2ZXWE

Bovine heart cytochrome c oxidase at the fully oxidized state (1-s x-ray exposure dataset)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
104
structure length
104
Chain Sequence
b'ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2zxwE00
3AG3E 5IY5E 2DYRE 2EINE 1OCCE 3ABME 3ABLE 5B1BE 3ASOE 1V55E 2Y69E 3WG7E 3AG2E 1OCZE 2ZXWE 1V54E 3X2QE 2EIJE 3ASNE 2EILE 3ABKE 5B1AE 5B3SE 1OCOE 2OCCE 2EIME 3AG4E 2DYSE 3AG1E 1OCRE 2EIKE
chains in the Genus database with same CATH superfamily
2EQXA 1JUQA 3D9NA 2HO1A 5ENRD 1YMPA 4P29A 3EIJA 1EF1C 2AJAA 4AV7A 4FA6A 3FY4A 2RKKA 5CRUA 3Q73A 2KZTA 5E75A 5B3SE 4PH4B 2OCCE 1HG5A 3FUHA 4UI9J 2DWZA 3L22A 2PNNA 1MZCA 4AY6A 1HH8A 2YINA 4L2YA 3RAUA 3OTNA 3ABLE 3C3OA 4L7TA 4TXRA 2JEKA 3CVLA 3BG0B 1Z5SC 3CR3A 4I1MA 4AJWA 1OUVA 2IFUA 4CGWA 5CBOA 3D9KA 4ILGA 1TJCA 3FP3A 5HS0A 2XEEA 4GTOA 2LSUA 4XIFA 1JWFA 4XZ4A 3ZIMA 1SZ9A 4GA2A 3B7BA 3DSWA 4EZKA 3CK8A 4BSXA 2WMNA 1YYHA 4J7WA 4ATGA 1TNBA 3U4TA 1NL4A 1E7UA 4A63B 4YDEA 4N39A 3TGOA 4LUNU 4ILIA 2UY1A 3CHQA 3EHMA 3L17A 1H2TC 3ASGA 4N2SA 4I6JA 4F53A 3DWLG 4AXHA 5FQ6A 4JEHA 4QQIA 2WPVA 3CKCA 2P9NG 3SFYA 4XI9A 3V30A 4GZ5A 3R7QA 3V79K 4I9EA 1UJJA 3QB2A 3C3QA 5AQ7A 5EIBE 4KVMA 3UIOC 3QK0A 3U66A 5CBNA 5C1DA 4WWNA 2WXKA 2NC9A 2GRMA 4KMOA 4E6HA 4BY6A 1BPOA 3PE3A 1WDYA 2QZAA 4KXKB 3Q75A 1TYQG 2FO1E 4GB9A 2XRZA 4KVOA 4ANUA 1LD7A 2J4BA 3MV3B 1KT1A 1ZU2A 3SI5A 1SVXA 1OWMA 1MX2A 1O5MA 3G2TA 2C0MA 5AAOA 4U7EB 3PZ2A 1N0RA 3VLFA 3UT8A 2BKGA 3BUAA 5D66A 3FUEA 4HNAD 5ANRA 3V2XA 5CERB 3TAXA 2XRYA 3HXEA 4BETA 4BESA 1TN8A 5ENSD 3UX4A 4QFVA 1KLXA 4MKTA 3BQOA 2R17C 1X5BA 2X6KA 5KNGA 3FU5A 4EZLA 2A4ZA 3OXFA 4KYOB 5T3RA 1WAO1 4TUMA 3D9HA 4APOA 2EILE 2VSNA 4ACKA 3DXKG 2IOSA 4B94A 1DNPA 4KT6B 3Q79A 2ZGGA 3NBNB 4JL0A 1OWPA 3UT4A 2DYRE 3TWSA 3QNKA 4BT9A 4CZ2D 2IQCA 3CVWA 4IRUA 3NZSA 3PDNA 2B0OE 2L6BA 1E7VA 2P9PG 3ULYA 5HQ8A 2IU1A 3L9TA 1N94A 5G04J 5KJNA 1OWNA 3NF1A 3DSXA 3JXIA 4U8VD 4C9BB 4HRLA 4AVXA 3QAQA 4R7LA 3S7JA 3MJWA 3R9AB 3FTZA 3ONLA 5DBKA 5KWDA 1Z3YA 3W9GA 2Y4UA 1OXJA 4H7YA 2I9CA 4ABNA 2WXMA 4A1SA 2ZU6B 2HR2A 5KJKA 3I4RB 3GZ1A 4DX6D 4W9RA 5ENPD 4U0SA 1ELWA 3V31A 5FQ7A 2JLBA 4HLEA 2HM8A 3QWWA 1GW6A 4HVBA 1JCSA 5BT1A 1QYMA 1A17A 3EDTB 2KATA 1IXVA 1LTXA 3LJ3A 