2ZXEB

Crystal structure of the sodium - potassium pump in the e2.2k+.pi state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
RTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Crystal structure of the sodium - potassium pump at 2.4 A resolution
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 51
structure length 265
sequence length 278
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zxeB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 2zxeB02
5APXA 4HYTB 2ZXEB 3VMXA 5AVTB 4LC1A 2C9LY 2IPPA 2YO3A 1OXZA 1FOSF 1HBWA 1HUCA 5APSA 3B8EB 4C7NA 2WWWA 3L35A 4RESB 2JJLA 2BASA 5AW1B 1A02J 2QM8A 2WPQA 2Z5IA 3IR9A 3LIEA 5AW4B 1MV8A 3V5BA 1HJBA 2E42A 3T97A 4EOTA 1SLQA 2WT7B 3MD0A 1FAVA 4GKGA 1MFZA 1S9KD 3A7OA 4JYBA 2Z5HA 3WGUB 1GU5A 3A3YB 1GD2E 3VN0A 2YNYA 2YO2A 1T2KD 3TK1A 1H89A 3TYYA 3M91A 1CI6B 1FOSE 3A2AA 4DZOA 3NXSA 3TNUB 4GT1A 3M06A 3M9HA 3LIDA 2KP8A 1JUNA 5AVSB 4XE5B 5AVWB 1IO4A 1GK6A 2Q3IA 5AW2B 3M9BA 4KHXA 2R5DA 3L37A 3I5CA 5AVYB 2XZRA 2XV5A 3M0DA 4JYCA 4AYCA 1KQLA 2R5BA 4B86A 5AVVB 4RETB 1DH3A 2H7HA 3M0AA 2XU6A 1H88A 1MUUA 5APVA 3TNUA 1H8AA 1J2JB 3OAKA 2N9BA 5APQA 1G2CB 3NTNA 5AW6B 5APWA 3UIAA 1CZQA 5AVQB 5AW8B 2WT7A 1NAFA 1CSBA 2E43A 3KQGA 3HE5B 3P8MC 1NWQA 4C46A 1X8YA 3O8ZA 1S9KE 1GK4A 2QM7A 4M3LA 3HE4B 2P2UA 1GZLA 2P67A 4I2LC 3NFQA 3HTKA 2W27A 3SWFA 3VMYA 2C9NY 2W6AA 5AVRB 3WGVB 2WPSA 5APYA 1CI6A 3A5TA 1T2KC 1OWAA 3KDPB 5AVXB 3V4QA 1JNMA 2WPRA 5AVZB 3VMZA 3HE5A 2R3CA 2ZFCA 1GU4A 3HE4A 5AW9B 3P7KA 3V4WA 4I6MC 2Q5UA 5APTA 5AW3B 3MGNA 3VYIA 3NMDA 5CMZA 2WTYA 2VRSA 3P32A 4C7NB 1GTWA 5AW7B 1A02F 1SP4A 5AW0B 5AW5B 2Q7CA 5APUA 5AVUB 4AQRD 4AUWA 2P7JA 1HWTC 1YYCA 3VTPC 3L36A 2R32A
chains in the Genus database with same CATH superfamily
1ZEAH 1DJIA 1KIQA 5C0BE 4XNYH 4XN8A 2C0WA 1NJIQ 4MB5A 3ULAB 3CZEA 2OPCA 4QCIB 3PWPB 3LKSB 3S97C 2AVFA 3SPJA 1S5HB 2JK5A 3C2AL 3DIDA 5MHSD 1DJWA 3VWJC 4WFGD 1UOKA 4JY6A 4OQTL 2O5XL 1ZGLA 1IBDA 5F1IA 5CBAA 5INCB 1XO8A 4UB6E 5F7AA 5DURB 1WA2X 3T5WA 1BLNA 1HESA 3QPQD 3HAEG 4JYBA 4KKPA 5IBTH 1T0PB 4N2BA 1TYJA 1H3VA 5D1XB 1HYRC 2G3AA 2X89A 3GXUB 4QKXB 5LBSL 3V55A 2VC2H 4ZNCD 5J13B 3D9AL 3BH8B 4D7PA 2VSDA 1NU1K 2RHEA 3TCLA 1AVAA 1LT9A 5I1EH 2ORBH 4U1MA 2W59A 2C26A 4IOFD 1ZDSA 3BP6B 1GSMA 3DI2B 4LOUC 1LP9E 2Y69B 4YSCA 1PG7W 5HTSA 3HN3A 2AEQL 2HKHH 1PZ5B 4PJXA 4JQIA 2AXTE 4X6BB 2EDFA 4MNQE 3E8VA 3B37A 1E0OB 5J1TC 5DRXB 3UEZA 3HOGA 5KLIC 1Q0EA 1IO4A 3MBEA 3UZEA 3ARUA 3BVHA 3PAVA 3C75A 4QRRD 2AI0H 4PJBA 3HN5A 3D2TA 2BW4A 2A77L 2FYUG 1MWOA 4PJAE 1E6JL 1IC2A 4PJ0H 1Q94A 4I0KA 4JANA 4NT6A 2V2XB 3NTNA 4BQCA 3FO1B 1O9ZA 2WBXA 4HZLA 5JHLH 3QCTH 2DBJA 2WQSA 2FL5B 1JY2P 1VAHA 1WTLA 3JVGA 4HGKC 1VZIA 1UCTA 2DH3A 2X4RA 4PV1B 4JFYB 1I9JH 1OV8A 3K6DA 3RDTC 1AQDB 4KHXH 3C8VA 2YPVH 4QOKE 2OCJA 3GBML 4MQ7B 1JHTB 2BZCA 1NGMB 1DDHA 1GAFL 1K3IA 2FHCA 4XOEA 3MLVL 5M95B 5KBPA 3MV7B 2OQJB 1TQBC 3Q13A 4NO0A 3FUFA 2IOMA 4RGND 4W1TA 4XAWL 3U46B 5LN4A 3H1HD 2Y1VA 1TQUA 3SDDC 3RIAF 3QCVL 5FB8A 2Y9ZA 2CO6B 2H1PH 4WEBH 1SY6L 1UG9A 4K5OA 3U6RA 5CD5C 3EDFA 2YN3A 5DFVD 3GIZH 1LGHB 5HYSG 1BA9A 4E68A 1J0YA 4XO3A 4Z7QE 3BUYA 2KLVA 1EEYA 1HSAA 1NCCL 2J56A 1OHQA 3OTTA 4IRSB 4OB5H 3F84A 5CIPA 3WMSA 2ZYHA 3WN5C 4WI8A 1UHVA 3HPJA 5AVUB 1A22B 5AD0B 1BE3J 5J6HB 4XVJL 3ILEA 1M7UA 3MUJA 1UM6L 3L45A 4G8GA 2HX9A 4PJHB 3L71E 3LYRA 5E79E 4PRHB 5KOMC 4L8BA 1NPJA 1VQ4P 2YXMA 3N50A 3MJ9H 4P4KB 5B39G 1LP9F 1NFIA 2O01N 1A02J 1OIPA 3LJ3A 4G6JL 4FRWA 1GOFA 2XC8A 1FGNL 2L8AA 3CL3D 1UOWA 3TIDB 2VUOA 4FYRA 5L4FA 1BFVH 3VGAC 4QHKI 1AZUA 2XVKA 3CSYB 4I3RH 4NHUA 2YUVA 5JPMB 4FA8A 3T6XA 3HLKA 1BFOA 1TCRA 4WI9A 4ZMLA 2XWDA 1U0QA 4BA8A 4I1RA 1KYFA 1OAXL 4MXVE 1LO0L 2K3TA 4PJAF 4DGIL 5GTHE 1Q82Q 1D7MA 3SBRA 3KGTA 5A2CA 2J73A 1B6UA 3E6FA 1X6NA 4FQXB 4X7TB 1FFOB 5FW7A 5I1HH 4ODBD 4CGUB 2HN7A 1MJ8H 2OKMA 5HHNA 3NRPA 2JR8A 1NIFA 2H2PD 1YEGL 3G5ZA 3CFJA 3P0YH 1XGYH 4LSVL 4HJ0C 5DK2A 5E03A 4WVZA 1YDPA 3HNSL 3BRTB 3QRBA 2O61A 2K9YA 3U9PH 4EDWL 1QSFA 3ZKMC 1BECA 1QNIA 1CFNB 3S2CA 1QRND 1YC7A 3UYPA 1EHKB 2EADA 3MV8B 4AQEA 2PETA 1XR8B 4G7VL 5I1IL 4LQFH 5E94B 1ZS2A 3TBTA 3FQNB 4TUKL 2Y72A 4YDIH 3OKOB 3THML 1KTLA 2A45I 3GD1C 5FECA 5J89A 3TT1H 3F8UB 1PZDA 3SDXE 3L4FA 3IBEA 2YRLA 4GXUN 1DBAL 1WFUA 1Z32X 3QHZH 3AY4A 4G8FA 4PRDB 5IQ9A 3TO4B 4A2HA 4BXVA 3VFOA 1RJZB 4CILA 3NCBB 1FBMA 3SDCA 2E43A 4WF7A 3U4KA 4HS8L 4ZBJA 5DLLA 1A0QL 4UBDD 1WWCA 1YJWP 1MCQA 8FABA 3OHMB 3MJ7B 3QNXB 1FWXA 3KLQA 1YNLH 3CI9A 3RBZA 2NX5A 3EJJX 2UVFA 4Y5VA 1AV1A 5KSAD 3NFSL 1CFVH 4TVPH 5HBBA 1BVLA 1GPOH 3V2PA 4NNYB 3AS1A 1INQA 2R3CA 4OGXL 3H9SD 2YJLA 3V0DA 3U6XA 4MMYB 3B83A 1HSBA 3I6LE 1SJHB 2WKOA 3P0VH 5DK0B 3V4PH 5SWZB 1JN6B 3EFGA 1S7UA 2F58H 5ESQB 1Q7YQ 4MS6A 3M7FB 4PJ9D 4OD3L 4FYSA 3KPSE 3OKYA 2LXBA 4JDEA 5J57B 3T0EA 1YN7B 4I4WB 1T1WA 1YECL 1KPRB 3FUIA 1T83A 4MXVF 3BQUA 3VX0A 1X5LA 1JK9A 3L54A 5D1QB 1U6AH 1N0XL 2YO3A 4JPIB 4TQIA 4ZX5A 2QSCH 3UZVA 1K5WA 1MFCL 2L04A 3T4AC 2JI2A 1CGSL 1NGPH 4LESA 3VWKC 3QXDA 4C7RA 2IBZX 3FB7A 4Z3HA 4OCXL 3WY2A 4L75A 4HWBL 3TWCH 2NY4D 3MRBB 2VW6A 2JI3A 