBLC 2WWMD 4UDTA 1P5UA 2A77L 4IGBD 5K59E 1OKEA 5KLVJ 1ETZB 2OL3L 4EF3A 2WHVA 3MNVA 2R23B 4FQ2H 1RZKH 4Y7MA 5IBUG 3T3PB 4WW2C 4IK7A 3IJEB 1DN2A 3QUYD 3MUDA 2ZUTA 4KXZH 3NCYS 4WO4C 1S7RA 4GBXA 1CLYH 1JPTL 1HL4A 1Q0XL 3OXRB 4Y5VC 4KZCA 4Z0XA 4M6NH 4DP9X 3O6ML 3B5NC 3BGMA 5B3JE 4XN7A 5JZ7C 2OZ4A 4FS0A 2BY2A 1ANUA 2X4UA 3C6LC 5EOQH 1VQ6P 5HGDA 3WEXA 4KHTL 4P06A 5LBGA 3V5DB 3IJSB 2X4RA 4GUOA 1KGCE 2J8OA 4NERA 5E9DB 2C3VB 3ZKMC 4AK2A 4FABL 2I1JA 3RTQA 1T5WB 5J13B 2FCBA 2NY0B 3PFUA 1D5MA 2OYMA 3NZ8A 4YIQA 5I6PA 1JVOA 5DA4A 3ET9F 1NLBL 5D7SH 4AYEC 1Z9PA 2WKOA 4FYSA 4ZUTB 3W9EA 4FNUA 2PAJA 2Y0SA 3N9GL 2IV8A 4XMKH 4LF3A 5FDWA 1L9OA 3I6SA 5C3LD 2D7QA 3T8VA 1N0XL 3DJTA 1RZJH 3HNVH 5KTEH 4DP4X 4WY7L 4ZFOA 2IOOA 3QO0A 3MHVA 3QJXA 4G1EA 3K6FA 1AGEA 3BCDA 4C55A 4BZ2H 5I1EH 3O2VH 4LSRL 5KJ7D 4PJ8D 3IFOB 1I1AC 2E9GA 1KN7A 4NO5A 1AIFA 3GBNH 1DO5A 4ELKA 1XSKA 3RP1A 3MLWH 4NKMB 4N0RA 3O3DB 5BV7L 1NMBL 1DVXA 2E5EA 1P1ZA 2VT0A 1GA2A 3GIZH 2ZXWB 5EO1A 5DRXA 3UJIH 1WPCA 1XXFC 1WHOA 2H3KA 1JPGB 3U36A 4M6ML 1OANA 3K6SB 3GXNA 4K8RH 3L74G 2F58L 2VITB 1FIEA 4WKZB 4AKOA 4XR8C 3O8ZA 1NCHA 3V5KB 1X7QB 4U1KB 1SUJA 4LLQB 1W72L 1GDTA 2C4FT 3BQUD 3Q1SH 1AOZA 4O02H 3VFVA 2E9IA 2NQDA 4YBHA 3OHXA 2W83C 3C5JB 3X3GH 1C8QA 2P80A 3AVEA 4MAYA 4V33A 3VWKA 4Q2ZA 3B9EA 1G6VK 2QR0A 3DRTA 1LE5B 1CYWA 1S7UB 3S4RA 1JXDA 3GGWA 3S2CA 1IK7A 1WWBX 3UC2A 1HEZA 4BWNA 1A6TA 3KPOB 5ECJE 3SKJL 5I1HL 1FO0L 5J12B 1ZJAA 5EF2A 3KWWA 3VJ6B 3FOMB 4AV0A 2BCCE 4GODA 1FV1B 4G6KH 4MCNA 2FLBT 1I3VA 3NIFE 1ZS8B 4URKA 4WU5B 1KPRA 4WU7A 4S1QL 2NY6D 1EXJA 3FTGA 3KH3A 3W2DH 1JPSH 2WLIB 3PF2A 1VQPP 1YSOA 4QGTA 3PHSA 1Z5YD 2KHAA 3BGFC 5IVNA 1QYGL 2R29L 4MMYB 2ZKXA 3AUWB 4QRQB 5HDLA 4NO3A 5K59F 2QLYA 3UC0L 1L0QA 2VDQH 3TYFB 5LGJA 4JFEA 1KILE 2EYSB 3WFBH 5HHXH 1CGWA 2DWXA 5CCKH 3TFKD 2JKXA 1ZPLA 1S1CX 4G7YL 5HHNA 3WTYA 2M1KA 3TBYB 4CL7A 1CURA 3KPRA 2X2HA 5GGRB 1A3ZA 3I84A 5TTRA 2CBMA 4M9PA 4RA3A 4NZJA 4JG0H 2QDVA 4DKEL 2DYRB 3ARDB 5B3JF 5LBVA 3LN4A 4YHPA 2A74B 4ZX4A 2ATKA 3AC0A 5IQ7H 3PABB 4P46C 3CFMA 1H3PH 4QTHA 5IQOA 3WYRA 4X6DB 1LEKB 1O7DC 2GEEA 2HTKC 1LILA 2VDPB 3EJZD 1J8HE 3HC4L 3RAJH 1J0HA 3ECVA 4ODTL 2XXFA 1WO2A 3VD3A 1E90A 4GXVL 3CAFA 4OIAA 3FAXA 4AQZA 2DMKA 1FSKC 2R0KL 2N1TD 5F7YC 5TE4H 1JOIA 3POCA 3P4MB 1AQDB 4XNZB 4WFED 5FF6A 5F89A 4N22A 4YXHH 4Z3EA 1TYRA 4NWTH 4Q7DA 2VR3A 4N2CA 5IB5B 4PJ9A 3SOBL 1V7NH 3M1OA 3OHMB 5CGYC 3MRCA 4PJFE 1F6FB 1H3VA 4JX0A 5KVEH 4OF8A 2XG5A 3SKNA 3NSYA 1AQKL 3MUHL 4M8VA 2DM7A 1S5LE 1HBWA 2FX7H 3HI5H 2G3MA 1JK9A 1ZT4A 3L4ZA 4Q0XL 1BE3D 1DZBA 4LVNC 1X5LA 4WI7A 1FYTA 5DGQA 4UTBA 1F58H 2ZSWA 4CADB 3AG4B 1F4XH 1AY1H 2Y7QB 4NUPA 1LQSR 4DESA 4YJZL 3VG0H 4Y16D 3ISYA 5GRXG 3LH2H 5HGBB 1U2HA 5B38A 2AJXL 2J6EL 4ZUUB 3RWGB 1PNDA 4F9LC 4Z3IA 1RSFA 4IIQC 4AH2B 4MAZA 3CX5I 4HUMB 3D33A 3GJEB 5D4JA 4JB9L 3PLNA 1AD0A 1NEZG 5J3HC 4E5XG 1Y07A 4XZUB 3C5SB 4KKAC 1FA4A 3CIAA 5C0DA 1QSEE 3IM1A 3AADB 2G9HB 1ETZA 2R23A 3BPOC 1O6TA 2ZWLT 4Y4HD 2A77H 3IJEA 2O1KA 3BDYL 1GSKA 4HWNA 2GC4C 4G9FB 2TSBA 5IJCC 3OXRA 4KY1H 3PH0A 2RACA 3P54A 3ENEA 4Y9GA 4ATTA 5DJ6B 1BMZA 2AK1H 4Z7VB 1JPTH 1Q0XH 3G5YB 3AXLB 4UF7C 1ZAGA 3DKHA 1FNHA 3O6MH 3UJJL 5I75B 2E6JA 3PWLB 4YZWA 3IJSA 3BZEB 4LSPL 3BVUA 4NXKA 4L37B 4K73A 5E9DA 4KHTH 5DWUL 2C3VA 1FGVH 1MZZA 4AG4L 4QCIB 1M3IA 5GS2D 3BATA 2XVLA 3NIFF 1T5WA 1BM3L 3BGAA 4W9FC 4WWNA 1OXYA 3M0DC 3LN5B 2BOBB 4FABH 3QVAA 1MLBB 2V2TB 3EYVB 4GS7B 4K3HA 2PNDA 4FG0A 1UATA 3AE2C 2GUVA 3SDDB 3EJUA 4YSCA 1IGJB 1PJWA 1Y0LB 5D1XC 5JPNB 1D6VL 3N9GH 2E4FA 3ULVD 3IJ9A 4J27A 4LB8A 2R2CA 3ASWA 1PPIA 3QDME 1N0XH 3BKCL 1W0VB 1BFSA 3IFOA 2Q3EA 3QE5A 4WY7H 1B90A 2QJKC 3MRFB 4NI6A 1QFUL 4LSRH 4MD0B 4RDQG 2L8AA 3X11B 4NKMA 2DW5A 3GXTA 4KXCA 3O3DA 5KLVG 1KC8Q 2WP3T 4L5FE 3OB0H 4AL8H 5EUOE 5FLUA 