2ZXWE

Bovine heart cytochrome c oxidase at the fully oxidized state (1-s x-ray exposure dataset)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2zxwE00
1OCRE 1OCZE 1V55E 2EINE 1OCOE 2EIJE 2Y69E 3AG3E 2DYSE 3ASNE 3AG4E 5B1BE 5B1AE 2EIKE 3ASOE 3WG7E 2OCCE 2ZXWE 3ABME 2EIME 3ABKE 3AG2E 3X2QE 5IY5E 1V54E 3AG1E 3ABLE 2DYRE 5B3SE 1OCCE 2EILE
chains in the Genus database with same CATH superfamily
3LCAA 4CGWA 1AP7A 3RRMB 4I1OB 3R9MA 1MJ0A 3ML9A 1HZ4A 1YMPA 2WXPA 3OAWA 2FI7A 3ENEA 3E30A 4HI8A 2RD0A 2P9PG 3CVWA 4F6RD 3LY7A 5EDSA 4UWLA 4U95D 4C9BB 3CQGB 1MYOA 2LO6A 1N4SA 3MKQA 4TRQA 4B0ZA 2F8XK 4PH4B 2E2EA 1HXIA 4LCTA 3NAWA 1HH8A 4GTOA 3L13A 2FO7A 4OVUA 3NOCD 4P29A 1TNBA 1JCQA 3PZ3A 3FU5A 4DUIA 5ARFA 3DSWA 1N95A 5JA4D 3U3WA 4DX2A 3C72A 3ZRHA 2IEJA 3KS2A 2OVBA 2XGMA 4HOSA 1EDUA 1GW6A 2WXGA 4XKBA 3QDNA 3B13A 1XNFA 4OAUC 4HOTA 3SHFA 4XE0A 3TJPA 4UQXA 4F7AA 2WMNA 3I5PA 2GRQB 1V55E 3E34A 1K1AA 4CDNA 3AS4A 3TXMA 5AQAA 4G24A 4JEHA 1KPSB 2C2LA 3JQ0A 4BFRA 1U3CA 3ZIMA 4JL0A 4PDXA 3LVQE 4N2SA 5G55A 4C0EA 5H7PA 3PUJA 4J8YA 1IXVA 2WXIA 4GYWA 1TJCA 1HFAA 3L82A 4A3VA 3E4BA 2PM7A 4EBAG 3PS6A 2XS1A 2ONDA 3CHPA 3TXNA 1OT8A 3AU5A 5JHBA 3T5XA 3QARA 3BEEA 4UQYA 1NA3A 1HG2A 1YCSB 3NB2A 4DLQA 3S7JA 5ENQD 3B7SA 4U7EB 3HHMA 3PZ4A 2WXNA 3C5RA 3S7DA 2Y1LE 3D9LA 5CEDB 2GRRB 2J08A 2R02A 3LPZA 3R9AB 4GTVA 5A7DB 3BG1B 1LF8A 1U2VG 3SFXA 5LFAA 2LAIA 2QFCA 2CG2A 3FFLA 4APFA 3K9IA 3LJNA 3FTWA 1H2TC 1N9AA 3TG4A 2V8SE 1SZAA 2WB2A 3FH8A 4TXRA 2C0LA 3E37A 3HYMB 1DVPA 4FULA 3QOUA 3AAAC 5AN8A 4XX5A 1QQEA 4M7CA 5E75A 3FULA 4E85A 3CVPA 4URKA 4BERA 2EIME 4FA6A 2AXVA 3CSTA 3ISMC 2EIJE 1Y8MA 4NIKA 3MGBA 3ASDA 5D0OD 4ILIA 2KM4A 5ITZF 3Q5MA 5G2NA 5CRUA 3LS8A 1FVFA 5IY5E 4D10C 4XZ4A 4LUNU 3DXKG 1DCQA 4DK5A 3UM3A 3FH5A 3HXCA 1OWNA 3PNTB 4NACA 4CDRA 3TWSA 4HOQA 3DPDA 1S64A 2JABA 2BUGA 3ZUVB 1LD7A 3AG1E 4TUUA 1OWOA 3PVLA 5LX8A 5A6CA 1WM5A 3CHQA 3TWUA 1N94A 2JLBA 2WXFA 3RU0A 3CK8A 4DI4A 1TEZA 3X2QE 2ETAA 3JCKC 4O60A 4EPZA 1A5EA 3ZXPA 1H6PA 2WPVA 3RAUA 3AU4A 1H6OA 4HNAD 5EKQD 4KZCA 4KVOA 2B0OE 4TXQA 4HI9A 2LSVA 3Q15A 5AAOA 1H2UA 4KT6B 2UY1A 4LNBA 1BI7B 2F37A 1NZNA 1TNZA 4WNFA 4ACLA 1VDYA 3AG3E 4U04A 1PC2A 5T4YA 2NSZA 3HRAA 3KD7A 2KZTB 1IQUA 3UM0A 3UT7A 1MX4A 3EIJA 4PS8A 3T5VA 1A17A 2HO1A 1TN8A 3NZSA 3GZSA 1IQRA 3V79K 3G2VA 1LTXA 2YQ8A 1D8EA 1PY1A 3ZN3A 2V4LA 5HRYA 4DI3A 4EECA 4F53A 4WNGA 1K8KG 3DWLG 4AY5A 2FULA 4B93B 3F6QA 5J08A 1OWLA 3FTUA 2XCBA 4MS6A 2DBAA 1H0AA 1MHQA 1L5JA 2IJGX 4JHJA 2AW6A 4YVQC 5BT1A 4JHKA 1V54E 4CRWA 5JMND 3PRZA 3B7RL 4UI9C 4JVSA 4O1OA 4CGVA 1BPOA 4LG6A 1INZA 3ASFA 3RRUA 5ARGA 2VQ2A 3Q7FA 3C98A 1KLXA 3OXGA 3EU5A 5KJKA 3QWVA 3ZKJA 2B6CA 3CHRA 4FADA 4G25A 3G2UA 2P9NG 3D9PA 4I1AA 1MQSA 1WAO1 2DCPA 2KCVA 3CQCB 4U0SA 4ACKA 3LXUX 3UX4A 4L2LA 4A1SA 4GB9A 3RRNB 4Y6WA 2R03A 3CIAA 3LDZA 1N54A 2KCLA 4UWFA 4FJZA 1UW4B 4CEMA 5CMWA 2F8YA 3SQVA 3HXBA 3L16A 1H19A 1KZOA 3DEPA 4ATGA 