4FFYL 3KPMA 4G7QB 1ZPUA 3V8OA 4DP4X 3W5NA 1TUPA 5KVGL 2B4CL 3HZVA 2O5ZH 1J1XH 3WV0A 3OVUB 5E6IB 1ZJAA 1DQDL 4FJYA 5DS2A 2N01B 5I73C 1FZJA 3V2RA 2WIIA 4RISH 1B3JA 2I9TB 2IPTH 2WANA 4FNSA 1IAOB 2NPSB 2BNRD 4WI0B 5BNXD 3SDXF 3WTWA 3DX2A 2XV2A 1U8IA 4IRSD 3MLWL 1B0RB 3V6FA 3IFPA 4I88A 5H4YA 4JDVB 3KM2A 4HIJB 4PJFA 1RULH 2NZ9D 4NQSB 2X2YA 1ZTXH 3BKYL 3OMIB 5C7ZA 2BIMA 2YRZA 2LQRA 4NZUH 3CHRA 3NPSB 3ECBB 2G2PA 1ZRUA 4JHBA 2H0EA 4QMAA 5IHZB 1CMOA 5PCYA 2J7LA 4HJGA 2B87B 2RN0A 1AZVA 4LKXB 3V4PB 1KXQE 5AOMA 4JQVC 1MVFA 4RETB 3VFRB 3DJ9A 1G7MA 1V3LA 3GKWL 2C9AA 4Y4HB 3IRPX 2ZX5A 3K4DA 4GPVA 3UIAA 2J12B 1LDPL 1AKJA 5ADOL 3WIIH 3EO0A 1NAFA 1N5AA 4Z9KB 1MRFH 5E5MB 3T2QA 3HE5B 2D73A 5TE4H 4JFSA 3T04D 4P2RA 2JCCF 5ACMA 2VE6A 4PRNB 3NPZB 2NR6C 4PCTA 5LCVL 4M8VA 2Z93A 3BPOB 3F64A 1LO4L 2JNZA 4KK5D 1KOAA 1AXTH 1HINH 1MF2H 4IIQB 5HVHC 5K1NA 3MR9A 1K73Q 5AOJA 1PPJD 2ZXWB 2YAFA 3RHWK 3ZHFA 1EEZB 1ADQH 4WWKA 2DM7A 2AJYH 3KJ4B 3CCEP 1W72L 4DAGL 4LCIL 2GCYB 2ZX8A 4M7KH 1GW3A 1TJHL 3VMOA 3OR6B 4FNUA 3MRRA 3HUSB 2XQYA 1M57D 1P1ZB 2XIBA 3CWBE 4FZ8L 4YK4B 5E4EB 4ODUB 4TUUA 3P3RA 3D4CA 3SWKA 3VOPA 2HTKD 1YJDC 4IU2B 1U8HA 2XX1A 1FL3A 3FUDA 2OR7A 1KBKA 3CLQA 2ATAA 5FM4A 1IFHH 1NBZB 1R24A 4F7CB 2VDQL 1AXIB 5K39B 2NLJB 1VPCA 2H6PA 1N19A 2EIZB 1CXEA 1FL5A 1R5WA 3RUGF 5E6SB 4EN3D 1AHKA 2FX7H 2MOGA 3W9EB 1T3JA 1NBYA 3QS2A 1IL1B 1E8WA 1FNEA 3GMMB 4S1SH 4C57C 4OCWH 3WU2E 3MRQA 4JVWA 4YHYB 5GGQH 2WCGA 3F7YA 3MFFA 1E5AA 1FVCB 2M3EA 4G5ZH 4JM2F 4LVHB 4HW6A 2Z4TA 2M26A 3RG1C 4QKTA 4OZ4A 4KJWC 2EE0A 2K1MA 4GSDH 4FMKA 1IJ9A 4Q52A 2LR2A 2DY2A 1KILA 5I5JA 1HZLA 1CD8A 2CAKA 2AXGA 5SWZD 1WAAA 2XWRA 4UUJA 2C0XA 1NC2B 1VKXB 1AYOA 4BSVB 4L4VB 1MFTA 4Z23A 3PTZA 1T80A 1EGJL 4PGEA 5D70H 2H7WA 3LKRB 3QFJB 1E43A 3ZZQA 1IAKA 1JUNA 1JRHH 3BCCJ 2QHLA 4HX1B 4LCWB 3EZ8A 5B38B 1D2OA 1SNRA 5D7KD 5T1LA 5AVWB 7TAAA 1EXIA 1HN1A 3BKMH 4UT9H 3BVXA 4WEMB 3VYOA 3L37A 1VQ6P 3B34A 5E2WL 2W0LA 1TZIA 4HH9A 1V7MH 5C0JB 2R5BA 3W5MA 1AJYA 4PJ5E 3WI9A 1EEQA 3MHVA 3RZCD 1RURH 3F12A 3LB6C 4E41D 3LPFA 3E38A 2EXYD 4LOFA 4OKVB 5A7EA 2YKLH 1I85A 4TULL 3RWFA 4OVUA 4FKEA 4Z78A 3I9GH 4ZAKB 3PIQA 4TQEH 4JVUA 1OTSC 1KENL 5SWQA 4PLOB 1RUKH 4HLZG 5I6PA 4F37K 1F1DA 2AEPH 3KCWA 4QHKJ 4J3BA 4BYHA 1N12A 1E27B 4NIKB 2IGFL 1QR1A 3MNWB 1FZKA 5SX5K 3UTQB 3BLBA 1I8AA 3BQVA 1XVSA 1OARL 2ESVE 2OXGB 3Q9PA 3DIFB 2PWDA 4L8DB 1HXMA 5IB3B 2MQGA 3CN4A 1Y9BA 1FIGL 1TEGA 1NAKH 3BUPA 1I7RB 3V52H 4OLYL 3KR3L 1U7MA 2AQRA 2BSCA 2E47A 3HKZA 4XX1E 1HHJB 1K8AQ 3S9OA 2DD8L 2GA1A 4ZFGH 2A06G 4B9CA 1L4AA 4CJ0A 3QDMD 4PS4H 4GP4B 1JY3P 2AAVA 3GS7A 4D9QE 4W9JC 2OA9A 4FMVA 5T3ZD 4C4BA 5CCGE 3MVSA 2E6JA 4WNQA 2QMJA 2CIIB 4J27A 4XOAA 5FXCH 3ZTCC 5CCGC 2ALWA 2CUHA 3FTUA 3PGCB 3HRNA 3D3VA 3MA9L 4Y4HD 3FYIB 1UURA 3RDJA 4BIKA 3TBYA 1VQLP 5EU5A 3DMMA 2NT0A 3AUVA 1CGVA 2PO6B 5E6RB 3ZT5A 2Q86A 3CU1A 4NO3B 3TPUB 3ZRFC 5LG1A 5D2LB 3VGBA 4U7JA 2AK1H 3CX5E 3ZSSA 1JZFA 4O5LL 3ABGA 2FNWA 3CZKA 3WY4A 4XNUL 2C3VA 5EOCH 1IT9L 2EEXA 4LLYA 2HFFB 1EDKA 2YMKA 3EOYG 2F19H 2CGRH 3T97A 4YDKH 3RY6C 4LFHG 1MCPH 1WA0X 1S3KH 2CE6A 1G1CA 1QSED 2WPGA 3E1IA 2BSED 4QYOA 5D9SB 4FERA 1WBXA 4AJVA 4K7PL 4EXKA 1GGUA 2HFED 4KXZH 2YGOA 4YVNA 2KZIA 1JDAA 3NK3A 3RAJH 1QWUA 1T1ZA 3G6EP 2AJVL 2ED9A 1U8MA 2F7QA 5FGCB 3P4LA 3LNGA 1WEJL 3ULUH 5ANMA 1Q9WB 3QI9A 1BBJB 4JQIH 3L3HA 4XN5A 4GRLA 1DN2A 2GFBA 4AC2A 4ODTH 2OMZB 1IM3B 2FXMA 2VDMH 4J3WA 5SWSD 4I9WE 1URQC 1ZT1B 3CX2A 5B1JC 4AWJC 1TYRA 4G59C 5FWRA 2GEQA 1L0LE 4A7GF 1D7BA 1S9XB 2X41A 3QUXD 3QAQA 3FXDA 3GSWB 1FFPA 1X9RA 4OCSL 3IFNH 4OJEH 1DQMH 4QRQB 3VFSB 2DLFH 2F0CA 3PNRB 2HZHA 2FJHB 3QS3A 4FYTA 4UAOC 5BU5A 4FFWD 4WNQB 3WIHA 1R3HA 4ANWA 1KIQB 5DRNA 4D8OA 2WUBH 3SCMA 2MQCA 2NY6D 2JK5B 1D5MA 4MLSA 1LP1A 2FECL 1SRDA 3GSNA 4AQ8A 3GXFA 1VL2A 1QFWI 1TFPA 4JY6B 4NCC2 5HI5C 4DP2X 2ZWSA 5HVGB 3COOA 4Q74A 4JFZH 4H0LB 4M1DL 5F1IB 4WUUE 1NCOA 4CMMA 5CBAB 2ZOUA 2KOGA 2IZ1A 5T3ZL 1GH7A 4LB8A 2DS4A 1ULVA 1BLNB 4LPCA 4BGDA 5IG7A 4MD5A 4IMKC 1OPGL 1MFMA 3L5XL 4NN5B 3O9WB 4G1EA 4JG5A 3ZE2F 2F08A 2DN7A 3OL2A 2P28B 3MV9E 1XAUA 1LTAC 1FZCA 1FSKB 2QADD 3C5SA 2QA4P 3KWTA 1QL1A 4KDVA 1TTBA 2ITFA 4GI8A 1VQKP 4G43B 1RXLA 4F2EA 1LT9B 1T2QH 5CIPH 4U1MB 2VXVH 4P5TC 4QYAA 4F93B 4F8NA 3TEXA 4J3OD 1JM0A 1CXHA 1KN2H 3BUTA 3HB3D 3QDGB 5EBMA 1RZQA 4N2AA 2IDCA 3VGHA 3QULA 5JPNA 3RY5A 1UJ3B 2YR3A 3KW7A 1PZ2A 1HX0A 1R3JA 1Y7VA 1O6SA 2J1KA 3PQYA 1HH0A 1ZHLA 4XNZC 3V5KB 3ULVF 3VD4A 1JZ4A 3VTPC 2MNJB 4MNGA 3X3GL 1O6TA 3LSOB 2C9LY 2Z65C 2XZQL 4RMTA 2AJUH 2Z31A 3KGUA 4PD4D 4PJBB 5FO7A 3UROR 4QHLA 2J72A 1SQBD 2OZ4H 2XYBA 3F83A 4CNIB 5LGYA 5DUML 4PVMA 2HA1A 2CO7A 1Q94B 2XY2A 4JANB 4R4BA 3UO1L 4AEIH 4EN2A 4NT6B 4PIBA 4AK1A 4HZLB 4WHTA 1H8OA 1BZEA 1ZHKA 6CGTA 1MJJA 3C60D 4JB9L 2CA4A 2ZYIA 1AGFA 4PY7A 2IIJA 4R5VA 2RIKA 5GRWA 4I8DA 2F53A 3PHOA 1KB9I 3O0RL 2YNYA 3GMQA 5D2NA 2OULB 1H5BC 3IT8D 5DHYA 3EBAA 4FXGA 4NNXA 4IKLA 3ATDA 4NO0B 4CAGA 3GRBA 4PWGA 1XH3A 4FXTA 2AJZB 3LS5H 1MWAH 4DGYL 1NLDL 4AUJA 3L73G 4X0NA 5HVFB 4C56D 5FB8B 2I7SA 1A4JA 2NY7L 1NIEA 5C3IA 3EBIA 5TF1L 5KJRL 3PY9A 3U6RB 