4I6EA 4NQ0A 1A5EA 4HOSA 4UQZA 3CHPA 4GZ6A 2P58C 4B0ZA 3AS5A 4ANWA 4JXTA 2EINE 4K0RA 3PREA 5KJLA 3HXDA 3VTXA 3KEZA 4BT8A 2BTDA 3FDHA 2ZGDA 4UWFA 1WG0A 4HRNA 2Q7FA 2R05A 3FUJA 1JPLA 1N9AA 4FC8A 2GGFA 5CRVA 3JQ0A 1AWCB 2CHWA 2IO2C 4TRQA 2CHZA 3ASDA 4DLOA 2Y4TA 4Q96A 3ZYQA 4C0MA 1KT0A 2WXLA 3UXGA 2FI7A 2WVIA 4BTAA 1UOHA 3PNLB 1OWOA 3ZEFA 2KM4A 3RJVA 5D0OD 4D10C 2PM7A 2VTBB 3MCXA 3ML9A 2QY7A 1JCQA 1ELRA 4RQIA 1E96B 4N2QA 4HRMB 3LY8A 1JWGA 2VGEA 1N95A 3IKOB 2XZDG 4E85A 2FEZA 3KS2A 3EU5A 3MKQB 5BV0A 1EPUA 3DPYA 3FUFA 1QNFA 3SHFA 3PUKA 2FULA 4I6GA 4PS8A 5JHBA 3ZN3A 1BLXB 4JW1A 2VSXE 2AXUA 3PUJA 3PZDA 4J8DA 4HI9A 4K03A 3ASNE 1S64A 2VGYA 1MYOA 1BU9A 2Y0BG 2L6JA 4GCNA 4HOQA 4A3VA 3PRZA 4Q94A 3FU0A 4J6IA 4ZHBA 2J08A 5KJMA 2X6JA 5EDSA 5CHEE 2OVFA 3GYZA 2QC9A 1W3BA 3NAWA 3ZKJA 1FCHA 3JQ1A 2WXIA 3DBSA 2ZIRA 3CQCB 5FWQA 4EBAG 3RK6A 3C98A 1OWLA 1H6PA 5EX3A 5T8IA 3L6AA 4CGVA 4M3OA 4CDMA 5KCMA 3MA5A 3C3RA 5BV1A 4GTVA 4G2VA 3E4BA 4U95D 4U8YD 3G2SA 4UWHA 1FVHA 2FO7A 4L9PA 3FUIA 3QDNA 4GAAA 2IOLA 2Y3AA 3HDXA 3FTWA 3T8MA 3MKRA 2WXOA 4FJYA 3DSVA 1MX6A 4K5AB 2V4HC 2VGXA 2PM6A 2C0LA 4AEZC 3FHEA 3RO3A 4N3BA 3QARA 4CCAA 1O1RA 5CMYA 2J8SD 5FTPA 3U9WA 3T5VA 4YDYA 3U64A 4G11A 2NXPA 3TWUA 3ZHEB 3UTMA 1OT8A 3PZ3A 4JPSA 4DLQA 5G04C 3FU6A 3SD5A 3G2VA 4WNDA 2YHEA 1UJKA 3FH5A 4HB5A 3PS6A 4Q69A 5G2NA 1IQUA 3UPVA 3FULA 5G55A 3IHVA 3SNXA 5AN8A 1AP7A 4OAVB 3PZ1A 1BI8B 3CV0A 5LOZA 3ABKE 5ENNA 2V0PA 3B13A 3S7FA 4DRXE 3HG0D 1FPPA 5IY5E 1H0AA 1WM5A 2J07A 3CVVA 2RFMA 1K1AA 4UUCA 5D2MC 4B89A 3APDA 1MJ0A 4F7AA 4F6RD 5AYWD 3T5XA 4WWOA 4B8CB 4XKBA 1G3NB 2E0IA 3ULEG 2XCBA 4CRWA 1RW2A 4GMRA 2MHKA 4DX5D 3JUIA 5G05C 5FQ4A 2E2EA 4GTTA 1BD8A 1NA0A 4H7XA 2VSOE 2XENA 4HXIA 3SO8A 4GU5A 5EILA 2HE0A 2X6FA 2R03A 5ANLA 4I1AA 3LVQE 3E37A 3CHRA 3CVQA 1N11A 2XGOA 2QFCA 3JXJA 4GPMA 5A7DB 4L23A 5AQBA 4DK5A 1NA3A 4JC8A 3ZYKA 3CIAA 3ZW3A 4MS6A 5AIJA 3SZ7A 3W9FA 4ILHB 2CFUA 3KAEA 3J5PA 3E30A 1IYGA 2V8SE 2KZTB 3AG2E 1TNOA 1OY3D 4U8HA 4I17A 2P9SG 2XQ0A 2XGSA 3TG5A 1U3CA 5FIOA 1IHBA 4AP2A 3MX3A 2IO3C 3TXMA 2Y69E 1HZ4A 2R59A 2ZISA 2P2CP 4N5QA 3VTYA 4GA0A 3IXEA 2H6GA 3CEQA 4GZCA 3LCAA 4PUCA 4EZJA 2H6IA 2P9KG 4FLBA 2MOWA 5AJDA 5AARA 3P2BA 3IBEA 5LCWJ 3D9MA 4B8AA 1TR4A 4JD2G 1XGWA 3WXXA 