1AWCB 1IKND 4F3VA 3G2TA 4GZ3A 5G05C 3VLDA 4JA9A 3UT8A 4WWOA 3CV0A 5AJDA 4K03A 1DNPA 3AG4E 1WG0A 2LXMA 3OXLA 4J8FA 5BV1A 3Q49B 4APOA 1OWMA 4BETA 3ZFWA 1OUVA 4CDMA 4WUYA 4KMOA 3ZYMA 4AIFA 2Y4UA 3FUNA 5CMYA 2LUHA 4EZJA 2CHWA 1UN8A 2WXRA 4FU3A 3PE4A 3D9OA 2WVIA 3EHNA 4N3CA 5AQ9A 4YVOA 3FU6A 4CT4A 2WXMA 2X6FA 3ASGA 2I1JA 4M3OA 4OAVB 4DX6D 3Q9UC 1FT1A 2X6KA 2NYJA 3P2BA 2NXPA 4LNUD 2VGXB 2XPYA 3FU0A 5B1BE 3S7FA 2VSOE 1UJKA 1NL4A 5ENRD 3FH7A 1JCRA 4ANVA 2XPZA 2YINA 3G2WA 3AS5A 5KNGA 4ABNA 4QQIA 2R5SA 3PNLB 1HG5A 2IOSA 1E90A 4GZCA 5ENNA 4XIFA 4XEIG 4GTPA 2J4BA 3Q47B 3TL5A 2DIWA 3PEUB 3MA5A 3TG5A 3SZ7A 5D2MC 4U8VD 1KZPA 5CECB 2VGEA 4AOFA 1RZ4A 1B89A 4BEPA 4TV3A 2IFUA 1MX6A 4AP2A 3DSXA 4JXTA 2GW1A 1FPPA 3D9JA 4I2WA 2DZNA 2KZTA 2L9BA 2XRZA 3ULYA 4N5QA 2H6IA 3T8KA 1EPUA 4GTTA 4B8CB 3ABLE 3EHMA 2VSYA 1EF1C 5C2YA 4HRMB 2KCKA 2I2OA 3ML8A 4DJAA 2IOLA 3C3RA 4EQFA 1UJJA 1XGWA 4U8YD 2BKGA 1ZBPA 3CK9A 3ASOE 3DSUA 2EQXA 2AJAA 1TN6A 1BD8A 2LNIA 3KSQA 3ONLA 3FUIA 3KEZA 3PZ1A 3IEGA 2VTBA 2MYOA 3SGHA 2PNNA 4AM9A 1DCEA 3LY9A 4FJYA 3JUEA 3TAXA 3TWXA 3PREA 2PM6A 3MEKA 4G23A 2L0IA 2ZU6B 2X3MA 3DPYA 2I6HA 3ULQA 5D66A 3CHOA 3CEQA 3PZ2A 5CCMA 3FUFA 1UN9A 3HVEB 3TWQA 4GA2A 2J09A 3VTYA 1TJFA 4RVBA 5EYLA 1BLXB 3JXIA 4L2YA 5CEAA 3D3MA 2R2LA 4Q69A 2VYIA 4DX1A 1JUQA 3OXFA 1S0PA 2CHXA 2QYUA 4RG6A 2X6JA 4LSZE 3QNKA 2ZIRA 2WQ6A 1HO8A 3U9WA 4AJWA 4BTBA 2HM8A 4F1PA 3IXEA 4J6IA 3FEXA 4G8LA 5HQ8A 2J9QA 3HIZA 4G11A 1MZCA 2F0YA 3DXMG 4A3TA 2XS8A 2VGYA 5KJNA 4JB8P 4DX7D 3EHRA 4I6JA 2V4HC 3ULEG 4V3IA 3WXXA 3LY8A 3CLJA 3LVRE 4YDEA 2WXLA 2L6JA 4U0UA 4QFVA 2OCCE 3QK0A 3CSFA 2XCCA 2P9SG 4I6GA 3CVYA 3SBSA 3DSTA 3ZEFA 5G04J 4FHJA 4WNDA 4GA1A 4ATZD 3O48A 4YDYA 5E76A 3FTZA 3MKQB 4DPRA 4CYMD 2OEVA 4IYPA 2IU1A 3SFYA 1NI1A 3EIQC 2R17C 3CVUA 4J8EA 4GA0A 3ASHA 4UUCA 3J5QB 3FUHA 3FP3A 3P1UA 2X38A 3UM1A 2XGSA 2DVWA 3QB2A 4ANXA 4GZ5A 1BU9A 2Y69E 5KNHD 3J5PA 4FLBA 4U8HA 1IHBA 1TR4A 3T8MA 3R7QA 3U4TA 2BF0X 2CHZA 3V2XA 5B3SE 3ZYKA 5EN5D 4Q94A 2HYZA 3Q7AA 2QZAA 2AXUA 3VLEA 3PDNA 3D9IA 5AYWD 3TWWA 3WG7E 5CBOA 2XEHA 5EX0A 3QJZA 3IKOB 4LRZA 3BQOA 2OEWA 3UI2A 5EIBE 3MX3A 2A5UA 4ZHBA 4U0ZA 1SQMA 4UI9J 3TWRA 1SA5A 3MZLB 1UG3A 3IHVA 4GZDA 1TNYA 5JJ6A 4I2ZA 3SD5A 1QYMA 2ETBA 3ZGQA 1OCCE 4B8AA 4J0UA 2KC7A 4B94A 3RIBA 3E33A 4I6EA 3W9GA 4U07A 4JHRA 4N2QA 2DYSE 1N4RA 5B1AE 3CK7A 2CG3A 4O6FA 4HVBA 1N0RA 3CVLA 5JJTA 3TWTA 2JEKA 4MRUA 1O5MA 4X8QA 2BKKB 1BI8B 3Q79A 2P9LG 4I43A 3L54A 4N3AA 2M63A 1E96B 5ENSD 3R7RA 3FUEA 2RKKA 3S7BA 5AQ7A 1ELRA 3ESKA 4RG9A 1X5BA 3SFZA 3CKCA 4J8SA 3JUIA 4GPMA 3AS8A 2EINE 2PQNA 3D9NA 4G2VA 4BESA 4JPSA 4ILGA 2XRYA 4FLHA 4K5AB 3RO2A 1O1TA 3LKUA 5G05J 4PS7A 4RLYA 1Z6TA 5M72A 2J07A 4JEUA 3I4RB 4YNDA 5KBAA 4JC8A 2ZGGA 2FEZA 4UWHA 1ZU2A 4JW1A 3DSSA 3NZUA 2HE0A 5CRVA 2XGOA 3B7BA 3HVEA 5FQ8A 1TN7A 4PS3A 1OWPA 4BX9A 2IF4A 2P9IG 3IV0A 4G26A 2L6BA 3QKYA 4HB5A 5LOZA 5FQ7A 4KXKB 1TNOA 3ZHEB 3PUKA 4EZKA 