2KI6A 4E9RA 5ALCL 3ZHDA 3D6ZA 4GMTH 5FKPA 1P9MA 1TZGH 1EEYB 2XVGA 3M6DA 5CIPB 3HZMA 2IQ9H 3RK2B 5KEZA 4GAJL 4LSUH 5BZZA 2IBZI 2IH8A 1TVBB 2V8LA 1BYNA 3NIGF 2CHNA 3UTPE 3GSXA 4G8GB 2VZUA 1YUHA 4OZGA 3PRJA 5FO8B 1QG3A 3PFUA 4L8BB 5F1SA 2A9BA 2YQGA 3CMOH 3E1ZA 2Q20A 1P7QD 1X5ZA 1NFIB 4FQJL 2PW2A 3NJVA 4M3LA 5I26A 2EO7A 2VDOH 1YMMA 4N3YB 3QIUA 1VQ7P 3BCFA 2EAEA 1GJIA 1CIUA 2QQNL 2R4SH 1IAMA 2XBZA 2WLKA 2NY3B 3UYRL 1NTZK 5LAXA 3EJSA 4NHUB 3D0VA 1GSKA 4G80B 4DUWA 3PNWA 5E99H 2VJ8A 1TCRB 3LZFH 1I1FB 3W0WE 3REWA 3NJNA 1IM3D 2X88A 4ZS6C 4CADB 1HKLH 2I60H 4HT1H 4FI7A 4B60A 5HXMA 2ZOTA 3E6FB 4JK0D 1IC0A 2ERJC 2Q1EA 1QLED 2PPAA 1OTTC 2APWA 3CFJB 1E4XH 3QJHB 4LRIA 5SX5H 4AEFA 4Z8FH 5DK2B 3V4VH 1XIWD 2BCCJ 1YDPB 1H15A 5D7LB 4NLHA 2O61B 2MRYA 2YK1L 1URZA 1A02N 1FN4B 5SX4H 4Z7NB 2QE7H 2XA8H 2M3BA 1SGKA 3UYPB 4GB9A 2R8SH 4AQEB 4X8CA 4GG6F 3VP8A 4PWIA 3TBTB 4BFFA 3KPTA 5CJ0A 2ZSVA 4KKBC 3RTQC 1I8LA 3CFTA 4FG0A 5I1GL 1KTLB 5IIEA 1OSYA 4MA8H 5EH1A 3EYOA 4TSAH 1LJMA 1ES0A 3MCLH 4HFUH 3EJYC 5KG9B 4DW2L 4G8FB 5EIVA 1FBIL 4F2MA 5IQ9B 3HI1A 4MAUL 3VFOB 3OX8A 1VQMP 4NUGH 2APBA 3OKMA 3Q8EA 2E8ZA 4GJTB 3HD7C 1EAOA 2BJML 4ELMA 2J8UB 1CICA 4YVUA 2YWZA 3Q1EA 3QZNA 1ZPLA 2FEDD 2VDOB 4GYBA 2H3NA 3SGDH 8FABB 4MS8C 2BY1A 2NX5B 2BVQB 1VEOA 1RQ5A 1GL2A 4Y5VB 1BVLB 2V4HA 4JG0L 1INQB 2KYVA 1SQMA 2RCSH 3C5ZA 3ARSA 2OP4H 3CCHA 3LZLA 3I84A 4JREC 5DD5L 3TZVA 1VF5C 2QJKC 3IU3A 5CZKA 2M8XA 4LARL 3TJHD 4APQA 2JSFA 1C5CH 3G5VA 1HSBB 2D2CB 4P9HL 5LLIC 4U1KA 3MBED 1HGZA 3V2AR 3WKYA 4U3SA 2YAEA 4BA0A 2FWUA 3ARQA 3IDGA 5FYKE 3CVIH 3C6LA 5BRPA 4OF7A 4AUYA 3C1LA 1M2VA 1XZ0A 4FNTA 3T0EB 2CR3A 2Y23A 3WEOA 3SOBH 1AQTA 1HWWA 2H4EA 2WBJC 5ILTL 3NVQA 1U2HA 1UKTA 3EIFA 4TM9A 3U30B 3FUEA 2P26A 3ZOAA 4G6FD 3JT2A 2O72A 1MY7A 3UZVB 1DJHA 4JPWL 1SLWA 2FJUB 4WKZA 5HPMA 5DEGA 2ARJA 3QXDB 4GEIA 3FB7B 1PFCA 1HEHC 4GSXA 4P2AA 3O4OC 2SPZA 2ILLA 2FGWH 1JPTL 1KIUB 1J5IA 1QLEL 4D7BA 3NFNB 4ONOA 1E5ZA 3KJ6H 2N59A 5JXEC 4JBZA 2FSDA 1BLIA 4IBTA 4OM1L 5I6LA 3BEVA 1FI8C 1ZJBA 1FZJB 4HIHA 5C0CE 5JQ6H 2X6VA 1FNLA 4NAQA 4L8SA 3E2HB 2IVFC 4A63A 1V05A 5IM7A 4GQZA 15C8L 1U8IB 2B89A 3OB0K 3IFPB 3KXFE 1TOXA 4RZCA 4ZYKA 4PJFB 1V8HA 1SYSA 4UM9B 1JNHA 4A2MA 1MI5E 1GY2A 1K8DA 2Y3AA 5I28A 3BIBX 3AEBC 5GGRB 1LTGC 1G2CA 3NGBB 5IQ7L 3K3QA 2NNXA 4KK6C 3ZXAC 5HYJB 1PZAA 1Z9SA 2OYHC 3QWOC 4HJGB 4YJZL 4TTGA 3R8QA 4RCAA 1JTHB 2ALAA 4UB8H 3JCUE 4OGQC 3FUNA 4WIQA 4B50A 4KVPA 1G7MB 3T0DA 4XTRC 2DIJA 2BSSA 4OJCA 3VFVA 4CVUA 2KNCA 5GZNC 2CLVA 4OIFA 3QUYA 1T89C 1TTAA 1AKJB 2XDJA 4GKLA 3EYUH 3EO0B 2QR0A 2E5YA 1N5AB 2JB6A 2LU5A 3S35H 4P2CG 4B0MB 1P4BL 3CPLB 1JNJA 3QXAA 4ZMNA 1QNZH 4P2RB 2Q3ZA 4AVIA 5CN1A 3T3PF 2VE6B 4P99A 5EC1A 5BW7C 3FB8A 4P2QA 1P84K 2V17H 2PP7A 1AMXA 4BFEA 3QEQE 1SQPG 1SPDA 2WZAA 3BAEL 2XU9A 1MCHA 5TF0A 1JK8A 4BFKA 3MR9B 4Y1AA 4LASL 4UILH 1KCVH 3EDKA 4ORZC 4WWKB 3ZE2E 4R7DA 1L3WA 3OQRA 1JIBA 4QTIH 1QSFD 3WCYA 4P46A 4WFEE 3K4ZA 2WNGA 1P4LB 3MRRB 1JP5A 4D6TG 5C0NC 4W9ZA 3W67A 3NCYS 3H3PH 4WW1A 1JPSL 4KKCD 1U8CB 5B7EA 1ACYL 1BZ9A 1BCCG 5DEZA 3RVTD 2JMRA 1GHFH 3GO1H 4C83A 1FL3B 3O3UN 3S5YA 1X9UA 1R24B 5JO5A 1L0NE 3QP3A 5D7HA 1FE8H 1YEJH 2H6PB 4X98B 5GIRA 3QYMA 3KS0J 1BD2B 5F0JB 3SDCD 1FL5B 1R5WB 1LO2H 4U7SA 1J5CA 5FF6B 3CIAA 1IVTA 2PGDA 1U91A 1A6WL 5C70A 1KN7A 3NIDF 1NBYB 1FNEB 2WOBA 5H2FH 4P23B 3WNOA 1RJYB 3MRQB 3B8SA 4NQQA 2UWEE 4AG4H 4C58B 2DKSA 3F7YB 3MFFB 2YLKA 1KB9J 1IBZA 1QW8A 3GB7A 3NSJA 4PY8I 1USQA 1W2KT 4ZO7A 5F9AC 2QPSA 4FFTA 4F1SA 3AREB 4LIQL 3WJMA 4OZ4B 3HHRB 4FNRA 3TA3D 3JZ7A 3SSUA 4AOFA 2AXGB 4UUJB 3DETC 2VM4A 4YHML 1AJ7L 3ABLB 3EOBA 1BGYE 2VT0A 4Y4FA 3D9AH 2HMIC 1TF4A 3VD9A 3VH8G 3VG9B 5I1KL 4Q2ZB 3PDGA 3BAIA 4HGWA 1KY7A 2BP8B 3FRPB 1CDHA 3BQUD 5T1LB 1HNFA 2X1XR 2CNZA 3CHQA 2YAQA 2EC8A 2AEQH 3UTSE 2H8PB 3APFA 4K3JL 4CA4A 4AITA 3D4ZA 1PW3A 2UY6A 1TZIB 4HH9B 2ZX7A 3IMBA 1S7XB 3BPNB 1M1JC 1DQJA 1H6UA 3GGWA 1EZVG 2VWEE 3F12B 1U3JA 2JO1A 4ODVL 2I9LA 5CGYD 2WN2A 4FTVE 2QQKH 1E5CA 2VWEC 4LGSB 4DO4A 4UTAA 4DZ8B 3RWFB 2A77H 2DTSA 1OP4A 5F9OH 3MRGA 4Z78B 1R0AH 4O2FA 3WJJC 1QHQA 3R18A 1CYWA 3N40F 1U92A 4L0YA 3ROOA 2YO2A 2HT4D 3ZTJG 4KRPB 3ZKXB 4KO5A 4Z7WA 3CSFA 1Z2KA 1DBBL 2V3FA 3ARFC 3MRJA 1WFIA 3I56P 1L7IH 2ZUXA 5IVZB 1HXMB 3GBMH 2GY7B 3VFPA 1L0NG 4PH8A 5FO2A 5INDA 2UZXA 3FU9A 5D4IA 1JVOA 3VD7A 1RHFA 4LU5L 3L8QA 4PLJC 5IHHA 5F96H 1SY6H 2YAPA 5FV2A 3QVAA 2BVPB 3OSKA 4G42B 1TVHB 2P5WE 3SGJA 2ENYA 2A6KA 5APVA 4JRXA 4LBEA 1NCCH 1RMFL 1KN4H 3BYTA 3D3VB 1DEDA 3TBYB 3DMMB 3EFDL 1H8LA 2BP0B 1ZOYC 2Q86B 2ZUQB 5D1XC 5JXAL 4Z5RB 4I0CC 5J13C 3HS8A 4U1SA 5FCUH 4JZOA 1NTMJ 3UTTA 2C3VB 3BSZH 2GHWB 4LE8A 4LLYB 3PHLA 1MCSA 2Q76A 4FGMA 4U3FE 3G5XA 2IDQA 5JW4R 3H2WA 1G6RL 5CFHA 3T97B 1P5UA 3V0EA 1O7SA 1P53A 1JYVA 5J3HD 3H7LA 1WBXB 5BRQA 5AVXB 4A7VA 3OG4B 2E75D 5LQBL 5KBDA 3RJDA 1OLZA 1RP8A 4G6AC 4JS7A 4MD4A 2O6PA 4QAWA 3ZW3A 3L4CA 1LYQA 1PG7X 3CC2P 2NNAA 4H0HB 2UZIH 3QI9B 4ZMXA 5EDSA 3L3HB 3ZKSD 4XC3H 4C7NB 1JXDA 2LU7A 5C86A 5GRVL 5A3IC 1LO0H 2ITDA 4K3AA 2RJMA 3UGEA 4AIZB 3BAJA 4URKA 3UABA 2QJPB 1MH5A 5GSVA 5C6WH 1KGIA 1BQHB 