2DQMA 1JPGA 1VJSA 2AEOA 1NMBH 3K6SA 4E9QA 4XNYL 4EDWH 2ZT9B 4PVNA 3SYPA 2VITA 2YPVH 5K93A 2M5AB 1MCPL 5KS9F 1JVKA 1X7QA 4FQPA 4M6MH 4LLQA 2ZWKA 3HZMB 4U1KA 5D7LE 3V5KA 1BEYL 2F58H 1KY6A 3QUXC 1G94A 4B9JA 2Y06L 4L5FL 3VMYA 3INUL 2OJEB 4LDCA 2NZ2A 1W72H 3QNXA 5FYLD 2L7JA 3C5JA 5E23A 4WENB 4B27A 1II4E 4GAAA 1BJ1H 1MG3C 5D72L 4PCSA 5GRJL 4PJDE 2Q5UA 3CVHB 5LGYA 4K5LA 4PJFF 1TQSA 5AB0A 4A7VA 1S7UA 3N0PB 1KC5L 3H9HB 3P11L 5BVZA 4L73A 4WGVB 3V9EA 2EDQA 2F18A 3KPOA 4HWBL 3FQ2A 1AO7B 2G0LA 5CHNB 3BDXA 3CSFA 3HD7D 3BAKA 1QZ1A 4UINH 3FOMA 3IPBA 3VJ6A 3SKJH 5I1HH 1FO0H 1RZQA 4X8XA 4J4PD 4OR1A 4JW3A 5E79E 5J1TC 3H1LJ 1ZS8A 2XY1A 1WS8A 2PTVA 3HMWH 1YECL 1CS6A 3M86A 4WU5A 1HILB 3EHBC 3V0FA 3T2NH 5FLVA 5KAFE 3KM2A 1CTNA 3PWUB 4JO1L 1HOCB 5I71C 5KLVK 2WUCL 3GHGB 3QIWC 3GM0A 4MMYA 4QRQA 4WY4B 1J8SA 2F53E 4S1QH 2LAAA 3OAYK 4JFWA 4Y0GA 3TYFA 2WYIA 2R29H 5ESAB 5SWZD 1KBWA 3RVXD 1CXHA 2EYSA 2PO6D 4M02A 2FD6H 3UC0H 3DXAB 1Z66A 1D5RA 3TA3B 3TBYA 3CVIH 3QW9A 4B7LA 5GGRA 4Z7QE 3N1FC 3Q48A 2QHLA 4JQVC 4G7YH 3FXDA 2GTZB 3ARDA 3V6OC 3BZFB 3A2AA 3R4YA 2A74A 1VF5D 5F7BA 3H2QA 3G6JE 1PKQB 3PABA 4IKIA 3FQWA 4C7RA 3MLZL 4D8PB 3U7WL 2BJML 1SYSA 3S4SG 2JEEA 3H9SB 2VSDA 4P3CL 1DEEG 4TL5A 2ZCKL 5HYJD 1KV4A 3H53A 2VUOA 4L4VE 1QNIA 3AEDC 3HUSB 3HC4H 3HN3A 2WBJC 4ODTH 4U6VL 5JO5B 2C4XA 5IB2B 3QRBA 1XR8B 4GXVH 3P4MA 3JCUE 1AQDA 2GCYB 1KWGA 4PMFA 2R0KH 1KN2L 4AGQA 2CK0L 3SKOA 3MX0B 3GF3A 3ZGHA 5IB5A 3ECBB 3X3FH 4H1LG 5KBKA 3H6PA 2MNUA 1W6LA 2B3IA 4J3OC 2O01J 3QH9A 1OAUL 4EKJA 4ZMVA 3N4XA 3SOBH 4RGMC 2W6BA 3G5WA 1BZQK 1GC1H 4P9HL 3V4VL 1MCOL 1GK4A 4QXTB 5C7ZA 4AM0B 4ENED 1HXKA 1HJBA 1AQKH 1AFOA 4CADA 3WNMA 4LPXA 2Y7QA 4HH8A 3TBVB 3HFML 4G80A 4LVOC 4HIIB 4MJ6B 4ZUUA 5EUOF 4WEBL 3RWGA 3AFLA 1FI8C 2FECI 3I6GA 4ODWB 1P84I 5IW6B 3SWFA 3GJEA 4YHMH 4KITB 2AJXH 4JKKA 9PCYA 3IKCB 4FX5A 2Y7SA 3E3QC 1I7UB 4IHOA 3L5WB 4U3FJ 3K5RA 4KWUA 1GCYA 4PGZA 3BVNA 1T66D 4JB9H 3C5SA 1JCDA 2VKWA 3D9AL 4G8EB 4XZUA 3D06A 4OZIE 3MN8A 4JQXA 1QSFB 2G9HA 4M8UA 1VQ8P 1A7NL 1KGXA 1SPDA 5DVLA 3CZLA 2ZNXA 4BK8A 3ZYJA 4PCTA 3BP4B 5CN2A 4E41A 1IBZA 1QAWA 3VMAA 4G9FA 3VRJB 2GM4A 3ZPDA 1ZSDB 3BDYH 3RJQB 3OGOE 5DJ6A 4R4BB 2HVBA 3MVSA 3FUJA 2NY3B 3G5YA 1QATA 3AXLA 2CUAA 1NJ9A 5CUSL 4XMLH 5D8JL 3BRVB 1QX8A 3PWLA 2C8NA 3SGDI 3ECWA 3EBIA 1KB9D 3L7FB 4KI5E 2XOTA 4E9YA 3UJJH 2EVJA 1Q82Q 1N0LB 3PWJB 1OOAA 2XT1B 4KTDL 4QCIA 4AVIA 3QUMH 3ZTJG 1KTMA 1IFJA 4GKNB 2NNFA 4LSPH 4Z18A 1GGBL 5DWUH 3LN5A 3VD1A 4AG4H 2BOBA 2G0KA 3LH8A 1MLBA 2H41A 1BM3H 1EAOA 2FVNA 3EYVA 2AGJL 4MSWB 3X1NA 2FYVA 1YQVL 4PJCA 3SDDA 5ELIA 1IGJA 1OTSD 1Y0LA 4WRLA 1VFOA 4MQ7B 5JPNA 1I8UA 3D51A 4RMSA 3V4UL 2N3JA 4KMLB 4CN1A 4OZGE 1D6VH 1F8TL 1W0VA 5JLZB 5C0CE 3FQ4A 3MRFA 1G9MC 2Y7OA 3OKEA 4MD0A 3BKCH 5CJOL 2J72A 2UUDH 4ZTPL 3X11A 2HVKB 4UBDD 3KR3L 4L3EB 1AZVA 1KENH 4OF6A 1QFUH 2MPAL 3C2AL 3Q2WA 5SWQB 1F4WL 1VESA 4P3WA 4ZKUA 2DLTA 4XXCA 2YAMA 4AQ1C 4AW7A 5I0ZA 5AOLA 1YEGL 4BBWA 4OFPA 2M5AA 3RIKA 4XPGL 5IB1B 3QARA 1UQSB 3HZMA 5APYA 3KJ4C 4FKKA 3QQXA 4XNYH 1Q9KA 2NZIA 3ULUD 3R0NA 3LEXA 1MCPH 3IR9A 2WXFA 1QNZL 1U8PB 2OJEA 3CFCL 3IAPA 4JKMA 4O5LL 1BEYH 3LKSB 1M1XB 1Y6KR 2Y06H 4L5FH 4LEOB 4XO8A 4R2GB 2CKBL 3V7AE 5AWNL 2YA2A 3EYOB 1BZ9B 4KKZA 3WAJA 2IZ0A 5D72H 2L91A 3UERA 3VGHA 2OJZL 3H9HA 1D7BA 3ES6B 4L4TB 3G3LA 4L9LB 2YA1A 1KIQB 3K72B 3U2SB 2ITFA 2NY7L 3EFFB 1KC5H 3P11H 3L2LA 5KEZA 1AO7A 5D7JD 1PZBA 3LKNB 4V1DD 5CHNA 2CJ3A 4Q56A 1QBBA 5D71L 4HWBH 1LQBC 4KQ4L 4RSVA 5H2FH 2VLJB 1TYEB 1E42A 4JREC 1SYVB 1HILA 3MOQA 1T8ZA 3PWUA 2E7CA 5E9NA 1HOCA 1NKOA 3BAEL 4YFEA 4EXKA 1YECH 3GHGA 5IMLA 4WY4A 3BEVB 5EEXA 1KEML 1TSRA 2G3XA 2RHEA 2QPUA 2V33A 2YARA 4PLJD 5JIHA 2OSWA 4OZIF 2LXBA 1CMOA 2A0LC 2WUCH 4XPBL 2I8DA 5ESAA 3EFDL 3K1KC 4UNVA 1KYOE 3G9AB 1U30A 2ERJC 