2XQ0A 2ZXWE 3MYVA 1HX8A 3UTMA 5LCWC 1HU3A 2VJ8A 3ZYLA 3T9KA 1JWFA 5AARA 2P58C 2RFMA 2Y4TA 1EYHA 1LD8A 2BTDA 1N0QA 4I17A 5AJLA 3APCA 5FZRA 1QBQA 2OV8A 1KT1A 3DSVA 1E7UA 3FUMA 5FINA 2PL2A 3FUDA 2IO3C 5ENOD 3ABME 1JWGA 2WMOA 3B7UX 4DLOA 5EX3A 1QNFA 4GMLA 5KJLA 5FZSA 4BT9A 4I1MA 5FQ4A 5ENPD 3Q9NC 2PQRA 3AJIA 4OYSA 2AWIA 4L7TA 4RSYA 2YHCA 3ZW3A 2H6FA 4CZ2D 1N4PA 4ANUA 5KCMA 4JA7A 5HI7A 4KYOB 1FCHA 4BSXA 3UMVA 2GRNB 1E8XA 4HOUA 3JXJA 3IBEA 2H6GA 4HRNA 4HRLA 3E32A 2DWZA 4HQDA 1NP7A 4E6HA 2AVPA 3KAEA 1U3DA 1HF8A 2MRIA 2UY1B 3BU8A 3DBSA 2WXHA 5BNWA 3U64A 2XZDG 5DBKA 3CGHA 3GYZA 4YDOA 3SO8A 4J8DA 3UKUG 3HDXA 4IN3B 4TXPA 4LEUA 5JJ7A 3GZ2A 2XZTG 3FHEA 2X6HA 2ZGDA 3CR3A 4K5CA 3APDA 4BSZB 5CHEE 1N4QA 4G1TA 1JCSA 3GW4A 2EIKE 3FTXA 4GMRA 4L9PA 4O1PA 4GYOA 4BWRA 5AIJA 2E0IA 4HXIA 4JZYA 4TUMA 1TYQG 5FJYA 2V0PA 4MKTA 3FUJA 4KVMA 2ILRA 1K1BA 3Q78A 4FP7A 2OVFA 4XKCA 4I9CA 2CFUA 3JYSA 3JQ1A 3SY2A 2V5QC 4CCAA 2QYJA 4J7WA 4MLPA 4LERA 3FEYA 3NF1A 3VLFA 2DZOA 1OCOE 1WY6A 4ILHB 2BEDA 3SI5A 5FQ6A 3DRAA 3ZU7B 3UIOC 5AENA 4EHMA 1ELWA 2WXOA 4ME2A 3VTXA 1OY3D 1JPLA 5BW8C 4GMJA 4PUCA 4IRUA 3MV2B 2IQCA 1OCZE 3PH0C 4Y6CA 4GPKA 4GZ6A 1O1SA 4KZ0A 2AXZA 3APFA 4GYYA 1YA0A 4JD2G 3ZVVA 3AG2E 3LJ3A 4FHKA 2P9UG 2XEVA 3FWVA 1SVXA 4U96D 1Z3XA 1OCRE 3EJNA 3QAQA 3CVQA 4H7YA 3ZNGA 2X6IA 4A1GA 3IHYA 3C3QA 2QY7A 3ABKE 1MX2A 2IONA 4NQ0A 5BXUA 3B7TA 4ANWA 4C0MA 4B89A 1P5QA 3QWPA 4L1BA 2XEEA 2KXPC 3ZPJA 5EIDA 1W3BA 1E8YA 2KBXA 3HXEA 1NFIE 2GGFA 3MKRA 3NQPA 4XI9A 5FZQA 4HLEA 4GTRA 2ETCA 1K3ZD 4GU5A 5EYPF 4U63A 2A5EA 3SNXA 3G2SA 2FBNA 5FIOA 3BG0B 3L22A 1IHGA 1E7VA 2QC9A 3RO3A 4EZLA 3EHQA 4L23A 4GAAA 3D9HA 1TNUA 3CVVA 3ZXSA 4C48B 2Y0BG 2L0TB 4UWKA 4AV7A 1WDYA 3EU9A 3HG0D 3ZHEA 4YDWA 4AEZC 4EBAA 1E8WA 2LSUA 1SZ9A 2WXKA 2I9CA 2R59A 2WQHA 3UM2A 3UQ3A 3KSLA 4GTQA 2YNQA 3FTYA 2RFAA 3QC1A 2EILE 2XHEA 3NOGD 4K5BA 2GRLA 3CVXA 4AXHA 4WAFA 3QWWA 4GTMA 3PEVB 3Q75A 2WM9A 5FWQA 5KWDA 2DYRE 3Q4AB 5HKPA 3GZ1A 4RQIA 4DRXE 2FO1E 4XI0A 3U66A 5D0QD 4DX5D 1IYGA 2YHEA 3RK6A 1QZ2A 3CVNA 3W9FA 4HLLA 2R05A 4F1SA 5G04C 2GRMA 2VGXA 3FTVA 3N71A 4GCNA 5HS0A 1FVHA 3UT4A 3TWVA 3UPVA 3FTSA 1G3NB 4FC8A 4BT8A 4UWGA 4A55A 4I9EA 3D9MA 2MHKA 5A23A 3LEWA 3TGOA 3RKVA 2NC9A 3ESLA 2GROB 3LYAA 1DC2A 4HORA 2HR2A 2V5FA 3MCXA 3FDHA 5J90A 2CFZA 1UOHA 1PAQA 2I1KA 5FT9A 3L6AA 2XENA 1Q2ZA 1E8ZA 1OXJA 5BXOA 2J4DA 1SA4A 3PE3A 2J49A 5T8IA 3UXGA 4LNGA 4UQZA 4OVVA 5LP0A 3OTNA 3FU3A 2H6HA 2C0MA 1N52A 4N5CA 4WWPA 3Q73A 1Y6IA 5CCLA 4K0RA 4HBDA 4H7XA 4WNEA 4W9RA 3B95A 3I3NA 4MBGA 3RJVA 4ZFHA 3NBNB 3HXFA 1S70B 2IO2C 1ZB1A 5BV0A 3DEOA 3C3OA 2VTBB 3ASNE 3O4ZA 4WWNA 3V30A 4GCOA 2FF4A 4BX8A 2MOWA 5AQBA 1N11A 4HS2A 3S2AA 4NURA 2WXJA 5DIZA 1H2VC 3UUXA 3CHSA 2LXLA 4KBQA 2P2CP 3SF4A 1D9SA 3ZYQA 1RW2A 4NRHB 1FT2A 2Q7FA 4AY6A 4G8KA 5ANRA 4BTAA 3MJWA 3V2OA 2VSXE 1KT0A 1ELKA 4N39A 3D9KA 4Z68A 5BPPA 4A63B 3EUVA 5LCWJ 1Z5SC 1SW6A 4AVXA 3UKRG 1S63A 5JHAA 3ONKA 1X81A 1O1RA 4R7LA 5BUZA 4IULA 3FY4A 4UI9K 2LAHA 5ENTD 3SBTB 3BUAA 3URZA 5T3RA 2ZISA 2WXQA 4N3BA 4BY6A 2UWJG 1H6KA 3V31A 1D8DA 2RG8A 2XPIA 4Q96A 3L9TA 2OOEA 5KJMA 2VSNA 2Y3AA 3MV3B 1YYHA 5EILA 1HE8A 5C1DA 3EDTB 5FTPA 4HFGA 4CT0A 3I4GA 2KATA 5CBNA 3PZDA 3KEAA 2A4ZA 5CERB 3CHMA 3UIPC 2GRPB 1HS6A 3L08A 2PZIA 3CKBA 4GTSA 1Z3YA 3L17A 2IY0C 5ANLA 2P9KG 3UINC 3FUKA 3RSEG 2WQ7A 1NA0A 3HXDA 2J8SD