3MDJA 3TTYA 2DQJL 1FP5A 4LBAA 2CK0H 1VFAA 4IBZA 4LSVH 5IW1A 4PV1C 1PZUB 2Y6SD 4LSPH 3HNSH 5E95B 4FC3E 1U4FA 1WYJA 3P3TA 4N68A 4LO9A 3L70J 2Y7OA 3OB0H 3BRGC 3TT3H 2JP3A 4HJIA 5F7BA 3IDMA 2Z5IA 4QI3A 4WB4A 3CQFA 5EU3A 2IFNA 1RY7B 4HDIA 3RNKA 3EGSA 4G7VH 3S6CA 3NEXA 3SCMB 3FU5A 2X0UA 3G6JF 3FUHA 2YIHA 5HDBE 5F0PB 1D5MB 3QBTB 1LP1B 1LWUA 2YD8A 3DVGA 3S4SG 1KC5L 1PYWB 1TU2A 2Y0EA 1UCBL 1DBAH 2NY2D 1PIXA 1KILD 5J11C 2X6MA 3DX7A 4RGMC 4HU2A 4CMMB 1D6VL 3SE4C 3BDXA 1EC5A 3SQOL 4JFFE 4KRNA 5IG7B 4MD5B 1W5CE 3C5JB 1OP3K 3P30H 4G1EB 2EDWA 3QG6A 2UXVA 3BN3B 4YUEH 5IEHA 1FZCB 3V7AG 4QWWD 3C5SB 2QGDA 4RFOH 3WD5L 1WP6A 4XODA 1CF8L 2NQCA 3NFSH 1P84H 4P4KC 5EBMB 4OGXH 3R4YA 1S5IL 3MOQA 3CZFA 3QULB 5DUBB 1NZRA 3L4TA 3BWZA 4LGDE 4PJ0E 1CLYL 1Y0LA 3L75E 4KKQA 3CUPA 3CVCA 3WUVA 3W38A 1ZHLB 2DAVA 1PX3A 3WY1A 4QAMB 3CH1B 5FW8A 1H9DA 4XP9H 5JA8B 1T6VN 1SMAA 1AANA 3QUHA 5JPMC 4E9VA 3FT9A 4PLNC 2Z31B 1TXKA 3UMTA 1YEDA 4QHLB 2P8PA 3FOMA 2KH2B 3HR5A 1S9KE 2A6IA 2V5RA 5DHEA 4NQXA 4QGTA 1YNTF 5A6LA 2CO7B 4R4BB 2BCMA 1BSNA 1UATA 3L74E 3BP4B 3AGVA 3RL0C 4FQXC 4WHTB 1ZHKB 2D7OA 1CVSC 1BEXA 1EX0A 2JTDA 3IE9A 3IJ8A 4ZW3A 5TQ2H 1AGFB 4PY7B 4OCXH 3DOIA 5AVZB 4HWBH 3PHOB 1S78C 3EH2A 3QUZA 4Z7VB 2WWKT 4YH6A 5D2NB 3GMQB 3ZVVA 1GU4A 2D3LA 1PY4A 5KVGH 5DHYB 2H0PA 3O81A 1NGZA 4FXGB 4YFDB 5FUZH 3FTSA 4GG8A 1CZ8H 2W5PA 4U6XA 5CWSA 4B41A 1L4AD 2KPNA 5K59E 1RPUA 1SQVE 4EUPA 3BLPX 3CN0A 2NSQA 4YS4A 1ORQB 4O4YL 1OLLA 1XH3B 4BBWA 1SJVA 5D7JD 5HDBF 3O3AB 4AQ1A 3BYYA 2ZWYA 1U93A 2NYYD 1A4JB 4R96A 1N0LA 3Q5OA 1P0SE 4KFMA 1AIZA 3EJQA 4JE0A 4JM4L 4P05A 5IMOA 4XWGH 4YE0A 5JHDE 3OHXC 5HHMB 3TO4C 2BNQA 2XN9D 2B1OA 1IVLA 4OF8A 5DMKA 1JPST 1KZUB 2H32H 3HZMB 3BPLB 1NGXA 4HV8B 4JL1A 4JZJB 1SUHA 1PGPA 2N1TE 4RESB 1QFUH 1YQVL 1MAKA 2AK4A 3NG5A 3SJVA 3ZDZB 1MFBL 1HL8A 5SV3A 1GGBL 3B2UD 2N1TC 3TVMA 3UAJD 3L7FB 1X9VA 3GSXB 3ZE1F 5L2KA 1WUNT 1YYLL 4OZGB 5CCHE 3FUMA 3ZU8A 1SLQA 3Q5YA 2IWGA 1A7NL 1AZRA 5D71L 3QZBA 2ZUSA 5CCHC 3EFOA 2HPOA 4BRYA 4O2EA 4W7ZA 1YMMB 3QIUB 5BQ7A 4K23H 5ADOH 3R7QA 3FN0H 3HC4L 4F9LA 4PY8J 4N8UA 4AH2A 4L74A 4I0PC 3K8MA 3D0VB 2QSQA 1F3DJ 4TLKA 1F4AA 4GRLD 1RQUA 1JV5B 4LDLB 4M7JL 1JPEA 2BSBA 2NPLX 4PI2A 1NEUA 1U8JB 2DJSA 5LCVH 3REWB 4D9RE 5ITFA 5I18L 1LO4H 3ZT6A 3RK3E 5C08D 3SDYL 3L4WA 4N8VA 4N2FA 4PRIA 5D1QC 2R69H 3BE1L 4OFPA 2QDVA 1WJ3A 1RZIA 1RL1A 2Q9OA 5T8IA 1G9MH 4P2OA 4GRWH 3TH3T 3ATFA 1V7NL 3F7KA 2X1PA 1MHPH 2EYRA 5F7DA 2ID5A 1PP9E 4F9PC 3D1MC 2H7HA 2C9QA 1JGLL 5A16B 2YBRA 1H88A 4PYHA 1BOGA 4HXAL 2CIKA 5KLVE 4PPTA 3RWCA 2WXPA 3P9MA 4HJJL 2HT3C 5DR5L 9PCYA 1XBDA 5K59F 1FRGH 4HCIA 3TF7C 2D3VA 5BOZG 5LUMA 3ROLB 1J1DB 1WFNA 4C46A 1FVDA 2KDYA 3VXSD 1QR4A 3BT2L 2ZSVB 4JO5A 1SQVG 4CW1A 3AM8C 4AYDC 3Q6GH 2HLAA 3NFQA 1ES0B 3CC4P 2XWJA 3OAZK 4MMZA 4PJDA 2X4TB 4N78D 4NM4L 4BUQA 3EOAA 5LNGA 3I3DA 1G4RA 4TVPE 4F2MB 1KCRL 3B1UA 3PP3H 4XGZA 1HL5A 5B5EH 4H44B 2FE0A 3T0VA 3NPSC 3HC3H 5CEYA 3VRIA 1AQKH 2H3NB 1KJ2A 1CCZA 4EQ3A 4M6AA 4M8QB 4MAZA 2L0DA 2MCAA 5GZOA 5AZEH 3BDBA 2I27N 1JTOA 1UUSA 4JR9H 5LDUA 5DSCA 5BO1L 3C5ZB 5EEYA 3CCHB 3NA9L 3TZVB 4JQ0D 1SVBA 2N56A 3GNML 3LQAL 2Y9YA 2F8OA 3PQYD 3U4BH 4APQB 3PAZA 5EZPA 3MBXL 3G5VB 3QXTA 3PDDA 1X5KA 3LCYA 3RKPA 4EI5C 4ENED 5D7IA 2FGZA 4F80A 3AWEA 2XQBL 2Z91B 2XNDH 4U3SB 1UWEH 2IQAA 3EH3B 3GMAA 2OSLB 5TQ0H 3IDGB 5KAFH 4Y7OC 3C6LB 5APSA 4N2NA 4MNHA 1M2VB 4KTGA 1WRGA 3ARXA 3NJGA 1XZ0B 2A6DA 4GRWB 2R23A 1HILA 5E8DL 4I2XB 2VXQL 1U58B 3BPOC 2LTQC 2HT2D 4FNLL 4TQHA 1SF5A 1A4AA 1RF0C 3B3BA 4WU7A 5HI4D 2JLPA 4IIQC 4IBUA 4XNDA 4OT1L 3FPXA 1FJ1A 2PN5A 3ZQ9A 2IAMB 1OAUH 1IQDA 1OSPL 4DN4L 4WKZB 5BO0D 5HPMB 2PABA 2ARJB 2F53D 5L0QC 3KS0H 1N6UA 1V27A 1L9MA 3HG1E 3GMNB 2X12A 3QDJE 4FQCL 5H94A 4N8CH 1GMIA 1IGFL 2EUZA 1U8PA 5EZOL 1PP9G 4NOBA 4YK4C 4NGHL 5E4EC 4IRJB 2J4WL 3W9DA 3WNPA 1KENH 4AENA 4BFIA 1ZTXE 3A2AA 3FB6A 4I48A 2CBQA 5KLVG 5B1CA 3BEVB 3TNUB 4JZNA 2D31B 4HIHB 3S2AA 1WISA 2IGFH 3VXOA 1KB9H 1RPKA 1UD8A 4DN3H 4G9DB 4L8SB 1GKEA 2YXRB 1VA9A 1BWMA 1NU1E 1XTMA 4FFVC 5IM7B 3WY3A 1IGTA 1YPZF 1FIGH 1WFJA 1HXYA 4PHXA 5JR1L 3GSNL 4RZCB 3FQRA 1IB5A 4A39A 3DX9A 3GMOA 3KR3H 3MODL 4OLYH 4KDTA 2YGQA 1SYSB 4F58H 1T0MA 1F4HA 1JNHB 2YMTA 2DYPD 3HUJE 2DD8H 4JO4H 1K8DB 5I8CA 1H8AA 5IROC 1OP3H 1E79H 1G2CB 4YHYC 4OZIE 4WW2A 4Z0XA 4IGBB 1DJZA 3ZX1A 3NCCB 4HUCA 3WNLA 1BG1A 4PJEA 3LH2L 4XBEL 3T0WA 5DD1H 5FHBL 2FEEI 5ICUA 2QGEA 3MA9H 4TT3H 3JTSA 3SY0A 2BSSB 3VFVB 1S7TB 3TESA 2PUQT 4J6IA 3QUYB 1JCCA 1EHAA 2KMWA 1USEA 4MZ2A 4NDMA 4O5LH 1QW9A 1E9PA 3BAKA 1AO7B 4OGZA 5DVPA 1RJCA 1I3RA 3CZNA 4FF9A 4WY7L 5DD3H 5JOPD 3QXAB 3V4QA 2WB1A 4XP5L 5EC1B 4WI4A 5CILL 1SEQL 3FB8B 3T8XB 1OGAB 5IGXL 1U3ZA 4GI6A 4KNQA 3OXSA 2AP2A 1WHPA 1NANH 4JY4B 4HCRL 4K7PH 1R1CA 5M1BA 1JK8B 4GAYA 4Y1AB 2DB8A 3NZ8A 3MV01 2FB4H 2A4EA 1FORL 2LXCB 4R7DB 3NJLA 2Q10A 3ZRCC 3CFUA 1C1EL 3E6HA 5B8CC 1WE5A 4JFEA 5C0GB 3D52A 4P46B 1TJIL 1J87A 4Y8DC 8CGTA 4UT7L 4E9XA 3ECUA 3QCUH 4XOCA 1JL8A 1HEZA 4AYEC 4IDLA 4OAWB 5E8EA 5GRJL 4WW1B 1ACXA 1ZK5A 5CEZH 3ZE0E 2WVSA 4BDVA 1OXZA 4EZLA 3QEUA 1BZ9B 4ZO8A 5I23A 3MRNA 