4HKBB 5E79H 2HT4D 2FYYB 4PRPE 1JTOA 4LK4A 3TA3A 3LCYA 3PAVA 5KAFH 4Y4KB 3CXFA 1P2CB 2IDQA 4G6AC 4LHQB 1D9KD 1NANH 5ESVA 1JPST 2GTZA 4I7ZC 1OD7A 2PCFA 3BZFA 4BWUA 5I9QB 4ZUWB 1PKQA 4I85A 2DI8A 3OTTA 4D8PA 4MYPA 4XP5L 1R3IL 2E47A 4A7QA 5DS8B 1HWGB 1NCDL 3MLZH 1E8XA 5F93C 2OAAA 3PJSB 2OQQA 3CI9A 2XV0A 3U7WH 1N6UA 4HSCX 2HYMA 1HQRB 1QFWL 4KV5E 3K8KA 3CFIC 1IM3B 3HUSA 4A2HA 4P3CH 2ZYSA 2E7LC 1OARL 4XRCB 1A4JB 1Y9BA 4B5EA 5JO5A 2ZCKH 5CCHC 1R9FA 5IB2A 1XR8A 2BK8A 3AROA 2GCYA 3KCWA 4XBMA 4CW1B 1ZRUA 3VXRD 3FOLB 1TU2A 4U6VH 4QHUB 2ESVD 2CDFB 2HLFD 3TO4C 3AEGC 3ECBA 1FFRA 4A2FA 1KN2H 1VADA 3H1LG 1G6RL 2CK0H 5E8DH 2CO2A 3QUHA 1AKJB 4YNYB 1L3WA 3BAYA 3OJDB 4MMZC 3AS2A 1ACYL 4QXTA 5CJXC 4AM0A 4K3DL 1MFBH 2WVVB 2JQZA 2H7WA 3JCUH 2EE0A 3TBVA 4FE9A 5D96B 3V4VH 4F57L 5E2WL 2F7IA 3QEHB 3VGAB 5ABDE 3US1A 1X4XA 4P4KB 3HB3D 4AQRD 5FS5A 4ODWA 5KSAC 3HFMH 2BRRH 3FSZA 5IW6A 2DIEA 2IF7A 2XN9B 3T77A 4G2AA 4Y2DC 4X5WB 5AOKA 4NZDA 1XGTA 3IKCA 4URTB 3QZWB 3QDGD 1I7UA 4FQCL 1MOEA 5C0GB 5E6ZA 4ZW8A 1T5XA 1DSYA 4ELME 1RY7B 5DMYA 4HSQA 2IDBA 4G8EA 2NLJB 4N2DA 5L2JB 1A3RL 1AJYA 3T0DA 2JJTC 3Q5TA 1SFDA 4FP8H 4EBQL 1B2WL 4HOZA 3KGUA 1DSFL 1LVEA 3BP4A 4FFWD 4MRCA 3ZGIA 4XNXL 3BN3B 2R32A 1A7NH 3HAEB 4I8DA 3ML8A 4WW2F 2HX7A 3KWTA 2VNCA 1ZSDA 3DIVA 4NZUL 2QKIB 4PJGE 1IE5A 3S6CA 2WQVA 1KFNA 2VXTL 3IDXL 4XTRD 4PYHA 1EAQA 1BZ7A 3HA0A 4LRIA 2J6WA 1UM4H 4KKLD 4GRLD 5CUSH 1N0LA 3PWJA 4XMZA 5D8JH 5SWSB 5F3BB 1O7DE 3DYPA 3P4OB 4GKNA 1Q38A 1XVSA 4TPRH 5FXCH 3S36X 1S7QB 3V8OA 3LHAA 4KTDH 4R97C 1IAIM 4GSUA 3CHQA 3UYRL 3BJLA 2EJ1A 4P23D 1GGBH 2UYLB 3KL0A 3DPBB 3C5ZB 4MSWA 1SMAA 3CVDA 4RBPK 3FUKA 3ARUA 3EZJB 4RAVB 3TT1L 3LZFL 3WFEL 3ZHKA 3LXBA 1RPQA 5KG9B 4MQ7A 1BDYA 2ZUYA 4ADJA 4PHXA 3UZQA 4ZYKA 5PCYA 2BNRE 2WK2A 1MVFA 4JMNA 4BRVA 3RIAK 1BD2B 5JLZA 5D6DC 3V4UH 4MJ2A 2K3TA 5GTIH 1F8TH 2HFGL 5FO8B 4L3EA 2YBRB 4M4RB 5E8NB 4ETQB 4ZO8A 5C6PB 1NMCB 3A5TA 5SWQA 1PDKB 1PIGA 5I15L 3KR3H 2JNZA 2WNKA 3UTSD 3VYIA 1UFUA 2MPAH 1RLWA 3C2AH 5E70A 1F4WH 4RWYL 4F3FB 5IB1A 1YUHB 3ZE1B 2IBZD 4KV5F 5FW6A 3IRPX 4TRPL 5SX4H 1VB9A 1OXZA 1SMOA 5E6SB 4H40A 1YEGH 4FNLL 4WK0B 4XPGH 4N0FB 3L2MA 1U8PA 5APSA 1Z0MA 3AWGA 3N5AA 3LKSA 3SDYL 3MOAL 1M1XA 1EHNA 2JJSC 4LEOA 2R39A 2DEYX 5B38G 3ABGA 1QNZH 3CFCH 2JCCB 5CSZA 4ZFQA 3EYOA 1BZ9A 4N86A 1JBJA 4P2QA 2KIKA 3O9WB 2FYUD 1MCWW 2CKBH 3BDBA 4U1GB 3ES6A 4IFDK 4GT0A 2XHNA 4L4TA 1GZHA 2FJUB 4L9LA 2DIAA 1KIQA 3HG1B 3K72A 4PRAA 3U2SA 5F44A 3BT2L 3KVDD 1H3WM 1OSZB 3EFFA 5HHME 5C0EB 1T03L 5HI4D 4LSUH 2KZWA 3H32B 1Y18B 3LKNA 2V9UA 2DICA 1E4WH 3DX7B 3NN8B 4P3DB 2NY7H 1S3RA 1AZZC 5FV2A 1CIDA 3JSVC 3CK0L 5E2UL 1I53A 3H2WA 4HZLB 4WI4A 4MVBD 3PL6C 3P2BA 1KCVL 2VLJA 3UTOA 1CB4A 2J4WH 4Y5YB 4HKZH 3NQKA 3BZ5A 1SYVA 2B3RA 3L9EA 1KCRL 4K5PA 5D71H 4NIYE 3GSRB 3FTSA 3PWPE 4APXB 4KY2A 4IOSA 4DW2L 4N87A 1TZHA 4FCAA 3S8FB 3BEVA 2W90A 4XWGL 1K2DB 2GJ6B 5C39A 1XH2A 3GTVA 3Q7JA 4N25A 5GJTL 4C56A 3BAEH 4UTAA 4MNQE 2V7HB 4GW4B 4TQPA 2YSTA 4GAGL 1Z9MA 1KEMH 4JRXE 3TSIA 4HKBA 3VXUB 4B3VA 3QORD 3KGTA 4XPBH 1IAII 2YKLL 2FYYA 2ICWI 3KG5A 5D1XE 2WZ0A 2F8IA 4TLFA 4YSRA 3L72E 4F8TA 1NU1K 4O2EB 4Y4KA 1P2CA 2DF3A 2WLZA 4K3EL 3TCTA 3QNYB 4PJGF 4H7VA 4ZUWA 2YSSB 5KTBA 4K94C 4MJIE 2X7LB 4PP1D 4OH2A 1G7JB 5DS8A 1H3UA 1NTMD 4NUMA 2WGXA 1CFVL 4RISL 1MZ9A 1D6EB 3QEGL 1R3IH 4XP5H 3LAFA 5DD0L 3T5WA 1ZLLA 1HQRA 1J1DC 1OZHA 3N41F 1NCDH 1X5ZA 1IM3A 2IANE 2NY5C 3MLYH 5A1AA 3B71A 1A4JA 4XRCA 1E5UI 1DUYB 3Q1EA 3PJNA 1D2PA 2V3DA 4CW1A 3H54A 4JE4B 2WT7B 3FOLA 1OARH 4A68A 3C9NB 3ZHDA 1VQKP 1F3JB 4QHUA 2CDFA 1QO3B 3TH2T 2OL3B 3M07A 1YYLL 4X83A 2EEBA 2GAZB 4IJ3B 1AKJA 3CX5H 4F7MB 4YNYA 2R2BB 4O2CB 4XP6L 4C58B 1LGVA 5KSVB 1ZV2A 3OJDA 1MUJB 2HUEA 3SJVD 3VU2A 1G6RH 3RB7A 5MHSE 4WHYH 2WVVA 3H1IE 1SQXE 1PBYA 2XTJC 