chains in the Genus database with same CATH topology
1OCRE 1OCZE 1V55E 2EINE 1OCOE 2EIJE 2Y69E 3AG3E 2DYSE 3ASNE 3AG4E 5B1BE 5B1AE 2EIKE 3ASOE 3WG7E 2OCCE 2ZXWE 3ABME 2EIME 3ABKE 3AG2E 3X2QE 5IY5E 1V54E 3AG1E 3ABLE 2DYRE 5B3SE 1OCCE 2EILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR E;  1OCZ E;  1V55 E;  2EIN E;  1OCO E;  2EIJ E;  2Y69 E;  3AG3 E;  2DYS E;  3ASN E;  3AG4 E;  5B1B E;  5B1A E;  2EIK E;  3ASO E;  3WG7 E;  2OCC E;  2ZXW E;  3ABM E;  2EIM E;  3ABK E;  3AG2 E;  3X2Q E;  5IY5 E;  1V54 E;  3AG1 E;  3ABL E;  2DYR E;  5B3S E;  1OCC E;  2EIL E; 
#chains in the Genus database with same CATH topology
 3LCA A;  4CGW A;  1AP7 A;  3RRM B;  4I1O B;  3R9M A;  1MJ0 A;  3ML9 A;  1HZ4 A;  1YMP A;  2WXP A;  3OAW A;  2FI7 A;  3ENE A;  3E30 A;  4HI8 A;  2RD0 A;  2P9P G;  3CVW A;  4F6R D;  3LY7 A;  5EDS A;  4UWL A;  4U95 D;  4C9B B;  3CQG B;  1MYO A;  2LO6 A;  1N4S A;  3MKQ A;  4TRQ A;  4B0Z A;  2F8X K;  4PH4 B;  2E2E A;  1HXI A;  4LCT A;  3NAW A;  1HH8 A;  4GTO A;  3L13 A;  2FO7 A;  4OVU A;  3NOC D;  4P29 A;  1TNB A;  1JCQ A;  3PZ3 A;  3FU5 A;  4DUI A;  5ARF A;  3DSW A;  1N95 A;  5JA4 D;  3U3W A;  4DX2 A;  3C72 A;  3ZRH A;  2IEJ A;  3KS2 A;  2OVB A;  2XGM A;  4HOS A;  1EDU A;  1GW6 A;  2WXG A;  4XKB A;  3QDN A;  3B13 A;  1XNF A;  4OAU C;  4HOT A;  3SHF A;  4XE0 A;  3TJP A;  4UQX A;  4F7A A;  2WMN A;  3I5P A;  2GRQ B;  1V55 E;  3E34 A;  1K1A A;  4CDN A;  3AS4 A;  3TXM A;  5AQA A;  4G24 A;  4JEH A;  1KPS B;  2C2L A;  3JQ0 A;  4BFR A;  1U3C A;  3ZIM A;  4JL0 A;  4PDX A;  3LVQ E;  4N2S A;  5G55 A;  4C0E A;  5H7P A;  3PUJ A;  4J8Y A;  1IXV A;  2WXI A;  4GYW A;  1TJC A;  1HFA A;  3L82 A;  4A3V A;  3E4B A;  2PM7 A;  4EBA G;  3PS6 A;  2XS1 A;  2OND A;  3CHP A;  3TXN A;  1OT8 A;  3AU5 A;  5JHB A;  3T5X A;  3QAR A;  3BEE A;  4UQY A;  1NA3 A;  1HG2 A;  1YCS B;  3NB2 A;  4DLQ A;  3S7J A;  5ENQ D;  3B7S A;  4U7E B;  3HHM A;  3PZ4 A;  2WXN A;  3C5R A;  3S7D A;  2Y1L E;  3D9L A;  5CED B;  2GRR B;  2J08 A;  2R02 A;  3LPZ A;  3R9A B;  4GTV A;  5A7D B;  3BG1 B;  1LF8 A;  1U2V G;  3SFX A;  5LFA A;  2LAI A;  2QFC A;  2CG2 A;  3FFL A;  4APF A;  3K9I A;  3LJN A;  3FTW A;  1H2T C;  1N9A A;  3TG4 A;  2V8S E;  1SZA A;  2WB2 A;  3FH8 A;  4TXR A;  2C0L A;  3E37 A;  3HYM B;  1DVP A;  4FUL A;  3QOU A;  3AAA C;  5AN8 A;  4XX5 A;  1QQE A;  4M7C A;  5E75 A;  3FUL A;  4E85 A;  3CVP A;  4URK A;  4BER A;  2EIM E;  4FA6 A;  2AXV A;  3CST A;  3ISM C;  2EIJ E;  1Y8M A;  4NIK A;  