3NOCD 3CHMA 3S7DA 3ASHA 4JEUA 3CHOA 3QWPA 3DRAA 2BUGA 1OCZE 3PEUB 1MX4A 3JUEA 3MKQA 2WB2A 2EIME 3VLDA 4JVSA 1QBQA 2XCCA 4YVQC 5JJ6A 3TWTA 3RO2A 5M72A 2R5SA 3N71A 1INZA 4G23A 2UY1B 4F3VA 5BPPA 4HOTA 3ASOE 3DEPA 2WXJA 2EIJE 1N4PA 5HI7A 5JHAA 3U3WA 2F8XK 4A3TA 3ULQA 3TWXA 3UM0A 2X6HA 4NURA 4BWRA 4F1PA 3LJNA 4MLPA 3HVEA 4CDRA 4OVUA 1N52A 3UINC 5J90A 3D9JA 4GYOA 2GRQB 4GZ3A 3K9IA 4UI9C 4JA9A 4DUIA 2A5UA 3MV2B 2OEVA 2CG3A 2CFZA 2WQ6A 3WG7E 3X2QE 3FTUA 1H2VC 3LPZA 4LG6A 3J5QB 2MYOA 2WXQA 4JHRA 2LO6A 3ZRHA 3EU9A 4OYSA 3L82A 4UI9K 5EX0A 2XHEA 3ABME 4TV3A 1YCSB 2KBXA 5HRYA 3ZUVB 5ENOD 2CG2A 1FVFA 1DCQA 3Q9NC 4KBQA 3FU3A 1P5QA 2KXPC 1PY1A 3ESKA 2XS8A 2KCKA 5ENTD 5KBAA 4K5BA 4U0UA 3DSUA 4GTQA 4LNGA 3AAAC 3L08A 3URZA 5FINA 4ANXA 5B1BE 3QWVA 5LFAA 3O48A 4RG6A 3HIZA 1KZOA 1TNZA 3FTSA 5FQ8A 1SA5A 4FU3A 3C5RA 4J8EA 5A6CA 1H19A 3BG1B 4GYYA 3FH7A 2L9BA 4I2ZA 2F37A 2IONA 3ZHEA 3TJPA 2NSZA 3Q7AA 3AU5A 3RKVA 3HXFA 2DVWA 3HXBA 2F0YA 2P9LG 1EDUA 4ANVA 3I4GA 2DZNA 3TG4A 2P9UG 4Y6WA 2YNQA 4XE0A 3UT7A 4O1OA 3LS8A 4PS3A 5BXOA 4WNFA 5CCMA 1U2VG 4DPRA 4CT0A 3L16A 2WM9A 2YHCA 4WAFA 3LYAA 4IN3B 3SFZA 2LSVA 1TNYA 4DX7D 3RU0A 3KEAA 2BF0X 4Z68A 4DJAA 3CSFA 3F6QA 5HKPA 1VDYA 3T9KA 3FUMA 2KC7A 4U96D 1NFIE 2J09A 2X6IA 5JA4D 5EIDA 1OCOE 2X38A 2LNIA 1Z3XA 3GZ2A 4I1OB 4UWGA 1D9SA 1E8YA 4C0EA 4N5CA 1TN6A 4ATZD 3DSTA 4JHKA 2OEWA 1HFAA 3Q7FA 5E76A 3ZXSA 4GPKA 3TL5A 4EBAA 4FP7A 4BX8A 3DEOA 5EKQD 1D8DA 1HXIA 1N4RA 1O1SA 1ZB1A 2I6HA 2P9IG 4F1SA 4A1GA 3Q5MA 1NZNA 3TXNA 3I5PA 3O4ZA 3BEEA 4APFA 2H6HA 5LCWC 3AU4A 4URKA 3APFA 4U63A 2WXFA 3GW4A 1IQRA 4WUYA 1H6OA 2V4LA 1LD8A 4JB8P 4DX1A 4Y6CA 1QZ2A 1N4SA 3HHMA 3R7RA 3AG3E 2I1JA 1FT2A 4UWKA 1K8KG 3FUKA 5EN5D 2WXRA 4BSZB 2A5EA 4RVBA 3D3MA 3LEWA 2X3MA 3MZLB 4HORA 4V3IA 3ZNGA 4AM9A 4RLYA 2ETBA 3KSLA 5FT9A 3B7UX 3T8KA 3CQGB 1ELKA 5CEAA 4UQXA 1QQEA 1TJFA 1SW6A 3UKRG 1V54E 2RG8A 4OAUC 4NIKA 4HBDA 5B1AE 4WNGA 3EHQA 2XZTG 2GRLA 3IEGA 3JYSA 1HU3A 2VYIA 5BNWA 2KCVA 4O6FA 4FHKA 5CCLA 3S7BA 4TXQA 3RRNB 5FZRA 3CVYA 2BKKB 5ARFA 3PEVB 1K3ZD 1TEZA 1UN9A 3FTVA 1UG3A 3L13A 4G1TA 2GRPB 4EPZA 3Q49B 3CGHA 2PQRA 4XKCA 3FTXA 3AG1E 2AWIA 3UQ3A 4GZDA 1X81A 4YDWA 2J4DA 3RSEG 3PE4A 5FJYA 3ZVVA 4IYPA 2DZOA 4BTBA 4MRUA 2QYUA 1TNUA 3APCA 2I1KA 4BX9A 