2Q2LA 4AYFA 3CIQA 1WFOA 4C83B 2LU4A 1L6ZA 2CDFA 3H1JJ 3QFGA 3B7SA 5JO5B 1KFAH 3VU2A 2EIEA 2RAMA 3TJEH 1R5IA 4PJCA 3CQQA 1RZ8A 3B7RL 4XPTH 2K0RA 5GIRB 3DO7A 3WO3B 1OD7A 1NU1G 4O9HH 1KNOA 5T5FL 2XJKA 1X44A 4XPFL 1U91B 1V55B 2E76D 1CICD 3HUJF 4B9YA 4ZUSA 5HYFA 1EQ7A 1EDIA 2ROYA 4GW1A 5FM5M 4EOWL 2F54E 3JTTA 3RKDC 3NACL 2O1KA 2Q9IA 5GTIE 1EZUA 1E8XA 4OZIF 4NQDB 2BVUA 1JZDC 1J8HA 1GL2D 1NEZA 3EAKA 5CSGA 1WQVT 3FONA 3GB7B 1HHGA 2VQ1A 4Z7OE 4YXKL 1VQ9P 2NY1B 1N4XL 3MLRL 2GY5A 1SXAA 4DUXA 5KVFL 1CURA 4JFVA 1J1PH 1NGQL 4X6DE 3OXRB 1ROWA 3DROB 4EZKA 1AQHA 1OPGH 3T6ZA 5GRZA 3RWIA 4PJIA 2CZNA 4CC4A 3G9AB 5BV7L 1FDIA 4L9LA 5DO2C 4B86A 4OM0L 5C9JA 1DH3A 1I82A 3TO2A 2HWZH 2VISA 4HSAC 1FYTD 3H1KG 2WIMA 3CC5B 3VD1A 3J2PA 1QATA 2VAJA 1ECYA 2E86A 2AJSH 4N20A 4ZD3L 4POZD 1AE6H 3V79C 1Y6NR 4HC1A 1ZIAA 3MJ8A 1G5GA 3DSFH 3F7VB 1CBVL 1KYOK 4ZMPA 5KYUB 4JNXA 1CSBA 3CDZB 4N0CC 1M2OA 3AXIA 1YCSA 1DQJB 2I26N 3GGWB 3IWUA 2XZQH 2IF7A 2Y36H 3NSCA 4PB9L 1XEUA 1NCAL 3H1ZA 3LDBB 4AVJA 5IHUL 1IFJA 4QRAA 3U1SL 3VE0A 4Z3TA 4DETA 3CPUA 4O2FB 1BYOA 2J8OA 4WY4A 5H4ZA 1IGCL 2OZNA 3ZE0F 4Q9RL 3RGVD 4JX0A 1EK3A 1W15A 4QRPB 3VFTA 4GO8A 4WFHD 1NFDA 3D85A 4XO9A 1WRFA 3ZQXA 4BWWA 3N04A 1PFIA 5JNYA 4Z7WB 4M62L 2EYTA 3V9FA 1UC6A 1FO0L 3S5ZA 4RMWA 4Z7AA 1KCLA 2YGVA 3F85A 1T3UA 5TJHA 1EFXD 3P32A 3WENA 3VXMA 3VFPB 4KZEH 1LMKA 5APUA 2UZXB 1N8OE 2ADGA 3RE0A 1KJVB 3X14A 4A2FA 5I0XA 1GYAA 4FCHA 4H0IA 1IEAA 5DHDA 4WZ9A 4G9FB 5C7XL 3GF3A 2ZXEB 1NCTA 4HK0B 1NLDH 2LAAA 2WO4A 5M7QA 1YEIH 2KL6A 1FZOA 2NY7H 2PWEA 5KJRH 1N59A 4OF0A 3O2DA 4Z7OF 5ALCH 2A6KB 3QUKA 4H0LC 3A0HE 4JRXB 5CR8A 1Q0XL 4LBEB 4FHBD 4PVLA 3OSVA 2CKBA 4X6DF 1KSRA 2BS9A 5DJCA 2EYSA 2DV6A 3K74B 4NN5C 3O9WC 5MENA 4GKGA 5E2UL 3N41F 2A99A 3AQZA 4OH2A 4JRYD 4ATWA 4JKWA 2FR4A 1WDAA 1CFMA 2O6DA 1FSKC 3HAEA 4U1SB 1TETL 1YNKL 1GD2E 3QEGH 3T6VA 3UTTB 2KBGA 4P2QD 5KVDL 4G6KL 3ABZA 3LV3B 1YEFL 5GS2D 2G75A 2Q76B 4G82A 3HMXA 4TL4A 5GPRA 3H9HA 2X6CA 3ULUC 1UJ3C 1KBGL 2OJ1A 5B22A 3GMPA 3FUKA 3S7GA 1OOAA 3OGCB 3ARVA 4A6YH 4XMKH 2QQNH 3HBZA 1TU3F 4XH2A 5KTEL 3M06A 3PS6A 2WLNA 1IO4C 1T7YA 3UYRH 4MD4B 5I15H 4W80A 4U0QB 2ATPA 3NQKA 1JGEA 2F7IA 1E7UA 3VXPA 4UQBA 2GSGA 4ZQKB 5TE7L 4JFPA 1BMGA 4GSUA 3QIBB 4HJSA 4FXLA 4PR5A 1N73B 1QEWA 4FULA 5F97E 4OLZL 2A6JA 2ITDB 4KI5D 4PGBB 3FQ1A 3SBQA 4JHWH 1TTFA 4QGYA 2ZJSH 3DUUA 2VLLA 1VFAB 2NZIA 5DD0H 3QNZB 5F6IB 2OR8A 4FXKA 5HI3C 2B0SH 3N43B 4C4UA 3HBPA 4JG1L 1RPQA 1GOHA 1FH2A 4NWUL 3GRWA 3IDMB 3L1OH 2X4PA 4J3TA 1QQDA 4GKNB 1JHKL 5EU3B 4LDOB 1PZSA 1OAYH 2K45A 2IBZD 1KYAA 3RNKB 3M0DC 3Q2VA 5E4AA 2L4OA 5EUOB 2F2HA 1LWUB 3RGUA 2AV1A 3ATAA 4LT7A 1K5NB 4UNTA 4M3HA 3DVGB 1WG3A 3TFBA 2ICCA 3CQPA 3QQDA 4P8QA 3QUGA 1FBIH 3TEZA 2O6EA 4MAUH 1JNLL 3UBGA 4EUPH 3VWJA 1U8LA 4YMPA 3DDGA 4N2HA 5FWQA 5E2TL 3VDBA 5ERWB 2BVTA 2FYUJ 5HYSA 1ERNA 1OD9A 4Y4FD 2BJMH 5HY9A 4F8PA 1ID2A 2IAND 4F8TA 4K94L 3TH2T 3V4LA 3SKOA 3ME0A 5EZLB 1F3DH 3CFQA 1UM5L 2WQXA 5LB1A 4A6YB 4KVNH 5G5DA 4XPBL 4GUPB 3JWOH 3B7TA 3CXHJ 2BOCA 1OAQH 4JGUA 3EJUA 3RVWC 3BGFB 1VB9A 1Z5LA 2K8MA 1F4WL 3CZFB 5C8JB 5K9QG 3SYAA 2C3GA 4P9HH 1Y0LB 5CO1A 3CUPB 2GSIB 4K0OA 5BS0D 2VR6A 2AEFA 1TTCA 2P1YA 4KNUA 2MSPA 3CG8A 4M5TA 4AW4A 2NY3C 3H6JA 4S1RL 1LP9A 3V9EA 3OBAA 1MFZA 1GYCA 1PCXA 1YEDB 3FOMB 4MNQA 4NQCE 1CC3A 1WHOA 2NW2A 3VTTA 3KYQA 2GJ6B 2HG5A 4HIQA 3VFGL 1F8TL 3TGUD 4RSVA 1IBGH 5GS1C 4R2GD 2H45A 4NAJA 5CEXB 4KRLB 4JLRA 3VDAA 5DC0A 5D7LE 3NZHH 4IKIA 4H13C 4PJAA 1SQQK 3VXTA 1JF1A 3ULVL 4KJPC 2AABL 4Z7NE 3O41A 5KW9H 3QUZB 2JELL 1D5ZB 4FEIA 1OT2A 4TTDD 4Z1PA 5J5EA 3ZO9A 1NGZB 3RDTA 2ATKA 5J9PB 4EIJA 4GG8B 5CWSB 4P4RA 2G30A 2EZ0C 5L9DL 4EUPB 4ZMYA 1IM9A 4Q7DA 1I8IA 2FJFA 4FNQA 4AYCA 1OQXA 4AQ1B 3CCJP 1KB5L 2AQ3A 2V0AA 2X2JA 4H8WL 1N0LB 2GUYA 5JA9A 4JRXD 2CJUL 15C8H 1A8JH 3SDDA 3BZ4A 1OW0C 4A66A 3R4RA 2BNQB 4PRPD 3LRKA 4S11A 5AW8B 3FO0L 3FT4A 3D6YA 3RPIA 1NGXB 1U3HC 1ADWA 3AROA 5FOBA 4L3FA 4OBSA 4ZXBD 2DJUA 3SJVB 5IQ7H 5HYQA 1SDYA 2CBMA 2WLJA 1S8DA 2E7CA 3TVMB 4APXA 4JFDE 4W81A 3R7RA 2VLJD 3WDIA 4HA1A 3FF8A 5L2KB 4NEHB 4KKAC 4Y9EA 1VHPA 2XNXA 2WYTA 5C2BH 2WVVA 2ARJQ 2CPUA 2DM3A 1BFSA 2Y4SA 3EFOB 4O2EB 3QGVA 5IQMA 3LRLA 1KYOH 4H8UA 5BQ7B 5JLZA 2D2CC 4LHUG 4PP2A 3OZKA 4FHKA 2OGUA 1WIUA 4OD1H 4GFTB 1FZGA 2XWZA 3P54A 3VVWA 1B4JH 3VXQA 1FG2A 2ZXCA 4X5PA 3UJJL 1AAJA 3BO8A 3WKQA 3SPGA 4OLUH 4UQ9A 4L5FL 2ZXQA 4EBQL 1ZGLP 3OJ2C 5ITFB 4WJ5A 4DOHE 1AR1C 1E6OL 5E5LA 4YWGH 3UCQA 4M1CD 3IAOA 3CXDL 4UTAL 4JDTH 4N8VB 1CI3M 4PRIB 3U30C 1A4KA 4KAQL 3T1FA 1UQSA 3TJPA 1UB6B 2ISDA 3DGCR 1NCBH 3PUUA 1BZ7A 3PHQA 2PYED 4P2OB 3BT0A 3ZL4L 1M3IA 5C0AD 1NM9A 5D5MF 2Y7QB 3B5NC 3MUDA 3FXIC 4DERA 4RFNB 1OM3H 1ED3A 2IH1B 3B9AA 3NP4A 1S6NA 3MXVH 4W9KC 2WGNB 2WLIA 1F0LA 3P9MB 2PRRA 1FVDB 4Y9GA 4NRXA 5AAWC 1FGVL 4CW1B 2CK2A 4PRAA 5EEVA 5JW5B 4MMZB 2HFGL 2HLAB 2XWJB 1PF3A 3HNTL 3VAEA 3SKNA 3U59A 1FIEA 4LEEA 5HHOD 4WI7A 4XGZB 3HG5A 2OMTA 3K91A 3HG3A 3MZGB 5HHQA 2ZUUA 5HYJE 4FLRA 5CEYB 3GINA 3VRIB 2AJXL 2R0KH 5JOFA 4BINA 4L29A 3CXHK 1PU0A 4DK5A 4HZAA 3VXRE 3I5CA 1B9KA 2AV7A 4MJ6A 2GTQA 2QBWA 2WTOA 3INOA 