1F56A 3QEHA 4K3DH 3FT4B 1CC3A 3OJ2C 3NVQA 4B5ZA 3D3VA 4P4KA 2JKIS 4F57H 1JUNA 4HHAB 2XN9A 4WUKL 3WY2A 2H4EA 3JSSA 5FW8A 2JQMA 4G83A 3CFNA 5C0GA 5APWA 4Y8AA 2VOTA 2E59A 3WNKA 4K3JH 2NLJA 5L2JA 3FSOA 4FQCH 1NCIA 1TIUA 4IJTA 3A7OA 2K7PA 2NDGA 3UTZB 1A3RH 1WAAF 1HFUA 5JIIA 3AEFC 1UADC 1JNLL 2X12A 5AENA 3HAEA 4YZFE 4EBQH 3IXAA 1B2WH 2XZQH 2VZVA 1DSFH 3AAZB 1QOKA 4HU8A 2R15A 4XNXH 2QKIA 1U3NA 4NAJA 1CICC 3KYOB 2Z7YA 3BXNB 3LXAA 2UXGA 3T0XA 2V0AA 1CFQB 3I9GL 4NZUH 5E4OA 3V6OE 1N2RB 2QA4P 2WZPA 3OKKB 1QBLL 5DUML 5BV7B 1FZCC 5GQBA 2UX7A 3RNQB 5SWSA 2VXTH 3FU7B 3IDXH 4FQXD 3D85D 3MV11 3P4OA 2X4SB 3TU6A 4N2HA 1S7QA 4I18B 2R8SH 1RUMH 3SGEI 1U8CB 3RL0B 4APQC 3KYKL 4N0CD 5DJZB 3NTCL 5I0YA 1W72B 4ONOA 5CILH 3WUWB 3MUZ1 2UYLA 3DPBA 3C5ZA 1YEHL 4HIHB 2ZP0T 4RAVA 2KMWA 4EI5D 3UYRH 2E9WA 3SIKA 1JFQL 1IFNA 3FF8A 3VD2A 3ATAA 3ZVVA 1RSYA 3WXWH 1NOHA 5F7LB 3TT1H 4PD4K 3P32A 3T1FB 3LZFH 2WTOA 5DD6B 2ZOWA 2GFBB 3WFEH 4A7UA 4BIKA 4ZX3A 3FYIB 3MBXH 3TO2B 1BD2A 1IBFA 2CJUH 2XV2A 4BSWB 2YQGA 3NCJL 4X0KB 2EDRA 4XZ4A 2P8PB 3LNGA 4G8GA 2X4NB 2ZZUT 5FO8A 1CT8B 1L6ZA 4M4RA 4PJ5D 2KK7A 2NPSB 1OWWA 4RH4A 4RWHA 4W9ZA 5E8NA 4ETQA 4S10A 3E7KA 1CDGA 1A6UL 1PDKA 3WSQL 2H1XA 1BZOA 2HFGH 3QJOA 3WEAA 4NP9A 2RKLA 3BIBX 4Y2OB 1MV8A 4XPAL 4F3FA 1YUHA 4GUCA 3HR5B 4D0DB 2Y9ZA 4W93A 1OM3H 4RWYH 3W11C 1KTRL 2VSCA 3E3QE 4N0FA 1NBCA 4TRPH 3ZHFA 2CO6B 3DUSA 2YIUC 2JSFA 1J1XL 5CSGA 4FNLH 1SXCA 3NH7H 5KVDE 1LP9E 2JCCA 3NIFB 3MOAH 1MCBA 3QJHB 3O9WA 2XKUA 2JF1A 2TRHA 5FFOA 1WIOA 1AFVL 5M7QA 2YEVB 3HG1A 3WMSA 2WQRA 2OI9C 5KVDL 4R7LA 1OSZA 4X7TB 1CXFA 2DMGA 4WFHD 4LOUC 3V2QA 3H32A 3TYYA 1Y18A 3D4CA 3MXVL 4BFBD 3DX7A 3NN8A 4P3DA 3BN9C 3BT2H 1KILB 3FW6A 1T03H 5CCJA 3OR6A 4HZLA 1FFQA 5I1DB 4NI3A 4XHJC 1J1EB 4Y5YA 5EEUA 3DUUB 1HGVA 1PL5A 1AOHA 5E2UH 3TLRA 4K07A 4PS3A 3GSRA 4Q9BA 5F8QC 2P7JA 1UJTA 4X7SL 1X0TA 2Q7YB 4DTGL 3WENA 3DMMC 4YBQC 3ZMEA 1KCRH 3CHOA 1L9QA 1K2DA 3KAAA 3MRQB 2GJ6A 3HPLB 4PH8A 1L7TH 3BVDB 4GH7B 2V7HA 4GW4A 4OD3H 2PPEA 1ORSB 2I85A 2Z4QB 3ESNA 1J8HB 5I17B 5IOPB 3TCLB 4PTUB 4IRSB 1EXIA 4L1LA 4KXDA 5EZLB 3VXUA 3QRFM 1YEDB 1TFHA 5KBPA 4YZFF 2FHCA 15C8L 3VX1A 3LTVA 2VDRB 1AANA 4O2EA 1HHJB 4JHWH 2YKLH 3QNYA 5FHAL 1ZANL 5IVXF 4YSPA 4DF9A 2OBGA 4HH9B 5ABZA 3I55P 3FONB 4K3EH 1TETL 3NACL 2BC4B 2Y1YA 2IZ1A 1ZK9A 2X7LA 3AU0A 3HC2A 1G7JA 3RWEB 3VRIB 2ZUVA 1HL9A 3ORJA 4CJ1A 1D6EA 5A2LH 4ODHH 2C26A 1IARB 5I74B 4U4IA 1CFVH 4RISH 1IBGL 3BVTA 4LPUA 2ZUXA 1G9ML 3QEGH 5DD0H 1DUYA 1NBZB 1F1DA 3T2LA 4MS8C 9CGTA 3EQ2A 1OAKH 4TUJB 1GGCL 1ID5I 2WT7A 5GRVK 1L0LD 3C9NA 3CBKB 5C0BE 1F3JA 4AVHA 3J2PA 1QO3A 1XIWC 1EEZB 2BNQE 2OL3A 3P3RA 1MCWM 1UASA 2F1AA 5H94B 2BS8A 2GAZA 1FZKA 1XWVA 4F7MA 4TN9A 1DVFC 2R2BA 1YYLH 2PCXA 1BZDA 1NAML 3KW7A 3LXCA 4O2CA 5KSVA 3R2PA 1KB3A 1Z0NA 4XMUA 2BNUB 3KYQA 1A9BB 3NCMA 4X4MA 4ZPVB 5F9WC 1QSEB 2ZAHA 2PW1B 4XP6H 4UU9B 5GGTH 2C1PB 3K4ZA 5L0QC 1WT5A 1SJXA 3NIGE 1AQTA 4JS7A 2D2CD 4ZUSB 1UD6A 2Y7LA 2PPCA 4HHAA 2WLMA 1SJEB 1CR9L 4DJGA 3VNYA 4FTVE 1QR4A 2Z8RA 3L95A 3IN2A 4LOEA 4ZXBD 3WKQA 3IJ8A 1EZVG 4WUKH 4DPBX 2YGOA 4OFVA 2R1YB 5C09E 4LOFA 4KZDL 3L1FA 2BHUA 3HNSL 4M7ZB 4TVPD 5HPOA 4XNDA 1O0VA 2DKUA 3NESA 4WUUD 2XYCA 1A7PL 2CPCA 3CZKA 1YEFH 4WVZA 2GHZA 2CO3A 3UTZA 3BIKB 4B9GA 1DSWA 3KXFD 4PPTA 1ILUA 4XMPL 5EU6E 4PJEB 3RGVD 1SQPE 3AAZA 2XWDA 3ILDA 4Z6AT 3KPEA 2C9VA 2CG9X 4XXWA 3KYOA 1JNLH 3DBXB 3BXNA 3K74B 3CCSP 4GG6B 5AZ2H 3MUGB 4NCC1 3D6ZA 5AKVA 1CFQA 1PVHA 2FSDA 4WTXA 1Q2NA 1L9TA 3ZDXE 1N2RA 1E2ZA 4DGVL 3OW2O 3A6BH 3OKKA 2H89C 4ABWA 4EIJA 5A2FA 1XSJA 4ZOBA 3FU7A 1KYUA 2W6JH 3V5BA 1M9WA 3QDMB 1QBLH 5DUMH 3UP6A 1SQVK 1G5GA 1ZHBA 2X4SA 2LFEA 2CRIA 5FDYA 4YDLB 1BF5A 4BGLA 4I18A 4UQ2B 3UDWC 2XACC 3NJGA 1U8CA 4BFIB 5E8EB 5DJZA 4MQXD 3PP3H 1W72A 2LU7A 3KPQB 3WUWA 1NTKE 3WNNA 