2M63A 1FT1A 3RRMB 3Q15A 1HS6A 2KCLA 4GTMA 4DI4A 4AY5A 5ARGA 3LVRE 5EYLA 3OXLA 1N4QA 2UWJG 3SFXA 4N3AA 2HYZA 2AVPA 2FBNA 1E90A 2XEVA 2XPIA 3PZ4A 4CT4A 4GMLA 4BFRA 4JZYA 3ZYLA 3UIPC 4N3CA 3VLEA 4C48B 4KZ0A 4O60A 1OCCE 3S2AA 2WQ7A 4CYMD 3ZU7B 2GROB 2GRRB 1HO8A 2LAIA 2F8YA 3LDZA 4ACLA 5DIZA 4LERA 1ZBPA 4ZFHA 5CEDB 4G8KA 4FHJA 4XX5A 1HX8A 1RZ4A 1Y6IA 1DCEA 2VGXB 5ITZF 4XI0A 4M7CA 5C2YA 4K5CA 1L5JA 4J8SA 4L1BA 4B93B 1SQMA 4HQDA 3R9MA 4I9CA 2BEDA 3TWVA 3QC1A 2QYJA 3KSQA 3C72A 1MHQA 3EHNA 2IF4A 2EIKE 2VJ8A 3B95A 3TWQA 2XS1A 3G2WA 3UMVA 3MEKA 4J8FA 3D9IA 5A23A 3B7SA 2AW6A 2WXNA 4NACA 3RRUA 2PL2A 1B89A 3IV0A 4FJZA 1UW4B 3MGBA 5KNHD 3CSTA 4GTSA 4U07A 2XGMA 5BXUA 2VTBA 5T4YA 1DC2A 1IKND 4GMJA 4HLLA 3SQVA 4G25A 2RD0A 4FLHA 3G2UA 1YA0A 4LRZA 2FF4A 4EQFA 2GRNB 4LSZE 2IJGX 3ZXPA 3LXUX 4FADA 2V5FA 4HS2A 2PQNA 4HOUA 3OAWA 2IEJA 3FUNA 2LUHA 3E32A 3Q4AB 4CDNA 4G8LA 2VQ2A 2H6FA 3MYVA 3Q78A 1H6KA 3ZFWA 4LEUA 3UI2A 4LNBA 1BI7B 5H7PA 4J8YA 3HXCA 4KZCA 1SZAA 4CEMA 1Z6TA 2IY0C 5BW8C 3CVPA 3ASFA 1HG2A 2PZIA 4NRHB 3FWVA 3SGHA 2XEHA 3UKUG 3QKYA 4DX2A 3DPDA 1E8XA 4HFGA 5ENQD 1KZPA 1Y8MA 2OOEA 2WQHA 3FUDA 4RSYA 3UM2A 1K1BA 5JJTA 2WMOA 3UUXA 5J08A 1N0QA 3FTYA 4OVVA 1WY6A 3EUVA 1D8EA 1PAQA 2JABA 5AQ9A 1E8ZA 3LY9A 5D0QD 3V2OA 1IHGA 4LNUD 3QOUA 4UQYA 3HYMB 4BERA 2V5QC 3OXGA 2DCPA 4HI8A 2Y1LE 3LKUA 4X8QA 3ML8A 3ESLA 3EHRA 2ETAA 1DVPA 4L2LA 4AIFA 3EIQC 5BUZA 3NB2A 1S63A 3B7TA 4GTPA 1KPSB 3ONKA 5LX8A 3EJNA 5G05J 4TXPA 1MQSA 3CKBA 2YQ8A 4A55A 3P1UA 3DSSA 3CVNA 2LAHA 4YNDA 4I43A 1UN8A 5AENA 3FH8A 2XPYA 5AJLA 4MBGA 2ILRA 3SBSA 2WXGA 3E34A 3TWWA 1V55E 3I3NA 2L0IA 3E33A 3JCKC 3Q47B 3UM3A 4I2WA 3NOGD 2LXLA 2ONDA 1SA4A 1XNFA 3UM1A 4EHMA 3AS8A 3PH0C 3CLJA 4DI3A 3DXMG 2LXMA 4JA7A 3CK9A 1HE8A 4ME2A 4XEIG 5FZSA 2J49A 2R2LA 4GA1A 5CECB 4G26A 3PNTB 1PC2A 4GYWA 4JHJA 3ZYMA 1Q2ZA 3ZGQA 3CVUA 1TN7A 3KD7A 4U0ZA 4PDXA 2GW1A 4YVOA 2R02A 1H2UA 4EECA 5JMND 3SF4A 2VSYA 4LCTA 4FULA 2NYJA 3CK7A 3FFLA 3D9LA 2CHXA 3NQPA 4TUUA 3PVLA 3SBTB 4PS7A 3D9OA 5JJ7A 4GCOA 4RG9A 4IULA 5LP0A 4UWLA 2J9QA 4AOFA 3ENEA 1LF8A 2DYSE 2DBAA 2ETCA 3HVEB 3NZUA 1OCRE 2MRIA 4O1PA 1O1TA 3CVXA 1NP7A 3RIBA 5CMWA 1HF8A 2B6CA 3TWRA 5FZQA 3B7RL 2OVBA 4U04A 1EYHA 3GZSA 2L0TB 1S0PA 3D9PA 2AXVA 2C2LA 3FEYA 3Q9UC 1NI1A 1E8WA 5EYPF 2WXPA 4WWPA 2WXHA 4WNEA 3BU8A 3IHYA 2DIWA 2I2OA 3ISMC 3ZPJA 3AG4E 4J0UA 2OV8A 3QJZA 4G24A 1S70B 2AXZA 1JCRA 1N54A 3FEXA 4YDOA 4BEPA 3AJIA 3CHSA 2RFAA 2ZXWE 3LY7A 5AQAA 2XPZA 4GTRA 3HRAA 1U3DA 3AS4A 3L54A 3SY2A