3MGB A;  3ASD A;  5D0O D;  4ILI A;  2KM4 A;  5ITZ F;  3Q5M A;  5G2N A;  5CRU A;  3LS8 A;  1FVF A;  5IY5 E;  4D10 C;  4XZ4 A;  4LUN U;  3DXK G;  1DCQ A;  4DK5 A;  3UM3 A;  3FH5 A;  3HXC A;  1OWN A;  3PNT B;  4NAC A;  4CDR A;  3TWS A;  4HOQ A;  3DPD A;  1S64 A;  2JAB A;  2BUG A;  3ZUV B;  1LD7 A;  3AG1 E;  4TUU A;  1OWO A;  3PVL A;  5LX8 A;  5A6C A;  1WM5 A;  3CHQ A;  3TWU A;  1N94 A;  2JLB A;  2WXF A;  3RU0 A;  3CK8 A;  4DI4 A;  1TEZ A;  3X2Q E;  2ETA A;  3JCK C;  4O60 A;  4EPZ A;  1A5E A;  3ZXP A;  1H6P A;  2WPV A;  3RAU A;  3AU4 A;  1H6O A;  4HNA D;  5EKQ D;  4KZC A;  4KVO A;  2B0O E;  4TXQ A;  4HI9 A;  2LSV A;  3Q15 A;  5AAO A;  1H2U A;  4KT6 B;  2UY1 A;  4LNB A;  1BI7 B;  2F37 A;  1NZN A;  1TNZ A;  4WNF A;  4ACL A;  1VDY A;  3AG3 E;  4U04 A;  1PC2 A;  5T4Y A;  2NSZ A;  3HRA A;  3KD7 A;  2KZT B;  1IQU A;  3UM0 A;  3UT7 A;  1MX4 A;  3EIJ A;  4PS8 A;  3T5V A;  1A17 A;  2HO1 A;  1TN8 A;  3NZS A;  3GZS A;  1IQR A;  3V79 K;  3G2V A;  1LTX A;  2YQ8 A;  1D8E A;  1PY1 A;  3ZN3 A;  2V4L A;  5HRY A;  4DI3 A;  4EEC A;  4F53 A;  4WNG A;  1K8K G;  3DWL G;  4AY5 A;  2FUL A;  4B93 B;  3F6Q A;  5J08 A;  1OWL A;  3FTU A;  2XCB A;  4MS6 A;  2DBA A;  1H0A A;  1MHQ A;  1L5J A;  2IJG X;  4JHJ A;  2AW6 A;  4YVQ C;  5BT1 A;  4JHK A;  1V54 E;  4CRW A;  5JMN D;  3PRZ A;  3B7R L;  4UI9 C;  4JVS A;  4O1O A;  4CGV A;  1BPO A;  4LG6 A;  1INZ A;  3ASF A;  3RRU A;  5ARG A;  2VQ2 A;  3Q7F A;  3C98 A;  1KLX A;  3OXG A;  3EU5 A;  5KJK A;  3QWV A;  3ZKJ A;  2B6C A;  3CHR A;  4FAD A;  4G25 A;  3G2U A;  2P9N G;  3D9P A;  4I1A A;  1MQS A;  1WAO 1;  2DCP A;  2KCV A;  3CQC B;  4U0S A;  4ACK A;  3LXU X;  3UX4 A;  4L2L A;  4A1S A;  4GB9 A;  3RRN B;  4Y6W A;  2R03 A;  3CIA A;  3LDZ A;  1N54 A;  2KCL A;  4UWF A;  4FJZ A;  1UW4 B;  4CEM A;  5CMW A;  2F8Y A;  3SQV A;  3HXB A;  3L16 A;  1H19 A;  1KZO A;  3DEP A;  4ATG A;  1AWC B;  1IKN D;  4F3V A;  3G2T A;  4GZ3 A;  5G05 C;  3VLD A;  4JA9 A;  3UT8 A;  4WWO A;  3CV0 A;  5AJD A;  4K03 A;  1DNP A;  3AG4 E;  1WG0 A;  2LXM A;  3OXL A;  4J8F A;  5BV1 A;  3Q49 B;  4APO A;  1OWM A;  4BET A;  3ZFW A;  1OUV A;  4CDM A;  4WUY A;  4KMO A;  3ZYM A;  4AIF A;  2Y4U A;  3FUN A;  5CMY A;  2LUH A;  4EZJ A;  2CHW A;  1UN8 A;  2WXR A;  4FU3 A;  3PE4 A;  3D9O A;  2WVI A;  3EHN A;  4N3C A;  5AQ9 A;  4YVO A;  3FU6 A;  4CT4 A;  2WXM A;  2X6F A;  3ASG A;  2I1J A;  4M3O A;  4OAV B;  4DX6 D;  3Q9U C;  1FT1 A;  2X6K A;  2NYJ A;  3P2B A;  2NXP A;  4LNU D;  2VGX B;  2XPY A;  3FU0 A;  5B1B E;  3S7F A;  2VSO E;  1UJK A;  1NL4 A;  5ENR D;  3FH7 A;  1JCR A;  4ANV A;  2XPZ A;  2YIN A;  3G2W A;  3AS5 A;  5KNG A;  4ABN A;  4QQI A;  2R5S A;  3PNL B;  1HG5 A;  2IOS A;  1E90 A;  4GZC A;  5ENN A;  4XIF A;  4XEI G;  4GTP A;  2J4B A;  3Q47 B;  3TL5 A;  2DIW A;  3PEU B;  3MA5 A;  3TG5 A;  3SZ7 A;  5D2M C;  4U8V D;  1KZP A;  5CEC B;  2VGE A;  4AOF A;  1RZ4 A;  1B89 A;  4BEP