3WLWC 3ZN6A 4HIHA 3EJSA 4YLBA 1W16A 5CCHE 5CZXD 3QC6X 3B7RL 3ARBD 2B4CC 2JKRM 5DD6A 2GFBA 5CZVL 1JFQH 4DVRL 3GXDA 5D7LB 3K1DA 3VD5A 3TO2A 4G3YL 2J1XA 4L3AA 3GD1C 4LPCA 1A66A 1OP3H 4X50A 3LZQA 3VFGL 4BSWA 4X0KA 5HDOA 2P8PA 4N8PA 4NM4H 5F0PB 1CT8A 1PYWB 2NPSA 4QYAA 3CHSA 3NCJH 4Z78B 1UOWA 4OLVL 3CN4A 2QJYC 4PJDB 2RAMA 4PTTB 3LQZB 5KVGE 4U0QB 3IF4A 2WWOA 5B4MD 1KN4H 1V55B 1Y6NR 2WO4A 1A6UH 4Y2OA 4ZOEA 3WSQH 1HZLA 3TBBA 4J3OH 4W4OA 3VXTA 3VXPB 5FGBC 3HR5A 4N6RB 1SHMA 2VZ3A 4D0DA 1WGVA 4KK6D 1AQ8A 1K8IB 4XPAH 1KQLA 2IWKA 3L75J 4FNPA 5FYKU 5KVGL 3VXNB 3SE8L 1AG6A 2R29A 1S2EA 2CO6A 4L8BB 4EN3D 5C08D 1CE1L 5IREA 4JO4H 5JW4Q 2JFCA 3JXAA 3NABL 3KLAB 3RBSA 2OQJB 5E56A 4ACPA 2X4PB 3OLGA 3RIFF 3QJHA 4L23A 4M03A 4Z7IA 5IV2A 2BERA 1PY9A 4K3GA 3TN0B 2F53B 3BUBA 4GPVA 5FYKE 1T0NB 2OYHC 2B16A 1NTZJ 4X7TA 3U82B 4KK5C 4I88A 5EWIL 3GMAA 1VDGA 3RK3E 1AFVH 1JNNL 4YAQB 1KTLB 4UNUA 2R69L 3PXHA 1KILA 5KVDH 1VZHA 4PS7A 4MXWH 2JELL 3MZGB 3TV8A 5L9DL 1T89C 2A9AA 3AREB 3V6FB 1DQJB 5I1GL 3H1JE 1GL2C 4PWJA 1TEYA 3QS2A 3DUUA 3EYUL 1NPNA 3KEHA 4FQIL 5FYKL 4Z7QB 2YZ1A 1KBBA 2Q7YA 2Y7MA 3EF4A 2AXJA 1F90H 1J5DA 4P4RB 5CZRA 1D5ZB 3G6JB 1PFCA 4E68A 4X7SH 5IJDC 3MRQA 3D4ZA 3HPLA 5J6HB 1TEFA 1G7QB 3ZT5A 4LSQL 1NTDA 2Z4QA 5I17A 1E7VA 1J8HA 5IOPA 4PTUA 4IRSA 5EZLA 2WO3B 1YEDA 2X9XA 4M1GL 3UADA 2AI0L 4GIAA 4DGWC 4OLXH 3AXIA 2BHFA 1HHJA 3FCTB 4E36A 4YPCA 3BRFA 1T6WA 1ASPA 2FFDC 2FQDA 3BRTB 3ARFC 3EO0B 4G7QB 3J07A 4HH9A 4U7KA 3V4VB 1E7UA 3FONA 3WJJA 4DIXA 4CU8A 4ZW5A 1BQSA 4TLTA 4XNAA 1QRKA 3THML 5FHAH 2BC4A 1ZANH 4L4JA 3RWEA 3VRIA 1R3JB 3LIDA 2JB6B 3ME0B 4DSYA 3CDCA 2XU6A 1TETH 3L4CA 4WV1C 2J6EA 2D4FA 5F1NB 4PW3A 5CJ5A 5E6YA 5AALA 4DUXA 3UP1A 5DHVH 1TTCA 4KO7A 1NBZA 1SLXA 4OLZL 2PP6A 1FN4B 1DH3A 4GB9A 5I18L 4Q6IB 1T7ZA 1IBGH 4HAKA 3RVUC 1Q9LB 4CMHB 1G9MH 3F2LA 5FGRA 4QD2E 3LPGA 1EEZA 1GGCH 5F2FA 4HJJH 4KJWC 4JFQB 5H94A 4AT6B 3S9DB 4W9DC 4NQCD 3ZYOA 4UQAA 4LHJB 1NCWH 3QIUB 2BNUA 4DT0A 4LE8A 4ZPVA 3UBFA 5JIDA 1SQQE 1QSEA 4OZIB 2PW1A 4FLQA 3WAKA 1AYRA 1NAMH 4L2LA 4UU9A 2C1PA 2ED7A 2VJ0A 3OQRA 4PFEA 4ZMNA 3FCUB 3JTSB 4XN9A 4ZUSA 1MCLA 4X9YA 4X4YB 2OMBA 2VQUA 2Y6SC 2QG4A 1SJEA 3CD6P 4IMLB 1DLFH 4YL9A 5EU3B 2O1AA 2ZYHA 1WJ3A 3S9OA 4BKTC 2VISB 1DBML 2R1YA 1CR9H 4P5MB 1UC6A 5EPMB 1CYXA 3RVVD 5CEZE 2F8VA 2Z65C 2ZXCA 1S9KC 1QBMH 2CZNA 1QD0A 2WAHA 5D5ME 1TQCC 4KZDH 4Y89A 3QWRD 1WFNA 2KLRA 3GLDA 3HNSH 4BH8B 4OWFA 3BIKA 3N43B 5GGVY 3VNZA 1PZUB 3FSWA 2IX7C 3VDBA 1Q0YL 4OUOA 1U4FA 1OTUC 3CXHE 5CEZL 2KUBA 2A45H 1FNFA 4XMPH 5EZPA 3DBXA 4UNIA 1RMFL 4W9CC 4GG6A 1REIA 3MUGA 2HX8A 1KIRB 1UCBL 4WWKD 4DP7X 1KXVA 1SMDA 2PXYC 3DGGB 2OXHB 5DJ2B 1XTLA 1FAKT 5HHOE 4PIBA 3VD0A 4KNTA 5C1MB 2P42B 3QDMA 4OGQC 1TZOA 4X8GA 4DGVH 5HI3D 4OZGB 3F7YB 4QT5A 2X6BA 1JB0J 5C0CB 2YS4A 3TZVD 4UQ2A 5ICUA 4BFIA 5E8EA 3H7LA 2KI7B 4TTGA 3GTNA 3W9DA 3UCQA 3ZRFC 3A3YB 1JM0A 2IALB 4K94L 2VLMD 4K5MA 1SOKA 1NGMB 5EUOA 5HYSB 1T2KC 5J11C 4UV7L 2ATAA 3MFGB 5IM7B 4Y7OC 2CKBB 4A7SA 3GLEA 3EFFK 1UUNA 4OD2B 5D7LA 2NY5L 1M7IA 2EXYC 4IEFB 5CZVH 4N2AA 1EXGA 4K8RD 2VZUA 3B2PA 4DVRH 3QNFA 1ZV9A 1IVLA 4YBLB 5AG8A 1RHZB 1BQKA 1ZRTD 4Y8DC 1QZNA 3EJCA 3LPPA 3DJZA 5D1ZI 1J1PL 1PYWA 5FO2A 1NWPA 1NL0L 4PJDA 4Z78A 2XTJE 5CBOA 1N8OE 2Y25A 3LQZA 4DAGL 3L71D 3DBSA 4WW2B 4XCCH 4DP1X 3V4PL 2VDNL 1UWGL 1CTMA 4TSAL 2BIQA 4TTDD 2ZJSE 1LD9B 5MEQA 2J44A 3SODB 1KJ2B 3VXPA 4XE5B 3BEWB 4N6RA 1K8IA 2ZXGA 5LNGA 2X9WA 3VXNA 2DH2A 4K2UL 4XVUD 2WCPA 4L8BA 5FECB 2AQTA 1YRKA 1O6VA 5AKTA 2ZJSL 3NJJA 3SE8H 3SSUA 3NJMA 3KLAA 4UYPA 2X4PA 2SEBB 2HB0A 2Y1ZA 1FC2D 3MCYA 3MXWL 1SFCD 3B9KD 3PNWA 3BCCE 3EGSB 3OG4B 3QZWG 4PJ7E 3NABH 2H0PA 4ISVB 3TN0A 3T0VA 4L0YA 3P9WB 1IKNA 2F53A 2P5WD 2XA8H 2V4HA 1MELA 1T0NA 4LKCB 4PJHF 3T2QA 3K80A 3MRBB 2HTLD 1R5IB 4OI7A 2B08A 