chains in the Genus database with same CATH topology
3AG3E 5IY5E 2DYRE 2EINE 1OCCE 3ABME 3ABLE 5B1BE 3ASOE 1V55E 2Y69E 3WG7E 3AG2E 1OCZE 2ZXWE 1V54E 3X2QE 2EIJE 3ASNE 2EILE 3ABKE 5B1AE 5B3SE 1OCOE 2OCCE 2EIME 3AG4E 2DYSE 3AG1E 1OCRE 2EIKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG3 E;  5IY5 E;  2DYR E;  2EIN E;  1OCC E;  3ABM E;  3ABL E;  5B1B E;  3ASO E;  1V55 E;  2Y69 E;  3WG7 E;  3AG2 E;  1OCZ E;  2ZXW E;  1V54 E;  3X2Q E;  2EIJ E;  3ASN E;  2EIL E;  3ABK E;  5B1A E;  5B3S E;  1OCO E;  2OCC E;  2EIM E;  3AG4 E;  2DYS E;  3AG1 E;  1OCR E;  2EIK E; 
#chains in the Genus database with same CATH topology
 2EQX A;  1JUQ A;  3D9N A;  2HO1 A;  5ENR D;  1YMP A;  4P29 A;  3EIJ A;  1EF1 C;  2AJA A;  4AV7 A;  4FA6 A;  3FY4 A;  2RKK A;  5CRU A;  3Q73 A;  2KZT A;  5E75 A;  5B3S E;  4PH4 B;  2OCC E;  1HG5 A;  3FUH A;  4UI9 J;  2DWZ A;  3L22 A;  2PNN A;  1MZC A;  4AY6 A;  1HH8 A;  2YIN A;  4L2Y A;  3RAU A;  3OTN A;  3ABL E;  3C3O A;  4L7T A;  4TXR A;  2JEK A;  3CVL A;  3BG0 B;  1Z5S C;  3CR3 A;  4I1M A;  4AJW A;  1OUV A;  2IFU A;  4CGW A;  5CBO A;  3D9K A;  4ILG A;  1TJC A;  3FP3 A;  5HS0 A;  2XEE A;  4GTO A;  2LSU A;  4XIF A;  1JWF A;  4XZ4 A;  3ZIM A;  1SZ9 A;  4GA2 A;  3B7B A;  3DSW A;  4EZK A;  3CK8 A;  4BSX A;  2WMN A;  1YYH A;  4J7W A;  4ATG A;  1TNB A;  3U4T A;  1NL4 A;  1E7U A;  4A63 B;  4YDE A;  4N39 A;  3TGO A;  4LUN U;  4ILI A;  2UY1 A;  3CHQ A;  3EHM A;  3L17 A;  1H2T C;  3ASG A;  4N2S A;  4I6J A;  4F53 A;  3DWL G;  4AXH A;  5FQ6 A;  4JEH A;  4QQI A;  2WPV A;  3CKC A;  2P9N G;  3SFY A;  4XI9 A;  3V30 A;  4GZ5 A;  3R7Q A;  3V79 K;  4I9E A;  1UJJ A;  3QB2 A;  3C3Q A;  5AQ7 A;  5EIB E;  4KVM A;  3UIO C;  3QK0 A;  3U66 A;  5CBN A;  5C1D A;  4WWN A;  2WXK A;  2NC9 A;  2GRM A;  4KMO A;  4E6H A;  4BY6 A;  1BPO A;  3PE3 A;  1WDY A;  2QZA A;  4KXK B;  3Q75 A;  1TYQ G;  2FO1 E;  4GB9 A;  2XRZ A;  4KVO A;  4ANU A;  1LD7 A;  2J4B A;  3MV3 B;  1KT1 A;  1ZU2 A;  3SI5 A;  1SVX A;  1OWM A;  1MX2 