A;  4TV3 A;  2IFU A;  1MX6 A;  4AP2 A;  3DSX A;  4JXT A;  2GW1 A;  1FPP A;  3D9J A;  4I2W A;  2DZN A;  2KZT A;  2L9B A;  2XRZ A;  3ULY A;  4N5Q A;  2H6I A;  3T8K A;  1EPU A;  4GTT A;  4B8C B;  3ABL E;  3EHM A;  2VSY A;  1EF1 C;  5C2Y A;  4HRM B;  2KCK A;  2I2O A;  3ML8 A;  4DJA A;  2IOL A;  3C3R A;  4EQF A;  1UJJ A;  1XGW A;  4U8Y D;  2BKG A;  1ZBP A;  3CK9 A;  3ASO E;  3DSU A;  2EQX A;  2AJA A;  1TN6 A;  1BD8 A;  2LNI A;  3KSQ A;  3ONL A;  3FUI A;  3KEZ A;  3PZ1 A;  3IEG A;  2VTB A;  2MYO A;  3SGH A;  2PNN A;  4AM9 A;  1DCE A;  3LY9 A;  4FJY A;  3JUE A;  3TAX A;  3TWX A;  3PRE A;  2PM6 A;  3MEK A;  4G23 A;  2L0I A;  2ZU6 B;  2X3M A;  3DPY A;  2I6H A;  3ULQ A;  5D66 A;  3CHO A;  3CEQ A;  3PZ2 A;  5CCM A;  3FUF A;  1UN9 A;  3HVE B;  3TWQ A;  4GA2 A;  2J09 A;  3VTY A;  1TJF A;  4RVB A;  5EYL A;  1BLX B;  3JXI A;  4L2Y A;  5CEA A;  3D3M A;  2R2L A;  4Q69 A;  2VYI A;  4DX1 A;  1JUQ A;  3OXF A;  1S0P A;  2CHX A;  2QYU A;  4RG6 A;  2X6J A;  4LSZ E;  3QNK A;  2ZIR A;  2WQ6 A;  1HO8 A;  3U9W A;  4AJW A;  4BTB A;  2HM8 A;  4F1P A;  3IXE A;  4J6I A;  3FEX A;  4G8L A;  5HQ8 A;  2J9Q A;  3HIZ A;  4G11 A;  1MZC A;  2F0Y A;  3DXM G;  4A3T A;  2XS8 A;  2VGY A;  5KJN A;  4JB8 P;  4DX7 D;  3EHR A;  4I6J A;  2V4H C;  3ULE G;  4V3I A;  3WXX A;  3LY8 A;  3CLJ A;  3LVR E;  4YDE A;  2WXL A;  2L6J A;  4U0U A;  4QFV A;  2OCC E;  3QK0 A;  3CSF A;  2XCC A;  2P9S G;  4I6G A;  3CVY A;  3SBS A;  3DST A;  3ZEF A;  5G04 J;  4FHJ A;  4WND A;  4GA1 A;  4ATZ D;  3O48 A;  4YDY A;  5E76 A;  3FTZ A;  3MKQ B;  4DPR A;  4CYM D;  2OEV A;  4IYP A;  2IU1 A;  3SFY A;  1NI1 A;  3EIQ C;  2R17 C;  3CVU A;  4J8E A;  4GA0 A;  3ASH A;  4UUC A;  3J5Q B;  3FUH A;  3FP3 A;  3P1U A;  2X38 A;  3UM1 A;  2XGS A;  2DVW A;  3QB2 A;  4ANX A;  4GZ5 A;  1BU9 A;  2Y69 E;  5KNH D;  3J5P A;  4FLB A;  4U8H A;  1IHB A;  1TR4 A;  3T8M A;  3R7Q A;  3U4T A;  2BF0 X;  2CHZ A;  3V2X A;  5B3S E;  3ZYK A;  5EN5 D;  4Q94 A;  2HYZ A;  3Q7A A;  2QZA A;  2AXU A;  3VLE A;  3PDN A;  3D9I A;  5AYW D;  3TWW A;  3WG7 E;  5CBO A;  2XEH A;  5EX0 A;  3QJZ A;  3IKO B;  4LRZ A;  3BQO A;  2OEW A;  3UI2 A;  5EIB E;  3MX3 A;  2A5U A;  4ZHB A;  4U0Z A;  1SQM A;  4UI9 J;  3TWR A;  1SA5 A;  3MZL B;  1UG3 A;  3IHV A;  4GZD A;  1TNY A;  5JJ6 A;  4I2Z A;  3SD5 A;  1QYM A;  2ETB A;  3ZGQ A;  1OCC E;  4B8A A;  4J0U A;  2KC7 A;  4B94 A;  3RIB A;  3E33 A;  4I6E A;  3W9G A;  4U07 A;  4JHR A;  4N2Q A;  2DYS E;  1N4R A;  5B1A E;  3CK7 A;  2CG3 A;  4O6F A;  4HVB A;  1N0R A;  3CVL A;  5JJT A;  3TWT A;  2JEK A;  4MRU A;  1O5M A;  4X8Q A;  2BKK B;  1BI8 B;  3Q79 A;  2P9L G;  4I43 A;  3L54 A;  4N3A A;  2M63 A;  1E96 B;  5ENS D;  3R7R A;  3FUE A;  2RKK A;  3S7B A;  5AQ7 A;  1ELR A;  3ESK A;  4RG9 A;  1X5B A;  3SFZ A;  3CKC A;  4J8S A;  3JUI A;  4GPM A;  3AS8 A;  2EIN E;  2PQN A;  3D9N A;  4G2V A;  4BES A;  4JPS A;  4ILG A;  2XRY A;  4FLH