4YAQA 4M6OL 1KTLA 3PJSK 4U1MA 1BFOB 5GRUL 1KIPA 1MFUA 1CGVA 3S36L 5EWIH 2ZKWA 3V6FA 3AREA 1DQJA 4PRPB 3TURA 2R56L 3C08L 3HAEG 3W67A 2YD2A 2R69H 5T1LD 4Y1AB 5L9DH 2R1WB 4BFOA 1XEUA 2OX5B 5I1GH 2IADA 2X4TB 4LARL 3KH4A 1HJ0A 1T2XA 4P4RA 3EYUH 4YVNA 1DEDA 3UPRB 1D5ZA 4FQIH 3G6JA 1PQZB 4WI8A 1CLVA 1Z5LB 1KYDA 4F80A 2BCCJ 1B3JA 2ZP8A 3MV9D 2BFGA 4PV1D 1G7QA 5D5MF 4EDXA 4YDIH 2GJJA 2NXZD 3ALWA 1MEXL 4AK1A 4MB3A 4S0TD 3LRSA 4LSQH 2Z31D 1LTAC 3FGAD 1SOQA 5E6RB 1G6RB 1BQHB 3FCTA 4FERA 3U46B 2P44B 4FQ1L 4N3TA 5TD4A 3DHMA 3LS4L 4M1GH 4LQ1A 4Q4EA 2AI0H 1MFCL 2KT6A 3EO0A 4GT1A 3NCWA 1U2CA 4I89A 4R5XA 2IDTA 1TZIB 3L75G 3V4VA 3PRJA 4BE5A 3V52L 5F7EL 1FFPB 3L3OC 5TFSL 1TQBB 1EHXA 1XF2B 3B8YA 1NPUA 1R3JA 2AK4D 2JB6A 2XPYA 3ME0A 1BREA 5EF0A 5HGHB 4MNGE 4ABQA 2R3CA 1UD5A 3U59A 2DZEA 3B5TA 3IFPB 5F1NA 1YBKA 3KLLA 2BFVH 4HJ1A 1I7TA 3BWUC 3OF6A 4IRJC 2XX1A 3T04D 1IQWL 1EQWA 3PPEA 4AC4A 1FN4A 2HODB 5F1IA 1H0DB 4Q6IA 5JHDB 5AAMC 1Q9LA 1U4EA 3U1AA 3D71A 4OLZH 5I18H 2E6PA 4XT1C 3MCLL 2E0PA 4JFQA 4MB5A 4AT6A 3FT0A 4KDTC 5K5YA 4DUWA 1MVUB 4IOFC 2R0LL 3D70A 3FFCE 3V4QA 1SVCP 2KLSA 4ELMB 1I8MA 3QIUA 2X4OB 4OZIA 4PJ0E 3A6CL 1DFBH 4JFDE 1MW2A 4OZFH 3MA9L 5DYFA 2Q7NA 4FI6A 3JTSA 3UX9B 2EQDA 4YSSA 2J73A 1O9WA 4X4YA 3HZKB 3L4VA 4ESKA 5CGMA 3REWB 1DQQB 4IMLA 3QDHA 3H6AA 5EU3A 3CN1A 1WA1X 2VISA 4AYFB 4P5MA 5EPMA 3C8HA 4GBXC 3ARGC 4R83A 4X5RA 3HZVA 1DBMH 4WWID 4N5EC 2ZF9A 1MXGA 4KKCD 4P46B 2WIIB 2GK2A 2VR4A 4GXUM 1OW6A 4BH8A 1QWUA 1YY8B 4EQ2A 4NX0A 2JKJA 3B9VA 5IMKA 3N41B 4XCFL 1QPPA 2AP2A 2ALAA 2YQBA 4XVOA 1EQ7A 4JKNA 3GLZA 2PR9A 3CDGB 1Q0YH 4PJ7F 3S35L 3G4SP 3SE9L 2Z1PA 2R7EB 3RTQC 1FSKB 2YAHA 3GZQA 3ETTA 3OXSB 3OLIA 3SGEH 4DGIH 2IAMD 4U1LB 5CEZH 5T3ZD 4JDVB 4IYKA 4XFJA 1EDLA 1FC1A 4UZSA 1E5CA 1ZMEC 4F7TA 3WXVL 4JQIL 1JXKA 2O6DA 2R4SL 1INQB 1UCBH 3DGGA 1G7IA 2GHWB 2XTSA 3DX1A 3O11B 5DJ2A 1G7LB 4OV5B 1HWHB 2BNRB 2GT9A 1OTTC 3C8KB 1AHWC 2NNCA 3CXHH 4ODUB 3F7YA 4OZGA 4ZX5A 4YPGB 1U3HC 1JWUB 2YD5A 4S0SD 2J8UE 2OTWB 5C0CA 3ETSA 5IFJB 4MA3A 3SHSA 1KCUL 4LVNB 3SQBB 2OTPA 2IALA 1R3KA 2OM5A 4OCXL 3ZSSA 1NCJA 5HYSA 2HFEB 2K8MA 3IDNB 2D7PA 2WKGA 2XPZA 4KH9A 1URQD 3HZYB 3TIEA 4K94H 5IM7A 1GZLA 1ILSA 1P4LB 2CKBA 4QOKE 4F2MB 5HP5A 4OD2A 3ABVC 1HH9B 5AW9B 2BVTA 2RR3A 4UV7H 1XGPB 3QJFB 5MEND 2A9BA 4OJCA 4YC2B 4IEFA 2OMVB 1CI6A 1S8DB 1WAPA 4ZAKD 1NCUA 1UWXK 2NY5H 4NPEA 4DN3L 2AJSL 4M8QA 3ATBA 3FSVA 3ZIMA 3VFOB 3O8XD 5ADOH 2W9DL 2WLYA 3WN6A 3BPOB 4HKZA 4QRRD 2ODIA 3OHXC 3FMGH 4JJ5B 1J7VR 4HCFA 4WW2A 3R06B 1B6UA 1MH5B 3U2IA 2X4QB 3WKPA 1OK0A 4OFYA 5B39B 3BHBA 4MAYC 5E9AA 3LZRA 4OGAD 4GAFB 4U1NB 1GYVA 3IDGB 4DAGH 5HHMB 3V4PH 3BEWA 7TAAA 4EIBA 1UWGH 3B5NA 1LO4L 1WZ1H 3GRBA 4KZ0A 2ATPB 4UTCA 3EWKA 3K6NA 3Q3DA 5FECA 2Q7AA 3DJ9A 5DA0B 5GS1C 1YN7B 4AMWA 4RMWA 1EZLA 3SBWA 5C3IA 3H9YA 4BHUA 4LESA 4K2UH 4UB0L 2F54D 1V27A 2SEBA 3PWPB 1YPZF 4JZOB 2ZJSH 1CDIA 3Q5YA 5E8OB 4ISVA 3HBPA 4TF4A 4UANA 3OKLB 3MXWH 4LKCA 4PB9L 2C7FA 5IB4A 4J12A 4NLHA 3B34A 2YAPA 1AZNA 3OG6B 3MRBA 4MNQB 1R5IA 4JRXB 1BFOA 1NFDB 1S7SA 2ARWA 4PRPA 1WWAX 2F6AA 4M6OH 4ODXB 1BJ8A 4Y1AA 1INDL 2R1WA 2V7NB 1KBGL 3IRZA 3QR2A 2OX5A 4NQDE 4CDHA 2HPCB 2R56H 2X4TA 3C08H 4HS3B 5BRQA 1KQSO 3UPRA 4I1NB 1PQZA 1D7DA 2Q3XA 4YHYB 1Z5LA 1HYSD 1XCTB 4TOYL 4Y9FA 3FQYA 1CD1B 4MJIB 1WRFA 3A4AA 3W56A 2B88A 5B8CC 2VW6A 3CZSA 1EUTA 3D8MA 3O6QB 5APQA 1TNNA 1PLGL 1SN5A 5DMGD 1AA0A 1YMMD 3DOIA 4ODBD 5KZCD 2IANB 1MEXH 1VZGA 1ITBB 2YWZA 5APXA 2KS1B 1BQHA 1G6RA 3D34A 3U46A 1JZ6A 5F7DB 3GF8A 3NPSC 4NQSB 5B66E 3WUWG 2AV1B 2K9UA 3QUXB 1TZIA 4H25B 4FQ1H 2QV2A 4ZMZA 3LS4H 3ZKQD 3V0HA 1FFPA 1MFCH 1XF2A 2B4CL 1H9VA 2XFXB 3V52H 5F7EH 2FQGA 5HGHA 3O4OC 4P5KB 3VSUA 2IPTL 3IFPA 2O61A 3EOTL 4BUGA 3JZYA 5DS1A 2HODA 2IBGA 3BH4A 1NFAA 5JHDA 1YTZT 4WDIB 1A6ZB 