3WSQL 4IJTA 3FBQA 2VDRL 1KQLA 3CAFA 2OJEB 3VI4E 4F7PA 1I8KB 5ISZE 5JQIB 4RVBA 3F6IA 1WA1X 3US9A 1RFDL 2MTPA 3QHFH 1J9QA 2IQAB 2ITEA 3HBQA 4ODHL 5MEQB 5HJBA 3A47A 3CVDA 4X4XA 4MNHB 3RIAK 4JKMA 3STBA 5CBNA 1NINA 4GUQA 3LRGA 4PTUA 2WO2B 3P8CD 2R23B 3Q3GA 1HILB 2ZT9D 5A2FA 4UINL 4B9FA 5B4MC 1PNDA 4MJ2A 1N10A 4QXWA 1YQ3C 1S7SB 4WU7B 3FU3A 4QRTA 1QBML 1YG9A 1J05A 1FJ1B 5CJQH 4WWKC 3I85A 1IQDB 5DJ0B 3FCGA 5H94B 3E1RA 1DVFD 1QUNA 4AYID 3SEPA 2RALA 5IR1A 4MDRA 3T4AA 2FQEA 1U8PB 3E9TA 3LH8A 2CPBA 4HIEA 4S1QH 5AW3B 3VWKA 3W9DB 4NSKA 2A9ML 4AENB 2QDWA 3RRQA 4Y0GA 4BFIB 5C0RH 1RERA 3TEYA 3FB6B 4I48B 4O58L 4WAFA 1SHSA 3LIZA 4XPGL 3ES6A 2NXZB 4RX4A 3TLRA 4RWYH 3VXOB 4IK6A 2MTAA 4R7NA 4K8RD 5FHAL 3L4XA 4G7YL 3DUSA 3MUZ1 4JO1L 5HDOA 1AIFA 1IGTB 2CBPA 2VXUL 2QHRH 4HS3B 4UB8E 3DX9B 2I07A 3GMOB 4ALAL 5T3XE 1T0MB 3K6OA 2AK4D 2XTJE 4ETYA 4LU5H 5I8CB 1N7ML 2VH5L 3U7WH 1SXCA 4P23C 2R29H 2XTJC 1JWMA 3LXUX 4MA7L 2Y2YA 3H1IE 4WW2B 4Z0XB 1EZLA 4GKSA 3OAUL 2MCPL 3AREC 3WE6A 3OC8A 4KMLB 4QLWA 3P4NA 1HOEA 5I66A 3EFDH 3JTSB 1Z9MA 3P2BA 3SY0B 3VI4F 1KCSH 2FT7A 4JQVA 2V5YA 4HVBA 4G6ML 2GB2A 2B2XL 1KXQA 5TISH 4HUVA 1GZPA 2MNUA 1A1NA 2XNAB 4ES9A 4N0RA 4JHAL 1G7PA 4D9LH 5AENA 2AEOA 1LK2B 1UOLA 4U7KA 2X5PA 1T0NA 3AWGA 3OGOE 1YBKA 3CFDA 3MMEA 2PMZA 3KVDD 4B7IA 1C16A 1DVZA 4V1DD 4DP0X 4BRJA 4BUGA 3EXLA 1PGOA 2NR6A 4KKNA 5LQBH 2W0FA 4P2OD 3BPNC 2DKMA 1S1CX 4JL2A 1OVUA 1PLGL 1YJNP 43C9A 2YQBA 2VDKB 4FJZA 2UXGA 1PEZA 4JFEB 1F3JA 1I85C 4UOQA 4FJ6A 4Y2DD 4JAMA 5E9DE 5DI8A 1HEZB 1NVOA 4LHJB 4XP4L 3AT9A 4XVUD 3JVFC 5E8EB 3S37X 4IBYA 4DIXA 4YHIA 3QEUB 3IDUA 4AW7A 3MRNB 4AYFB 1SN2A 4F57H 4UU9A 5H2FE 3S4RA 2XZZA 4KRPC 4XWOD 5FYLH 3ZKXC 5KZCD 3IMSA 1A7PL 2BDNL 3B9KD 1R5IB 3D39A 4PM1A 4PJCB 4HUUA 1BEYH 3DO7B 5TDPA 1G7LA 1R3IL 2W8CA 4MRCA 4PP1C 3EJRA 1RH5B 1A7QH 1KNOB 1LXMA 4FG6C 4K8RL 3S3CB 4ZO9A 2P24A 4OGAD 3NCJH 4BCYA 2QPUA 1A3ZA 4ZUSB 1PGJA 4L3EA 4RDQG 4GW1B 4FFZA 3ZQWA 1IZKA 3JTTB 1GC1L 1M8OB 1G84A 4Z3GA 4N1EA 1NEZB 1J8HB 3BGMA 5GZOD 1NTDA 1DCLA 1NTZE 3FONB 3H0TB 4U49A 2JQAA 2Z8RA 3TBWA 1N18A 4YHOH 3NTCH 1AD9B 1XH0A 3G5YA 1BZQK 1KTRL 3DMMC 2WZ6A 3KPOB 2ZYGA 4R5TA 3WJLC 2P44B 1M6OA 2ZUQC 4PJIB 1ZDQA 2DIAA 1NMCB 1WH0A 3PL6B 4RMBA 1R5VA 3QNYA 5BZXA 1MIML 4Y19E 1KJ3H 3WXVL 4MWFA 5C9JB 4GQPH 5JW4M 3D71A 3TO2B 2WLHA 4OD2A 2VISB 3JWDL 3Q2CA 1MHCB 4GUOA 1FZFA 3FRPG 3FMGL 1EHXA 2EUXA 4KBPA 5C0IA 1CTOA 5DLML 3I6SA 4NZTL 1ET5A 4AT6A 1J5OL 3EJZC 3EH5B 3GZPA 4A04A 3CCUP 1RK7A 4MD0A 4S10A 4OVNF 3L3DA 2E9BA 2WNWA 4KKLD 1DVQA 2J88L 1KTBA 1I7ZA 2VGLM 3IJ9A 2Q8AH 4NJAL 5KVEL 3KDMA 3ABKB 2ZSWA 3VE0B 5IV2A 2QVMA 3PLNA 2Y2TA 4NC2B 2DM2A 1RZPA 1Z3GH 1HZKA 2TSBA 3FHAA 3FU0A 1MNUL 3RLSA 4DVBB 1MFDL 3VXUE 5ABZA 5IP4A 2EDOA 5EN3A 3VFTB 4X7SL 1NFDB 3D85B 2KT6A 1I9RL 2JJTA 1PKOA 1MCRA 3F6JA 4XHQA 5JNYB 3AACA 4O02L 2EYTB 1DFBL 1F00I 2VLKA 5GGUB 3VXMB 4CDGC 1OAJA 4YSQA 3RU8H 4L37B 3PXLA 1I9IH 2G4EA 3X14B 3FH7A 1GRWA 5MHSE 3NCWA 1SXSA 5GGTA 2FUTA 3UP1A 5I0ZA 4Q9QH 4R8WL 3SCMC 4WFGE 1HHIA 2ESVA 3DGDA 1JGUL 1RLBA 3JQOB 4ERSL 4G71B 1YUKB 1OTUD 1QASA 5DMIH 1A5FL 3T1WA 1KDJA 5E56A 1FZOB 4PI0A 3CXHH 4QXUL 2OLDA 3GRGA 3BXNA 1N59B 3M8OL 3ESMA 3QUKB 3ELAT 3HZKA 4N0YL 1KJ2L 3BVWA 4AEHL 2MCMA 1NTZG 2JJUA 5E8OA 2R27A 2OYOA 4L0PB 7FABL 3IJ7A 3R0NA 4N5ED 5DQ9B 2EYSB 5CCGA 1YQVH 2QQQA 3GXTA 3HA0A 4IW4C 4HPYH 4C4KO 4X5QA 1GGBH 1ZV8A 5CZRA 2J6EA 1ZTMA 4GXVL 2FR4B 1UD3A 3GHBL 1JXKA 5KSBF 3HE4A 2AQNA 2O1AA 2G75B 1A7NH 2NMSA 5K1JA 1DVXA 1AG0A 5MP6H 1USDA 5CCJA 4LRNL 1AHMA 4HIIB 5E8NA 3GI9L 3N0AA 3GMPB 1NFAA 4QRRE 3H4HA 1C5BL 3CC1A 4M61A 5DEJA 4AQRD 4UB6H 5EEXA 4NCDA 4XH2B 4AV0A 1LTJC 2B1HH 5DVNA 1HI6A 3HBGA 3CZUB 4YHNA 2ATPB 5HPOA 3H32B 3DOSA 1JGEB 2Z31C 3VXPB 5JHMA 1Y8AA 4JN1L 2GSGB 3IDYB 1EO8L 1JFHA 3GZQA 4JFPB 1Q0YH 3UAFA 1QEWB 4V33A 1VFMA 3KPPA 3ZDXE 2BASA 4N6QA 2WPQA 2FWLB 1CVRA 4JN2A 4B3EA 1BQHG 1BBDL 3DUUB 1ILUA 2VLLB 3S34L 3WNIA 4XCNB 5BCAA 1JGLH 1URQA 1DTUA 3Q0HA 5CZXC 5B1JA 4ZFZB 2RACA 4KQ4H 3ZKQD 3FTGA 4LLMB 3O3BA 4HXAH 5D2NC 3LY6A 1VQ5P 3H1HE 1R4XA 2X4PB 2IPKB 2CCLA 1QQDB 4ZTPL 5E08H 3MNMA 2EEDA 4HJJH 3HS9A 5DR5H 3SQRA 3HVDA 5JIKA 5C0FA 4OIIL 4PJ6A 1SLVA 2VQ4A 4L23A 2A74B 3KVPA 4ONGL 2EILB 1J8HD 2XXMB 4TLSA 1SDDB 2EQDA 3FQWA 1BZDA 1RZKL 4V2BA 5G4OA 4IRZL 4QXTA 4M5YL 4NM4H 1FL6A 4XO8A 2DQDL 3QQDB 2CH8A 5C0BB 5MEPA 3X11A 1RI8A 3I50H 3S8WA 3VG0L 3N44F 1U8LB 3FT2A 1PG7H 4U6HA 3KLHC 1MCOL 4A68A 5HYSB 5HY9B 4JZJC 1DZ0A 2XWCA 2UZPA 4ZMVA 1N7SD 4RZKA 1DJSA 3SKOB 4XN9A 4WUUA 1RZJL 5DS8A 2CO1A 1RE4C 2WXHA 1FAIL 4IMKA 1KY6A 3F5WB 5G5DB 4GFXA 3RA7L 3FX0A 3BVTA 3MUY1 3AU1A 4YDNA 1HCFX 3B9VA 3WE1A 3MV9A 1DVYA 1Z5LB 2CHZA 1L0LJ 5LGHH 3QIUC 2C3WA 4P5TA 1GGCL 2ENQA 4QHNA 4JRFA 2XQBH 2JJWA 3HHMA 2X38A 3I75A 5K33A 1LP9B 1XAKA 4NKIH 4TVUA 3L73J 1MLCA 4Y1TA 1EIBA 4TKWA 5APYA 1Q2NA 2NXYB 1A2YA 3IETA 3JYCA 3QZMA 2OR9H 4WY4D 1FF5A 1NCUA 3GF7A 3HS0A 3JV4A 1G7IA 5E79H 2GBTA 4HUXA 2HG5B 1T0OA 3ZDXF 1SF3A 3ARBD 2LLLA 2P7TB 4GBXD 2H2PC 4JPQA 4Z95H 3KHQA 3LIUA 2G5BA 1OSPH 4DN4H 3QPXL 2NTSP 3OWEA 4NP9A 3ZMNA 3CD4A 4PJAB 1QRNE 1U42A 3VXTB 