A;  4K5A B;  3RO2 A;  1O1T A;  3LKU A;  5G05 J;  4PS7 A;  4RLY A;  1Z6T A;  5M72 A;  2J07 A;  4JEU A;  3I4R B;  4YND A;  5KBA A;  4JC8 A;  2ZGG A;  2FEZ A;  4UWH A;  1ZU2 A;  4JW1 A;  3DSS A;  3NZU A;  2HE0 A;  5CRV A;  2XGO A;  3B7B A;  3HVE A;  5FQ8 A;  1TN7 A;  4PS3 A;  1OWP A;  4BX9 A;  2IF4 A;  2P9I G;  3IV0 A;  4G26 A;  2L6B A;  3QKY A;  4HB5 A;  5LOZ A;  5FQ7 A;  4KXK B;  1TNO A;  3ZHE B;  3PUK A;  4EZK A;  2XQ0 A;  2ZXW E;  3MYV A;  1HX8 A;  3UTM A;  5LCW C;  1HU3 A;  2VJ8 A;  3ZYL A;  3T9K A;  1JWF A;  5AAR A;  2P58 C;  2RFM A;  2Y4T A;  1EYH A;  1LD8 A;  2BTD A;  1N0Q A;  4I17 A;  5AJL A;  3APC A;  5FZR A;  1QBQ A;  2OV8 A;  1KT1 A;  3DSV A;  1E7U A;  3FUM A;  5FIN A;  2PL2 A;  3FUD A;  2IO3 C;  5ENO D;  3ABM E;  1JWG A;  2WMO A;  3B7U X;  4DLO A;  5EX3 A;  1QNF A;  4GML A;  5KJL A;  5FZS A;  4BT9 A;  4I1M A;  5FQ4 A;  5ENP D;  3Q9N C;  2PQR A;  3AJI A;  4OYS A;  2AWI A;  4L7T A;  4RSY A;  2YHC A;  3ZW3 A;  2H6F A;  4CZ2 D;  1N4P A;  4ANU A;  5KCM A;  4JA7 A;  5HI7 A;  4KYO B;  1FCH A;  4BSX A;  3UMV A;  2GRN B;  1E8X A;  4HOU A;  3JXJ A;  3IBE A;  2H6G A;  4HRN A;  4HRL A;  3E32 A;  2DWZ A;  4HQD A;  1NP7 A;  4E6H A;  2AVP A;  3KAE A;  1U3D A;  1HF8 A;  2MRI A;  2UY1 B;  3BU8 A;  3DBS A;  2WXH A;  5BNW A;  3U64 A;  2XZD G;  5DBK A;  3CGH A;  3GYZ A;  4YDO A;  3SO8 A;  4J8D A;  3UKU G;  3HDX A;  4IN3 B;  4TXP A;  4LEU A;  5JJ7 A;  3GZ2 A;  2XZT G;  3FHE A;  2X6H A;  2ZGD A;  3CR3 A;  4K5C A;  3APD A;  4BSZ B;  5CHE E;  1N4Q A;  4G1T A;  1JCS A;  3GW4 A;  2EIK E;  3FTX A;  4GMR A;  4L9P A;  4O1P A;  4GYO A;  4BWR A;  5AIJ A;  2E0I A;  4HXI A;  4JZY A;  4TUM A;  1TYQ G;  5FJY A;  2V0P A;  4MKT A;  3FUJ A;  4KVM A;  2ILR A;  1K1B A;  3Q78 A;  4FP7 A;  2OVF A;  4XKC A;  4I9C A;  2CFU A;  3JYS A;  3JQ1 A;  3SY2 A;  2V5Q C;  4CCA A;  2QYJ A;  4J7W A;  4MLP A;  4LER A;  3FEY A;  3NF1 A;  3VLF A;  2DZO A;  1OCO E;  1WY6 A;  4ILH B;  2BED A;  3SI5 A;  5FQ6 A;  3DRA A;  3ZU7 B;  3UIO C;  5AEN A;  4EHM A;  1ELW A;  2WXO A;  4ME2 A;  3VTX A;  1OY3 D;  1JPL A;  5BW8 C;  4GMJ A;  4PUC A;  4IRU A;  3MV2 B;  2IQC A;  1OCZ E;  3PH0 C;  4Y6C A;  4GPK A;  4GZ6 A;  1O1S A;  4KZ0 A;  2AXZ A;  3APF A;  4GYY A;  1YA0 A;  4JD2 G;  3ZVV A;  3AG2 E;  3LJ3 A;  4FHK A;  2P9U G;  2XEV A;  3FWV A;  1SVX A;  4U96 D;  1Z3X A;  1OCR E;  3EJN A;  3QAQ A;  3CVQ A;  4H7Y A;  3ZNG A;  2X6I A;  4A1G A;  3IHY A;  3C3Q A;  2QY7 A;  3ABK E;  1MX2 A;  2ION A;  4NQ0 A;  5BXU A;  3B7T A;  4ANW A;  4C0M A;  4B89 A;  1P5Q A;  3QWP A;  4L1B A;  2XEE A;  2KXP C;  3ZPJ A;  5EID A;  1W3B A;  1E8Y A;  2KBX A;  3HXE A;  1NFI E;  2GGF A;  3MKR A;  3NQP A;  4XI9 A;  5FZQ A;  4HLE A;  4GTR A;  2ETC A;  1K3Z D;  4GU5 A;  5EYP F;  4U63 A;  2A5E A;  3SNX A;  3G2S A;  2FBN A;  5FIO A;  3BG0 B;  3L22 A;  1IHG A;  1E7V A;  2QC9 A;  3RO3 A;  4EZL A;  3EHQ A;  4L23 A;  4GAA A;  3D9H