A;  1O5M A;  3G2T A;  2C0M A;  5AAO A;  4U7E B;  3PZ2 A;  1N0R A;  3VLF A;  3UT8 A;  2BKG A;  3BUA A;  5D66 A;  3FUE A;  4HNA D;  5ANR A;  3V2X A;  5CER B;  3TAX A;  2XRY A;  3HXE A;  4BET A;  4BES A;  1TN8 A;  5ENS D;  3UX4 A;  4QFV A;  1KLX A;  4MKT A;  3BQO A;  2R17 C;  1X5B A;  2X6K A;  5KNG A;  3FU5 A;  4EZL A;  2A4Z A;  3OXF A;  4KYO B;  5T3R A;  1WAO 1;  4TUM A;  3D9H A;  4APO A;  2EIL E;  2VSN A;  4ACK A;  3DXK G;  2IOS A;  4B94 A;  1DNP A;  4KT6 B;  3Q79 A;  2ZGG A;  3NBN B;  4JL0 A;  1OWP A;  3UT4 A;  2DYR E;  3TWS A;  3QNK A;  4BT9 A;  4CZ2 D;  2IQC A;  3CVW A;  4IRU A;  3NZS A;  3PDN A;  2B0O E;  2L6B A;  1E7V A;  2P9P G;  3ULY A;  5HQ8 A;  2IU1 A;  3L9T A;  1N94 A;  5G04 J;  5KJN A;  1OWN A;  3NF1 A;  3DSX A;  3JXI A;  4U8V D;  4C9B B;  4HRL A;  4AVX A;  3QAQ A;  4R7L A;  3S7J A;  3MJW A;  3R9A B;  3FTZ A;  3ONL A;  5DBK A;  5KWD A;  1Z3Y A;  3W9G A;  2Y4U A;  1OXJ A;  4H7Y A;  2I9C A;  4ABN A;  2WXM A;  4A1S A;  2ZU6 B;  2HR2 A;  5KJK A;  3I4R B;  3GZ1 A;  4DX6 D;  4W9R A;  5ENP D;  4U0S A;  1ELW A;  3V31 A;  5FQ7 A;  2JLB A;  4HLE A;  2HM8 A;  3QWW A;  1GW6 A;  4HVB A;  1JCS A;  5BT1 A;  1QYM A;  1A17 A;  3EDT B;  2KAT A;  1IXV A;  1LTX A;  3LJ3 A;  4I6E A;  4NQ0 A;  1A5E A;  4HOS A;  4UQZ A;  3CHP A;  4GZ6 A;  2P58 C;  4B0Z A;  3AS5 A;  4ANW A;  4JXT A;  2EIN E;  4K0R A;  3PRE A;  5KJL A;  3HXD A;  3VTX A;  3KEZ A;  4BT8 A;  2BTD A;  3FDH A;  2ZGD A;  4UWF A;  1WG0 A;  4HRN A;  2Q7F A;  2R05 A;  3FUJ A;  1JPL A;  1N9A A;  4FC8 A;  2GGF A;  5CRV A;  3JQ0 A;  1AWC B;  2CHW A;  2IO2 C;  4TRQ A;  2CHZ A;  3ASD A;  4DLO A;  2Y4T A;  4Q96 A;  3ZYQ A;  4C0M A;  1KT0 A;  2WXL A;  3UXG A;  2FI7 A;  2WVI A;  4BTA A;  1UOH A;  3PNL B;  1OWO A;  3ZEF A;  2KM4 A;  3RJV A;  5D0O D;  4D10 C;  2PM7 A;  2VTB B;  3MCX A;  3ML9 A;  2QY7 A;  1JCQ A;  1ELR A;  4RQI A;  1E96 B;  4N2Q A;  4HRM B;  3LY8 A;  1JWG A;  2VGE A;  1N95 A;  3IKO B;  2XZD G;  4E85 A;  2FEZ A;  3KS2 A;  3EU5 A;  3MKQ B;  5BV0 A;  1EPU A;  3DPY A;  3FUF A;  1QNF A;  3SHF A;  3PUK A;  2FUL A;  4I6G A;  4PS8 A;  5JHB A;  3ZN3 A;  1BLX B;  4JW1 A;  2VSX E;  2AXU A;  3PUJ A;  3PZD A;  4J8D A;  4HI9 A;  4K03 A;  3ASN E;  1S64 A;  2VGY A;  1MYO A;  1BU9 