3RE0A 1IQWH 4RGND 4FGMA 5SV3A 4NCC2 4OM1L 4QLWA 2D3NA 2A9CA 1F00I 5CLWA 3M9BA 1X5IA 2DKMA 2NY1D 2O6PA 4QPEA 1MVUA 8CGTA 1JZGA 2ZG2A 3MCLH 1BEXA 5C08B 4ELMA 3GYRA 4S1SL 3P02A 2X4OA 4GY4A 2O5YH 2XJLA 3IDIB 5JIPA 4C4UA 2BCCG 3I3BA 3U30B 1HEJC 4XNUL 1SJMA 5I24A 4NN7C 4D94A 4HU2A 3QAQA 5CD5C 3A6CH 2G3ZA 4J2QA 3QJVB 1WF5A 1E3XA 1QPKA 3U9UB 4DEWA 3HZKA 5E1GA 3FQ1A 1X4ZA 4HCGA 1N4XL 3MA9H 5ITFB 4QMEA 3FU0A 3REWA 1DQQA 1SY6H 2FXOA 4PJGA 4OD1L 4GIFA 4AYFA 3D39E 4HKJB 5K33A 4PJ0H 2VRQA 1FZGA 1V7ML 4E9RA 2HG5D 3L36A 1AE6L 4WTWA 4P46A 1YAIA 2WIIA 3LZPA 4J3SA 1YY8A 4I9WD 3GTTA 4WHTB 3BAJA 3WKMH 2LVEA 2NQ3A 3FCBA 3TYGL 4AZ8B 4N90E 5B21A 3CDGA 3TF5A 1L9SA 2OLDA 4XCFH 2R7EA 2H1LM 3OXSA 2WBJB 2NY0C 5FK9B 1OAXL 4JDVA 3D69B 2QADD 1FGNL 3S35H 4FLOA 4AJVA 3SE9H 5JXED 2JWAA 3DGDA 1INQA 3O11A 5FW7A 4N28A 5JDSB 4LHUD 1ZEAL 2ZSVB 4OV5A 2BNRA 2BP5M 1F4YL 1XCWA 2CR6A 3C8KA 2VZ1A 2R4SH 5FHBL 4ODUA 1FVEB 1MWAB 1NC4D 3BWAB 4UM9B 4YPGA 5BNXD 1JWUA 1YI2P 4NWUL 2OTWA 1N86A 5IFJA 1SBBA 4RGMB 4EI6B 5I1JL 1KZYA 4KQ3L 2X89A 4H0GA 2Y0DA 4JY5L 3UZVB 3ZL4L 3SQBA 4DOHE 1XBDA 2ZCZA 3MJWA 5CN1A 5AVVB 5HDWA 1L4AD 4PRBB 3SPGA 2XV5A 4GT7A 3UAJC 4A39A 1KCUH 3QI9C 2HFEA 3IDNA 4J3TA 4KKRA 3FUEA 1GGUA 4LVOB 4ECNA 5T5NG 3CN2A 3HZYA 5JHLL 4KOBA 4OCXH 4F9LA 2N4IA 4IIQA 5JR1L 3C6SB 3CC2P 3E80A 2AXCA 4OF3A 1HH9A 4MX7B 5ACZB 1XGPA 4DJMA 2VDOL 2F5AL 4ZS6C 2OMVA 2UY6B 3JBG7 3HE7D 4M7KH 3APMA 2A1WL 4HXAH 2C9SA 1FDIA 2DV6A 4PLKC 3H7BB 2WSFJ 5J89A 3HHRB 3VFOA 4F8LA 4U1SB 3OMNB 1TU3F 1LP9B 4HALA 4P49A 2VRSA 5CMAB 5D1QD 4DN4H 1G1IA 4DN3H 3GMQB 4JJ5A 2FQEA 4MHHG 3R06A 1MH5A 5L7XL 4TT3H 1LMIA 2X4QA 2IGFH 3KJ6H 5E0FA 3VUAA 3APCA 2W9DH 4QTFA 2GJRA 3IDGA 2F8OA 1IL1B 1S4IA 2D0GA 4I0PD 5FWRA 5IG7B 3GC3A 2K3HA 2ATPA 4OTXL 4QXVA 3HG2A 4L0PB 2A6KB 2HWZL 4FLRA 2DQDL 1S72P 4D7BA 3MAWA 4NOFA 1YN7A 3QFJD 2COVD 1S9KE 4L3FA 5J12C 4WQOA 5DRZB 4LKXB 3GBEA 2BSED 3HKFA 3PWPA 5AOJA 3BQVA 4JZOA 1A9EB 5J06A 3QR1A 5E8OA 5I19L 3NTNA 1K8AQ 4UB0H 1EFXD 3OKLA 1XF4B 3L37A 1GIGL 2HZHA 4KAQL 2J1ZA 4B3EA 3CQFA 5GIRB 4MNQA 5DVPA 4PB9H 4JRXA 1KCLA 5I1KH 1NOFA 2IPUG 1NFDA 2FJHB 4OBSA 2ZF8A 4HLJA 4MYWB 5DZPA 1LK2B 4WWPA 3U79A 5D1XA 1XGUB 1F1GA 2CLZA 4ODXA 4LCWB 4MN4C 5FOJA 1NGYB 3LKPA 3WDIA 4AUUA 2V7NA 2J1WA 5LNDA 1PP9E 5DHVB 3CQQA 3FTVA 1EMTL 3NDYE 2HPCA 3CFUA 4HS3A 1WTLA 1INDH 2CRZA 3CWBJ 5I0VA 1KBGH 2XWEA 5DJXB 1XCTA 3D12B 1ZLSH 2TSAA 3U48A 1CD1A 2HLAB 4MJIA 1PFOA 1YC7A 3D5OF 1OD9A 3EXJA 1F2XK 2POHA 3O6QA 4TOYH 1B4LA 5DVMA 1SUHA 2VLRE 3GEWB 3ML9A 4H5SB 3G08A 4TUOB 4AYMC 3AGWA 4G8FB 4AQ1B 1DJWA 2IANA 2KS1A 4RSYA 3HR6A 5HVFB 5F7DA 1PLGH 1RCYA 1YVLA 4NQSA 2XSKA 4OB5L 1I9RL 2AV1A 3QUXA 1NGZB 3QAZB 3TWYA 1EAJA 1KYOJ 1K5NB 2BNQB 4OFIA 2KYVA 1TZ8A 2NW2B 4TQHA 2PPAA 4JRYE 1B0RB 5DMJB 2XFXA 2H88C 5E4IA 1JY3P 3O0RL 3IN0A 2C1OB 4JGJA 4P5KA 4PJAE 2B4CH 4MJJA 1NAKL 5E5UB 2NPLX 1GHFL 2B9BA 3E9UA 3MV7E 5B66H 2IPTH 2QSVA 2X38A 2IPUK 1BVNP 2WBKA 2HCZX 5CR1A 1KMGA 3NIGB 2AEIT 4L4VD 3EOTH 4FXLA 3L4UA 3KYNB 1MDAA 1S4XA 3MBWB 4GP8B 2GY5A 2PR4H 3TPUB 1G7HB 2ITEA 1J0IA 4FTVB 2WLNA 4JREB 1LNUB 1NFIB 5C09B 4GW5B 3G71P 3BYTA 3QFDB 3ZKND 2CXKA 5CLYA 3IDIA 3HTKB 2ADFH 2WPVB 1CGYA 1XGQB 4S1SH 1SFCB 4Y4FD 2VDML 4DK3A 2FRGP 4LSVL 3U9UA 1XTMA 5EU6B 3RFZC 2EO1A 4KVCL 2YQ2A 4XNUH 4DGUA 1I9EA 5ITFA 4MDJB 5LNEA 2I32A 4QRPE 5L2KE 2I07B 2IOMA 2H1PL 1N4XH 1KEGL 4FOMA 1U8KA 3U6RB 4HKJA 1AGFB 1R5SA 2K9FB 4XBPB 3I3DA 4G5ZH 1J2JB 4Z7WE 3ZDXB 4D2NA 4OD1H 1FORL 3FTYA 5LWYL 1XH3B 3F12B 4OCLC 3RVTD 1HCFX 5DZJA 1V7MH 4RAUB 3H2PA 3MU3A 5I75C 4FULA 3VXMD 1AE6H 2H5UA 1FZMA 2HPOA 4DK6A 3MV9B 5HYFA 4AZ8A 2BZCA 4LAQL 2NXZB 4D9QE 2G30A 3G5XB 5EZJA 2WBJA 4M5SA 3ZX1A 1ZIAA 3RZCD 2YZ8A 5FK9A 1I3GL 1SXAA 3D69A 3MRNB 2XWTB 3D52A 4PV8B 1L9RA 4B97A 4GS7C 1NCNA 5JDSA 1OAXH 3DHPA 