1JF1B 1JHLL 2Q3EA 3O41B 1IGFH 5GRYA 1EZVI 3BRDA 1TSHA 3WFHB 4Q8BA 1A3QA 3JT0A 5E1IA 2P7JA 1OB1A 2W88A 4Q0XH 3MTUE 4C55A 1JOCA 3HKFA 3P11L 2ATKB 3FCBA 4JO2H 4TUOB 4P4RB 5IB1A 1EDJA 3H1HG 3MLXL 4MJ5A 3UYOD 1H5BA 2OCCB 1GZQB 5GTHH 1IM9B 2P49B 1I8IB 1D7DA 4QOKB 4AE1A 1HUCA 3G7TA 2IADB 4I89A 4F33A 3IDNA 2ZVOB 4N3TA 5I1AA 3MLTB 3DXAD 3DHMA 5I76B 2X44D 3N1QC 2J59M 4UIMA 3BZ4B 5AW4B 3MODH 3STLA 1DBJL 1D5BA 2KLSA 3FT4B 1A47A 2X6UA 3RPIB 5MEND 4OI7A 3A7OA 5FOBB 4D0BA 2PPDA 3FZUD 5HYQB 4FQHB 3TV3L 3SGEI 1S8DB 2CQVA 4Z7QB 5KSAC 3H9SE 1EHLL 1BSIA 5FHBH 3G08A 1MVUA 2CO2A 4YBQC 5CD3A 2XJLA 2WVVB 3C5ZC 2CO3A 2B14A 3TZVC 1JXGA 5K9JL 4APQC 4M9OA 3AEAC 4BH7A 1KLUB 4Q9CA 4HC1L 3IJHB 3A67H 3QZOA 4LKCA 3VQ2C 3VXQB 1FG2B 4NIYE 1QGKB 4QY8B 1G9NL 4WY7H 4NERA 3J7HA 1K3ZA 4KJQD 3C6LC 2H47C 2HPTA 5CILH 1SEQH 2X53A 4D2NA 1BJ1J 1G9MC 5FYKU 1R6VA 3WDHA 3BH9A 3NFPB 4WJ5B 5MEOA 3AT8A 3V0VA 2AQPA 4L1SA 3T0AA 4LDCA 3V6BR 3WS6A 4HCRH 2FYUD 3VYNA 4XB8A 3U4EA 3MX0A 1W0YT 3RI5F 4DT2A 2VQTA 2QRXA 1N6QH 1UQSB 2IAMC 2EXTA 1K72A 5GISH 3APCA 2Q87A 1BZ7B 3W0WA 4YNYA 4WDIB 5DJ8A 4DEPB 3CX5K 4GP8B 1X8YA 2R3SA 3R1GL 2P2UA 3FWNA 2X40A 3N42F 4UT7H 2IOIA 1XBRA 2MEJB 4TUJB 1CS6A 5GRJH 1ED3B 1PLAA 2DQGL 4IRJC 3OZ9L 5BVPH 4RA3A 3UOAB 4NPKA 4B27A 1SYVB 2BNRE 1G1OA 4JFHD 1CI6A 2WHVA 3I9AA 1MELA 4MAYD 3L17A 3IMWA 4NRXB 4L8SC 4PRAB 2EP6A 3ET9F 1MAMH 2BVYA 3QG7L 1OF0A 3C8DA 4OFYA 5IMKA 1T6BX 3VWJD 2NZ9C 2K9JA 3PF2A 4UIKH 3RTQA 3SKNB 2FBOJ 1GCFA 2QT6A 3K46A 3V0IA 1GXEA 1XL4A 2WSKA 4NO2A 5T5FH 5T1KB 1I8MB 4L4JA 1NSNL 1MCEA 1W16A 2CUIA 4HKZH 2WMPA 1CJYA 5HHQB 2X9ZA 5EC2A 2RQEA 3SDXB 3KZ8A 3BN9C 4E9YA 1SOKA 5J8OA 5JOFB 2CMRH 3F5HA 3LHPL 1WCBA 1PMYA 4IGBC 2PLTA 4KJYA 3MREA 1KYUA 4G70B 4XVSL 3U4AA 1J86A 1N4XH 2DQEH 2BSTA 4MJ6B 1L0LK 1SHMA 4TQ8A 5BVJA 4R7XA 4WHDA 5CMAA 4F7PB 2FZ3A 2N4IA 2EDBA 4R26H 1IC5L 4LOUD 3HMXL 2KDGA 3QUYC 1Q9LA 2WAQA 4ZMQA 4MHHG 4XPAH 1NH6A 1HIML 1Z9OA 2KC0A 1FAVA 1RHHA 1RHZB 2BERA 4MNQD 3V7MA 2V9RA 4X4XB 2E9JA 1TVDA 3RWHA 3ISWA 4L1HA 1ZMEC 5DF0A 1ID5I 1PPJE 3Q5PA 2WXJA 3Q3GB 4KK5C 4N3UA 4PIRF 4WO4B 3NJMA 1KEML 2X70B 1Q72H 1KGJA 1CBVH 1UIXA 1Y6MR 1CE6A 3H2PA 3MRKA 3BWUF 4ZS7L 1SJMA 4BWTA 1MFAL 3KPSB 4KHTL 2W83C 1J05B 1DANT 1ZV2A 1S3JA 2WBJA 2WQWA 2R59A 3OMZA 4HLJA 4DVRL 2WQRA 4U6VH 4OI9A 4ZNEE 5ESVB 3VVVA 4PTTA 1A66A 4DEWA 1NL0L 1QUNB 2P5EA 4P46C 4PB9H 1VZGA 2ZP8A 1TQSA 3VFUA 5IHUH 2XUWA 3N9GH 3U1SH 3RDTD 3T4AB 4UOZA 2HTKC 2WSPA 4NSKB 2Y6TE 2QJDA 2GK2A 1IE4A 1ETA1 4U3CA 5I1LA 2CPSA 3C09C 3ES6B 4JKPL 1AZNA 4FTDA 3LQZA 3I3BA 4P3CH 5LKNA 4HKZB 1J9RA 3HHSB 3SDDD 3QJSB 5I73B 1JCVA 2WYZA 1IIIA 1ZV5A 2CHDA 3IDXH 2MJWA 5IVXE 4F7EB 5C0CA 5CD5D 2I07B 1G9HA 4HLZH 1SQPJ 4DKFH 4MJIE 2ZKHH 1WICA 1YJDH 1Q9OA 1ZCRA 1LO3H 4EIZC 1EDYA 4PG9A 4QRUA 2XRAL 5EO1B 3KXFA 4F15C 5E1AA 5EEZA 1HE8A 2VN4A 3HI6H 4GKSB 4HF5L 1MI5A 3W2DH 4EVNA 2ZD0A 2NY1C 2IV8A 2EIDA 3WE6B 1UM4H 4PB0H 1SBBA 3SOTA 1I7TA 3P4NB 1LHZA 4AGQA 4D6TJ 4XN1A 1OXYA 1XB6A 3PJSK 3R19A 2DLIA 3IDIA 1SQXD 4LEXL 4BE6A 3MCYA 3U0TA 3F6LA 1JI1A 1BCCJ 4XXWC 1V10A 3BD4A 4A7QA 4HUVB 1A1NB 1YNKH 2CM5A 5C6TL 1E28A 2HB0A 5DQJB 3O2VL 1T89A 3WU2H 1YEFH 4K9EL 5GSRB 5T5NF 3KVQA 4IL6E 4QXGH 4TLTA 4AUWA 3AFLA 4XMPH 5ABAA 2VIRB 3V2QA 1T0NB 3SO3B 1MY5A 3T08A 3VTMA 1VRSA 4LL1A 5T5NG 1N8ZA 5J6GA 3EJPA 3CFDB 3SFDC 1KBGH 3MMEB 1S4IA 1C16B 1J8RA 4KPHL 5BW7A 3T3ME 3WTYA 4ZT1A 4E41E 3FSZA 3JZYA 1R5SA 2VDLH 5JW3L 5EZJA 1UFGA 2EXYC 5DU7A 1JY3N 3KYKL 1N6VA 43C9B 2AEWA 3QEQA 3ZL2A 2JF1A 4TS6A 1F3JB 3DPDA 1WMKA 5ID1A 5TE7H 3LDBC 4HJ0D 3G4SP 2D2OA 5C09A 5DI8B 4OJFL 5HHPA 4IFDK 5ANHA 3D69B 1ZLVK 5EO0B 3ZKMD 2E9WA 4LLWB 4XCYA 4YHIB 3LNHA 2N3JA 3CE1A 2WWOA 4OTXL 3ECVA 1IGJB 2EIKB 4UU9B 4PUBL 5EB9A 3SPVB 2BOBA 4ZW8A 2KZ1B 3O3EB 4Y16A 1OSZA 2Z4QB 2Q6QA 3BSHA 5E5UB 3RWJA 1D9KA 5A1AA 4HUUB 4NWUH 5TDPB 3IKCA 1JB0J 1G7LB 3KPQA 5IVXF 1GW4A 1JHKH 3QDME 3NXSA 2ZWZA 2YMYA 1ZXQA 1NCDL 4ANUA 2P24B 2C3XA 5T3ZE 5HP5A 5T1DL 3NYKA 2HUHA 2AJ3A 1X7QA 2YC1B 2V2TB 1MFUA 3K81A 2CLRA 4XE5B 1SFCB 2HX7A 4ZPTA 1ZS8A 5AWNH 2IMNA 5KAQF 4PBVC 5DEFB 3BGMB 3T0BA 1SOQA 4CGTA 2ZOKA 1MZZA 1AGBA 2B77A 2CU9A 2FDBP 3TBWB 3VGDA 4FQ2L 1JNLH 1CIDA 3QHTC 5D1ZI 1AR2A 4XMLH 3IF4A 3AAZB 4G3YH 3G5YB 1MN4A 5E2TH 2UWEA 4K2UL 4MJ4A 5DS1A 5EEWA 1CLVA 2FEJA 1TSRA 1MDTA 2WT7A 3R4DA 2QKIC 2CRZA 1UZ8A 5D4QA 3QNYB 4GSRA 4M48L 4XXCC 4KROD 1PTZA 4MWFB 2VDLB 1QSEE 3C87A 3I6LD 2GUVA 1S7WA 3MV11 2AZAA 4XPBH 4AY0A 4OD2B 1H3PL 3HEIB 2NSMA 3SO5A 4ANVA 1XXFC 2RR3A 2PR4L 2UXFA 4OGYH 2YXVA 1L0NJ 5C0IB 2RFXB 3E7KA 3T3MF 1VADA 3KBFA 2WPSA 1UWGL 2B08A 3G6AA 4GQ9H 4AT6B 3CWGA 1W2BO 1BM3L 3L3DB 5J1AA 3PGDB 3CX5H 2F5AL 3UTSA 4XX5A 1IQWL 1I7ZB 1M1JA 2V5TA 2YFOA 1VGKB 5SWSE 1GYWA 3KDMB 3VWKD 2ZSWB 4HEPG 5D72L 3RWEA 3QIBC 1M1KQ 4PJ5B 1N73C 4JJ5A 2VRSA 5KBKA 4JRWA 3MRHA 1HCZA 5AW0B 1SOXA 1MFEH 5ITBL 4JO3L 2V37A 5IT2L 4GO6B 4JPKL 5I17B 1MKFA 5GRXG 4HUWA 4YE4L 2WM0A 4BD4A 3LXCA 3ULVH 5F6IC 3ARGA 2H5UA 2JELH 2OMVA 1WWWX 1PZCA 1BGYJ 1XCQA 1DUZA 1JWUA 3U0WH 3ARFA 4X4KA 3RBXA 4X4YA 2VLRE 2NY6C 3O11A 4HOZA 1OIOA 2ESVB 2Q3XA 3T2PA 4DTGH 