A;  2Y0B G;  2L6J A;  4GCN A;  4HOQ A;  4A3V A;  3PRZ A;  4Q94 A;  3FU0 A;  4J6I A;  4ZHB A;  2J08 A;  5KJM A;  2X6J A;  5EDS A;  5CHE E;  2OVF A;  3GYZ A;  2QC9 A;  1W3B A;  3NAW A;  3ZKJ A;  1FCH A;  3JQ1 A;  2WXI A;  3DBS A;  2ZIR A;  3CQC B;  5FWQ A;  4EBA G;  3RK6 A;  3C98 A;  1OWL A;  1H6P A;  5EX3 A;  5T8I A;  3L6A A;  4CGV A;  4M3O A;  4CDM A;  5KCM A;  3MA5 A;  3C3R A;  5BV1 A;  4GTV A;  4G2V A;  3E4B A;  4U95 D;  4U8Y D;  3G2S A;  4UWH A;  1FVH A;  2FO7 A;  4L9P A;  3FUI A;  3QDN A;  4GAA A;  2IOL A;  2Y3A A;  3HDX A;  3FTW A;  3T8M A;  3MKR A;  2WXO A;  4FJY A;  3DSV A;  1MX6 A;  4K5A B;  2V4H C;  2VGX A;  2PM6 A;  2C0L A;  4AEZ C;  3FHE A;  3RO3 A;  4N3B A;  3QAR A;  4CCA A;  1O1R A;  5CMY A;  2J8S D;  5FTP A;  3U9W A;  3T5V A;  4YDY A;  3U64 A;  4G11 A;  2NXP A;  3TWU A;  3ZHE B;  3UTM A;  1OT8 A;  3PZ3 A;  4JPS A;  4DLQ A;  5G04 C;  3FU6 A;  3SD5 A;  3G2V A;  4WND A;  2YHE A;  1UJK A;  3FH5 A;  4HB5 A;  3PS6 A;  4Q69 A;  5G2N A;  1IQU A;  3UPV A;  3FUL A;  5G55 A;  3IHV A;  3SNX A;  5AN8 A;  1AP7 A;  4OAV B;  3PZ1 A;  1BI8 B;  3CV0 A;  5LOZ A;  3ABK E;  5ENN A;  2V0P A;  3B13 A;  3S7F A;  4DRX E;  3HG0 D;  1FPP A;  5IY5 E;  1H0A A;  1WM5 A;  2J07 A;  3CVV A;  2RFM A;  1K1A A;  4UUC A;  5D2M C;  4B89 A;  3APD A;  1MJ0 A;  4F7A A;  4F6R D;  5AYW D;  3T5X A;  4WWO A;  4B8C B;  4XKB A;  1G3N B;  2E0I A;  3ULE G;  2XCB A;  4CRW A;  1RW2 A;  4GMR A;  2MHK A;  4DX5 D;  3JUI A;  5G05 C;  5FQ4 A;  2E2E A;  4GTT A;  1BD8 A;  1NA0 A;  4H7X A;  2VSO E;  2XEN A;  4HXI A;  3SO8 A;  4GU5 A;  5EIL A;  2HE0 A;  2X6F A;  2R03 A;  5ANL A;  4I1A A;  3LVQ E;  3E37 A;  3CHR A;  3CVQ A;  1N11 A;  2XGO A;  2QFC A;  3JXJ A;  4GPM A;  5A7D B;  4L23 A;  5AQB A;  4DK5 A;  1NA3 A;  4JC8 A;  3ZYK A;  3CIA A;  3ZW3 A;  4MS6 A;  5AIJ A;  3SZ7 A;  3W9F A;  4ILH B;  2CFU A;  3KAE A;  3J5P A;  3E30 A;  1IYG A;  2V8S E;  2KZT B;  3AG2 E;  1TNO A;  1OY3 D;  4U8H A;  4I17 A;  2P9S G;  2XQ0 A;  2XGS A;  3TG5 A;  1U3C A;  5FIO A;  1IHB A;  4AP2 A;  3MX3 A;  2IO3 C;  3TXM A;  2Y69 E;  1HZ4 A;  2R59 A;  2ZIS A;  2P2C P;  4N5Q A;  3VTY A;  4GA0 A;  3IXE A;  2H6G A;  3CEQ A;  4GZC A;  3LCA A;  4PUC A;  4EZJ A;  2H6I A;  2P9K G;  4FLB A;  2MOW