1FGNH 2ZSVA 5JDJA 4KZEH 1Q94B 2DH3A 5HJDA 2R83A 3DOSB 2O30A 1M05B 4TUKL 3S7GA 3U1SL 1HESA 1FVEA 1MWAA 1OSEA 3BWAA 1FVCB 4YTPC 1T6VN 4UM9A 5GSVB 1ZEAH 3TL5A 3VH8A 2J21A 3RNKA 1F4YH 3JV6B 2J20A 4HDIB 4WTZA 5FHBH 4JRFA 8FABA 2A06D 3UZVA 4NKOA 5BS0B 4NWUH 3ILQD 4DWHA 3WDHA 4PRBA 5I1JH 2BRQA 3GM8A 4KQ3H 1X5FA 4JY5H 3DLQR 3ZL4H 4F92B 3HPJB 1A4AA 5KSAB 2XX0A 3C6SA 4EOWL 4NBYB 4X6CF 4BQCA 4C4BA 5ACZA 5KYXA 2D7TL 3I75B 1R5WB 5JHLH 4XXCC 5J4MA 2UY6A 2ZT9C 4OKVA 4XCYB 1N7ML 4OT1L 1JZ2A 3GS4A 2XVKA 2CIIB 3O4LE 3OAYH 3P3YA 1CQYA 3H7BA 4X5LA 4U1SA 3SCMD 4DO4A 1LP9A 2QVKA 2UWJE 4JFTA 5CMAA 5DEJA 2B59B 3RYMA 3RX9A 3GMQA 4JFFD 3HE4B 5BOJA 4JCWA 5CLZA 4PJAF 1X7SA 1MAMH 4DP2X 3I5CA 3AB0C 5L7XH 1IL1A 1OO2A 3B5GA 3OMAB 3GI9H 2EIBA 3WUZA 5IG7A 5GRYA 3KLHC 5GSRB 3RK3B 4W6XB 2A6KA 3ZQWA 1G1YA 1FF5A 2ARJB 3JVGA 5AVWB 4OTXH 1BXXA 2HWZH 2DQDH 5DRZA 4LKXA 4OLUL 1A9EA 4KX7A 3AE4C 1IEAB 4JR9L 3T65B 3S3BB 2LLNA 4I3RL 1N7SC 2ADGB 2XKSA 4LCYB 2VM4A 4YHKL 5IHUL 3EGXB 5GIRA 4X0NA 5I19H 3L73E 3ALXA 1IBYA 4KHXL 4WO4D 3KS0H 4KAQH 3GHGC 2R44A 3FK3A 1PIXA 1RHHB 1S9YB 1YHPA 4WY4C 2ZXXA 1YYML 2FJHA 2XN0A 1LK2A 3L70J 1XGUA 1CQKA 5JZ7D 2IAMB 5AYUH 4LCWA 1NGYA 1U36A 3C6LD 4OKDA 2H0FA 5DHVA 2WITA 1ZGLB 1K72A 2YKPA 3GMNA 3A23A 3WUTA 1SHSA 5MERB 4MBOA 1N59B 5E1AB 3TA3C 3SPVB 4IKKA 5DJXA 4F58L 3MLPA 5CCGC 1QUPA 3ZKMD 3BRDA 1NO4A 2HLAA 4JVWA 1IFMA 4WLCA 1A0QL 4NGHL 2YLKA 2KS0A 3BWZA 3H1KD 4CSSA 4H5SA 4NC2B 4TUOA 1GZPB 4G8FA 5DO2C 3V0EA 4AQ1A 5G2NA 3GZOA 1U91B 1C5DB 3ABLB 4ZFOL 5DO8A 5C07D 1SXNA 1NAMA 4RFNB 1XAKA 2OCCB 2XKNB 3TEZA 3OWRA 3GUTB 4G9DB 1J87A 4FJ6A 3WI9A 1NGZA 1FG9C 3H1LE 3HUSC 3VI4E 5HYSG 1K5NA 2BNQA 4OB5H 4DZBB 2NW2A 1WBXB 4UQBA 1ID2A 1B0RA 1I1AD 1QRND 1EDKA 1SOSA 3W3BA 1OE2A 4MNHB 2C1OA 1JPEA 3NJXA 2ARJQ 2CCWA 4NENB 1YNLL 2ROXA 4YXDC 5DQDL 1GK6A 5CJ4A 1OIPA 3ZYIA 2AQNA 2HJFA 3KPSD 4H1LH 1SXSA 2IDFA 1NAKH 3CX5D 1GHFH 4H0LD 4P0DA 3EJYC 3MBWA 4N2EA 3QIBB 3TPUA 4K15A 2SODB 2FYNB 3CCRP 4FTVA 3R8BB 2Q2EB 3F58H 3T4AB 3B6SB 3D6GA 3L4XA 3O3BB 2YJLA 2XWCA 4GAJL 4GW5A 5C09A 3QFDA 3VGGA 1B4RA 1OGTB 1NAFA 3CWBG 3HTKA 2W88A 2HH0L 5FA4B 4JZNB 4AGLA 2F54B 5J1AB 5D5MB 1AZRA 1XGQA 1WIUA 1E28B 1CFSB 3QK0A 5TDPB 3T6QC 1JMXA 2CM5A 3JT2A 5DZNA 4YDMA 5EU6A 4XWOC 2FLRT 2WPRA 2DIJA 2JTDA 2QPEB 4KK9C 2XETA 1SFHA 3LEYL 5DJDB 1MSPA 2I07A 3TWCL 4KTGA 1NQBA 2C3GA 1RJYB 2EO9A 3H1IJ 1UT2A 1SQXJ 3W0WE 4AGOA 1KT2B 1B0IA 5G5DB 4JFEE 3U6RA 2N0MA 1AGFA 5GISL 2HMIC 4L1BA 4YK4B 4XBPA 2ZVNB 4PLNC 2H1PH 2H8PD 1JGVL 1XH3A 1UD2A 2APBA 4H44D 1FG2B 5TH2A 1EZVI 3EYSL 4R4FL 2X6VA 5HHOB 1AIZA 4HUUA 4NDMB 1BQUA 4RAUA 4NRZB 3RPKA 1FORH 4JPWL 1PV3A 2JMRA 3C8VA 4LRIC 1V3JA 5ACLA 4OGZA 5EZIL 5IHWA 4AQEB 1QA9B 4LAQH 3MRNA 2XWTA 3MJ9A 4P2AA 3QHZH 4PV8A 4S1DC 3ZTJH 5IFHL 2A83B 2ZKHH 1S6NA 4MQTB 4N2OA 3I6LE 3O0LA 5EO0B 1MZYA 1ZLWK 1LMKA 2DS4A 2GSIB 3DOSA 1E9PB 2WKOF 1M05A 4FA8A 4J5VA 1RL1A 3H42L 1BQHG 3V4PB 5GSVA 1GPOL 4WHYG 2VDNB 4JLRB 5J1SC 3SDCD 3NIDB 2B1AL 2YUWA 4HDIA 4TUKH 2V8MA 3PRZA 3U1SH 5AVQB 1FNGA 1E3FA 3NT0A 5BS0A 3BH8B 2HTKD 3AG2B 3BKJH 3O3UN 2VXUL 1GS7A 3DSNB 5F7UA 5K39B 5H37A 1WBZB 2QPFA 1OW8A 3HPJA 1NPJA 2O5ZL 3K81A 1FYTE 3KW8A 3HE6B 1EBAA 3A67L 5KSAA 1NU1E 1TPXC 2BP8B 3K2IA 3I75A 1R5WA 1ZLVK 3VXOB 2ZVOB 2B39A 4EOWH 2ZUSA 1KYOK 3DJSA 4XCYA 2IC2A 4FA6A 2CIIA 2YFNA 5CGYD 3OB8A 3MNWA 1LDPL 3B8EB 2VM3A 3VI4F 1N7MH 2W0PA 3KCPB 4OT1H 2B59A 2VDKL 4RVBA 3HE4A 2ICEC 1JGUH 4QKXB 4XN4A 1M57D 1L0ND 4PJ7B 5D2LE 4R2GC 3ZQXA 3MJGX 3FBKA 3OKDB 1QKZL 2GITB 1KDIA 2WWMC 2B0SH 3T3PE 1DIPA 1CICB 1CVRA 5JHBA 3D2UB 5GSRA 1BZ8A 4L9LC 1I9JL 2ARJA 5DJ0B 5DZVA 3S48A 4KQ0A 1UXSB 4N8CH 2V5YA 2CGZA 1HVVA 1GMIA 1DQML 3PQYD 1JI2A 1QVFO 1WFJA 1ZKAA 3TTSA 3IBOA 3GRGA 4EE2A 5DK3A 5BQDA 6CGTA 3RIAF 1I3RA 1IEAA 3LEVL 2VQ1B 5C0AE