A;  1TNU A;  3CVV A;  3ZXS A;  4C48 B;  2Y0B G;  2L0T B;  4UWK A;  4AV7 A;  1WDY A;  3EU9 A;  3HG0 D;  3ZHE A;  4YDW A;  4AEZ C;  4EBA A;  1E8W A;  2LSU A;  1SZ9 A;  2WXK A;  2I9C A;  2R59 A;  2WQH A;  3UM2 A;  3UQ3 A;  3KSL A;  4GTQ A;  2YNQ A;  3FTY A;  2RFA A;  3QC1 A;  2EIL E;  2XHE A;  3NOG D;  4K5B A;  2GRL A;  3CVX A;  4AXH A;  4WAF A;  3QWW A;  4GTM A;  3PEV B;  3Q75 A;  2WM9 A;  5FWQ A;  5KWD A;  2DYR E;  3Q4A B;  5HKP A;  3GZ1 A;  4RQI A;  4DRX E;  2FO1 E;  4XI0 A;  3U66 A;  5D0Q D;  4DX5 D;  1IYG A;  2YHE A;  3RK6 A;  1QZ2 A;  3CVN A;  3W9F A;  4HLL A;  2R05 A;  4F1S A;  5G04 C;  2GRM A;  2VGX A;  3FTV A;  3N71 A;  4GCN A;  5HS0 A;  1FVH A;  3UT4 A;  3TWV A;  3UPV A;  3FTS A;  1G3N B;  4FC8 A;  4BT8 A;  4UWG A;  4A55 A;  4I9E A;  3D9M A;  2MHK A;  5A23 A;  3LEW A;  3TGO A;  3RKV A;  2NC9 A;  3ESL A;  2GRO B;  3LYA A;  1DC2 A;  4HOR A;  2HR2 A;  2V5F A;  3MCX A;  3FDH A;  5J90 A;  2CFZ A;  1UOH A;  1PAQ A;  2I1K A;  5FT9 A;  3L6A A;  2XEN A;  1Q2Z A;  1E8Z A;  1OXJ A;  5BXO A;  2J4D A;  1SA4 A;  3PE3 A;  2J49 A;  5T8I A;  3UXG A;  4LNG A;  4UQZ A;  4OVV A;  5LP0 A;  3OTN A;  3FU3 A;  2H6H A;  2C0M A;  1N52 A;  4N5C A;  4WWP A;  3Q73 A;  1Y6I A;  5CCL A;  4K0R A;  4HBD A;  4H7X A;  4WNE A;  4W9R A;  3B95 A;  3I3N A;  4MBG A;  3RJV A;  4ZFH A;  3NBN B;  3HXF A;  1S70 B;  2IO2 C;  1ZB1 A;  5BV0 A;  3DEO A;  3C3O A;  2VTB B;  3ASN E;  3O4Z A;  4WWN A;  3V30 A;  4GCO A;  2FF4 A;  4BX8 A;  2MOW A;  5AQB A;  1N11 A;  4HS2 A;  3S2A A;  4NUR A;  2WXJ A;  5DIZ A;  1H2V C;  3UUX A;  3CHS A;  2LXL A;  4KBQ A;  2P2C P;  3SF4 A;  1D9S A;  3ZYQ A;  1RW2 A;  4NRH B;  1FT2 A;  2Q7F A;  4AY6 A;  4G8K A;  5ANR A;  4BTA A;  3MJW A;  3V2O A;  2VSX E;  1KT0 A;  1ELK A;  4N39 A;  3D9K A;  4Z68 A;  5BPP A;  4A63 B;  3EUV A;  5LCW J;  1Z5S C;  1SW6 A;  4AVX A;  3UKR G;  1S63 A;  5JHA A;  3ONK A;  1X81 A;  1O1R A;  4R7L A;  5BUZ A;  4IUL A;  3FY4 A;  4UI9 K;  2LAH A;  5ENT D;  3SBT B;  3BUA A;  3URZ A;  5T3R A;  2ZIS A;  2WXQ A;  4N3B A;  4BY6 A;  2UWJ G;  1H6K A;  3V31 A;  1D8D A;  2RG8 A;  2XPI A;  4Q96 A;  3L9T A;  2OOE A;  5KJM A;  2VSN A;  2Y3A A;  3MV3 B;  1YYH A;  5EIL A;  1HE8 A;  5C1D A;  3EDT B;  5FTP A;  4HFG A;  4CT0 A;  3I4G A;  2KAT A;  5CBN A;  3PZD A;  3KEA A;  2A4Z A;  5CER B;  3CHM A;  3UIP C;  2GRP B;  1HS6 A;  3L08 A;  2PZI A;  3CKB A;  4GTS A;  1Z3Y A;  3L17 A;  2IY0 C;  5ANL A;  2P9K G;  3UIN C;  3FUK A;  3RSE G;  2WQ7 A;  1NA0 A;  3HXD A;  2J8S D; 
#chains in the Genus database with same CATH homology
 1OCR E;  1OCZ E;  1V55 E;  2EIN E;  1OCO E;  2EIJ E;  2Y69 E;  3AG3 E;  2DYS E;  3ASN E;  3AG4 E;  5B1B E;  5B1A E;  2EIK E;  3ASO E;  3WG7 E;  2OCC E;  2ZXW E;  3ABM E;  2EIM E;  3ABK E;  3AG2 E;  3X2Q E;  5IY5 E;  1V54 E;  3AG1 E;  3ABL E;  2DYR E;  5B3S E;  1OCC E;  2EIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...