1LWUC 3MLYL 4R9HA 1KB5H 3MD0A 2G4GA 4GKZB 2X4SA 4QCIA 2G9KA 3LKSA 2CJUH 3C08H 1I3GL 3GQFA 4UNIA 4KZCA 3V6OE 3S4SA 3QC6X 5KKZB 2C1OB 4HMEA 5E8OB 3VQLA 1WS7A 3V6OC 1RZFH 1JPFA 3EH1A 2P5WA 5INCA 4K3EL 4KX9A 4XBGA 5EZIL 1Q8MA 3RNQA 3PRZA 2ICES 4M93C 2EDMA 2C4FT 1MJUH 5D1XA 3AEGC 5DWPA 4L4TD 2F5BL 2QVAA 1CLZL 5TK2A 4EI0A 2ODHA 2LKMA 3BGFC 2QFRA 1KFNA 1WFMA 2XPGB 3QRGH 3HRZB 1RK1A 1IC7H 3O6KH 1P7KA 3M7OA 3IU4H 3QJUB 4PD4E 4M61B 1X0TA 4JFXA 1UYWH 1HI6B 1U2CA 2GTZA 2OK0H 4X6BA 1C9SA 2I7OA 2OTWA 4YHNB 2FTAA 3DOSB 3IKKA 3NUKA 4QTHA 4CUCA 3LPGA 5E51A 3TXAA 3S3DB 5A6MA 4PHZA 3EOTL 3GJFA 3LZRA 1ILSA 2GIMA 1RP9A 1ZR4A 4IBQA 4TPRL 4XCCH 3TF4A 3L72E 4LPTA 4W9CC 5IK3B 2VOTA 1FNSL 3MRFB 4JN2B 4MXQC 2HKFL 2C9NY 2QZ5A 3D39D 4BQ8A 5IHBA 3DYMA 4U1GB 3ZL4H 2V2XA 2C4FU 3FO1A 1FLRL 4YBHA 3UFIA 3IMRA 2NRDA 3MN8A 1LEKB 4F24A 1JMBA 3K8KA 1LE5B 3DSNB 2J43A 3FO9A 1WZAA 4JFYA 3VFNA 2C9XA 1GS7A 2GIXA 5CHNB 4L3ED 4C56E 6FABH 2N1KA 4PMEA 7PCYA 5C0FB 4MQ7A 1JHTA 1HNYA 4U3FJ 3QORC 5EWIL 1T1XA 3FC8A 2A06D 1OK8A 5EO9A 3WKML 4AQ1C 3FQWB 3PREA 3AS0A 3MKGA 4HQQL 5EBWA 4QXTB 3HNTH 2VMFA 1FL6B 1Z0MA 1TJMA 5MEPB 3FFCD 1ZHNA 4XNXL 2DZEA 1DJYA 4LVEA 4U6HB 2ENPA 3JWOC 2YSTA 3BJ91 4KJWD 3B2DC 3WUTA 4K07A 2PFXA 1MQKL 1CBJA 2C9SA 3EHBC 5AB1A 4NUMA 4J2QA 3SE4A 4J3OF 4P9HC 4WUUB 1BJ1H 2F7RA 2OMYA 4ECNA 3B5HA 4GINA 1A25A 2R0ZH 2WYHA 3II2A 3FQUB 4R4FH 2AGJH 1R3LA 3B4NA 3WSQH 4Y2LA 3AU1B 3L1GA 1OCZB 3NAAH 1KFGA 5DCCA 2C5DC 3EG9A 1FCGA 3MV9B 4PJHA 4LFHD 3ZIMA 1YN6A 1JXFA 1J9CT 4P5TB 1TNNA 3AB0B 3D08A 1TQTA 5LWYH 4U2YA 1OT4A 4OV6F 2WUCH 4WJG3 5AYUL 3PJNA 3T9WA 2OQQA 1NYHA 3MZTA 5F7MC 3I75B 4CRPA 2VAAA 2ZPKL 5F88B 3TIDA 1MLCB 1MCCA 3BIKA 4M7ZB 2XN0A 3LB6D 1PFOA 1A2YB 1QYGH 3IETB 3TFKC 1UA6L 4A7PA 2APFA 2GTWB 3HS0B 3JV4B 3ARDC 3UCRA 5JHLA 5JPMA 2H26B 5F7EL 4B9KC 3G6DL 3QUMH 1B88A 1FE6A 5L8RJ 3U7YH 2XTSA 1UWFA 1NO4A 2X6AA 4FCAA 1WVZA 2G5BB 4FQ1L 4KHXA 1NUDA 2HUEA 4W4NA 2YPVA 2VLKD 3U82B 1OT1A 2DYRB 3L72G 2VYRE 2YS4A 3MLUL 3MO1A 4GLRH 4QF1A 4X7TA 2EH8H 3TP4A 1WWAX 5IKCA 3CCQP 4RFNC 3TGXA 1OB1B 4JFWA 1KC8Q 2DLHA 4MCYA 1UEMA 5AOKA 4AGLA 4O58H 5IB1B 3I3EA 1SVFA 2G3MA 2BIIA 1DFXA 3LZPA 4MJ5B 4XPGH 4EUPG 1NAML 2E46A 5DHVA 3AS2A 3PJSB 3TYGH 4F33B 3IDNB 4PGZA 1S9VA 4FFZL 3MUUA 3L75J 3FQNA 2AQSA 2QQLL 5IB2B 3OKOA 5B66E 2VXUH 5D1ZA 4PBXA 2YARA 4D9QD 2HTLC 1D5BB 5CCGD 4Y4KB 4KTEL 3W81A 1I7UA 1FC2D 4X4MA 1INDL 2VH5H 4GIAA 2FEDC 3OHXA 1G94A 5KUMA 3RJOA 1AD0A 1JZIA 1RJZA 2OTKE 1KTMA 1F13A 5ELIA 3SYQA 4PJXE 3PU7A 4BUHA 2GK0A 3MJ9A 2Z1PA 3L74J 4WSGA 5CD3B 2NT1A 4UTBL 3N85H 2N1TA 3G71P 5CMZA 5BMFH 5AW7B 4P06A 1XT5A 4P57A 1DSFH 3CBKB 3NA4A 3QIWD 4BH7B 5AB0A 5ID0B 5CCHA 3B6SA 2VXTH 1UH4A 4LKCB 5EIIG 4MMYA 1JRHI 4KXCA 4JHAH 1JCKA 3O0LA 3QUMB 3VYPA 5IZ7A 5IFAL 5GHWL 1ZLUK 4N28A 1SQVJ 1VQNP 3O6FA 1JN6A 5ESQA 3GXNA 2WWWA 1UWXK 2I69A 3V0VB 5MEOB 2E5EA 4I0PA 2FFDB 4PCSA 1VPOL 3R8BB 2D7MA 1A3LH 1FUNA 3K5RA 3U4EB 3UBXG 2XG5A 3MX0B 3S36X 3KPRD 3W0WB 1URQD 4B9ZA 2UZYA 4YNYB 5DJ8B 1ZMYA 5D1QA 5DA0B 2LABA 1PD6A 3OF6A 1MHHB 5FYKH 1QUPA 4XP4H 1F3RB 4KY1L 1KG0A 3MUGA 4YDVA 1M7IA 1N3NA 2FBJL 4YHPB 4F9PA 1AGCA 1E4HA 3C9NB 3WFCH 3C12A 1ORSB 1CI6B 3I9IA 4G9DA 4GXUM 2NXZC 1EV2E 1UT1A 3PGFL 2PXYD 2PYFA 2WB7A 4OCMC 5F1NA 4N25A 3L73D 2IYPA 4NQVA 1KZQA 4WTWA 1SLXA 2K9JB 4YR6A 1F90H 3SPHA 2J5WA 2HLFD 3AM8A 3GBNL 3L5WA 4LIQE 4NO2B 4WI3A 5HI5D 3F00A 4B5EA 3KYMA 5A6IA 1YEKH 3G9VA 1TR7A 4Z18A 5CCKL 2WMPB 1K4DA 1BOYA 4AGNA 4RH4A 4OW6A 1E65A 1QKZH 2BIHA 5C07D 4KVCH 5I30L 1QEXA 1BCIA 1XF1A 2IMMA 1OCWL 1WCBB 4PJXF 1PCSA 2FX9H 3MREB 4CN6A 3ECBA 4G8IA 4Q6IB 3RKDD 3ULSA 1TTRA 2J6EL 2BSTB 3VXNA 5BVJB 2W9EL 2B87A 4LKXA 3MACH 3OPZL 2FZ3B 1PP9J 1A7OL 3BRFA 1IAII 1A4BA 1HWGB 4YHLL 1Q9LB 2EICA 3ASOB 3UIZA 5IQNA 5BRZE 1VF5B 2QJKB 1ACZA 5KLVJ 5LDSA 2H43A 2BW5A 2K6YA 2NUPA 3GZKA 5D7EA 5LO7A 4EI5A 4X4ZA 4DPAX 4DPBX 5ICYA 2H3XC 3JWDH 4OUUA 3RWHB 1DYZA 2VZSA 1UXSB 3HE5A 3FMGH 2R4RH 5GS0L 1WAPA 4KXZI 4PRNA 1IFMA 3MTRA 4YLQT 1CE6B 3MRKB 3VP9A 2VDPH 1QSFE 1CFTA 2EDTA 4D3CH 3EGDA 2ADIB 2WBJB 1KLFA 4M29A 2CR6A 4AJYV 3BI9X 2ZX6A 3WTXA 2ZE0A 1A02F 2J88H 4NP4L 3OJAB 4LSQL 2D0GA 1FNAA 1EEZA 2KERA 3VFUB 3V0AC 1RIHL 1C08A 4B9PA 1CT8B 3UC0H 3RVTC 4IFMA 1MNUH 2N7AA 1MFDH 1J0JA 3O4OB 3HG1A 1P1ZA 2ZP9A 1WBZA 1IKFH 3FCSB 1I9RH 3APDA 2X1QA 4YL9A 2ZXDA 4ESKA 2C3HA 3D25B 3GSUA 3QNFA 1A3RH 3SY6A 5JIPA 2DTMH 3H1LD 1NBZA 4UCFA 5C0CB 4JVPA 4F7CA 1DSYA 2NLJA 1MRCL 4WCYH 1Q9OB 4FQLL 2DWEB 1A5FH 3FQTB 3LEXB 5GJTH 2VL5A 3K8LA 3KXFB 5TH2A 5E1AB 4M03A 4YDMA 4NM8L 1TFHA 2KLRA 1IL1A 2WLLB 5L4JA 1MI5B 3X1BA 1KQGB 4EVNB 3WMPA 2Y1YA 4N0YH 3DX0A 4WEUD 2HRGA 4ADJA 4FI8A 2H6UA 1WAEA 5M94B 1G43A 1FVCA 1I7TB 4HBCL 4XC1L 2C7UA 2H1XA 5FA4A 3KMDA 1FS0E 2PKDA 2RQ8A 7FABH 5AALA 3IDIB 4YX2L 1BYPA 3U0TB 1NMCC 3A21A 3PL6C 3VW3H 3SZ6A 4GXVH 3SKUD 5L7XL 1S7VA 3RL1B 1A6UL 2YD5A 2VDPB 1E28B 2W65A 3TBBA 3EUDA 3QW9A 3KZIE 2YPLD 1BXUA 2XFXA 4BSVA 1FQ9C 1N8ZB 3U1QA 3WFBH 3OAKA 1C7SA 1ZOXA 5J6GB 4ABUA 3QFJA 4E9QA 2Q1KA 4U6YA 1CWVA 3WBDA 1F2XK 1NU1J 1JFQL 4NQED 4ZS6D 1IJDB 4HEME 5CGYC 1ZVYA 5EZJB 2G60H