A;  5AJD A;  5AAR A;  3P2B A;  3IBE A;  5LCW J;  3D9M A;  4B8A A;  1TR4 A;  4JD2 G;  1XGW A;  3WXX A;  3NOC D;  3CHM A;  3S7D A;  3ASH A;  4JEU A;  3CHO A;  3QWP A;  3DRA A;  2BUG A;  1OCZ E;  3PEU B;  1MX4 A;  3JUE A;  3MKQ A;  2WB2 A;  2EIM E;  3VLD A;  4JVS A;  1QBQ A;  2XCC A;  4YVQ C;  5JJ6 A;  3TWT A;  3RO2 A;  5M72 A;  2R5S A;  3N71 A;  1INZ A;  4G23 A;  2UY1 B;  4F3V A;  5BPP A;  4HOT A;  3ASO E;  3DEP A;  2WXJ A;  2EIJ E;  1N4P A;  5HI7 A;  5JHA A;  3U3W A;  2F8X K;  4A3T A;  3ULQ A;  3TWX A;  3UM0 A;  2X6H A;  4NUR A;  4BWR A;  4F1P A;  3LJN A;  4MLP A;  3HVE A;  4CDR A;  4OVU A;  1N52 A;  3UIN C;  5J90 A;  3D9J A;  4GYO A;  2GRQ B;  4GZ3 A;  3K9I A;  4UI9 C;  4JA9 A;  4DUI A;  2A5U A;  3MV2 B;  2OEV A;  2CG3 A;  2CFZ A;  2WQ6 A;  3WG7 E;  3X2Q E;  3FTU A;  1H2V C;  3LPZ A;  4LG6 A;  3J5Q B;  2MYO A;  2WXQ A;  4JHR A;  2LO6 A;  3ZRH A;  3EU9 A;  4OYS A;  3L82 A;  4UI9 K;  5EX0 A;  2XHE A;  3ABM E;  4TV3 A;  1YCS B;  2KBX A;  5HRY A;  3ZUV B;  5ENO D;  2CG2 A;  1FVF A;  1DCQ A;  3Q9N C;  4KBQ A;  3FU3 A;  1P5Q A;  2KXP C;  1PY1 A;  3ESK A;  2XS8 A;  2KCK A;  5ENT D;  5KBA A;  4K5B A;  4U0U A;  3DSU A;  4GTQ A;  4LNG A;  3AAA C;  3L08 A;  3URZ A;  5FIN A;  4ANX A;  5B1B E;  3QWV A;  5LFA A;  3O48 A;  4RG6 A;  3HIZ A;  1KZO A;  1TNZ A;  3FTS A;  5FQ8 A;  1SA5 A;  4FU3 A;  3C5R A;  4J8E A;  5A6C A;  1H19 A;  3BG1 B;  4GYY A;  3FH7 A;  2L9B A;  4I2Z A;  2F37 A;  2ION A;  3ZHE A;  3TJP A;  2NSZ A;  3Q7A A;  3AU5 A;  3RKV A;  3HXF A;  2DVW A;  3HXB A;  2F0Y A;  2P9L G;  1EDU A;  4ANV A;  3I4G A;  2DZN A;  3TG4 A;  2P9U G;  4Y6W A;  2YNQ A;  4XE0 A;  3UT7 A;  4O1O A;  3LS8 A;  4PS3 A;  5BXO A;  4WNF A;  5CCM A;  1U2V G;  4DPR A;  4CT0 A;  3L16 A;  2WM9 A;  2YHC A;  4WAF A;  3LYA A;  4IN3 B;  3SFZ A;  2LSV A;  1TNY A;  4DX7 D;  3RU0 A;  3KEA A;  2BF0 X;  4Z68 A;  4DJA A;  3CSF A;  3F6Q A;  5HKP A;  1VDY A;  3T9K A;  3FUM A;  2KC7 A;  4U96 D;  1NFI E;  2J09 A;  2X6I A;  5JA4 D;  5EID A;  1OCO E;  2X38 A;  2LNI A;  1Z3X A;  3GZ2 A;  4I1O B;  4UWG A;  1D9S A;  1E8Y A;  4C0E A;  4N5C A;  1TN6 A;  4ATZ D;  3DST A;  4JHK A;  2OEW A;  1HFA A;  3Q7F A;  5E76 A;  3ZXS A;  4GPK A;  3TL5 A;  4EBA A;  4FP7 A;  4BX8 A;  3DEO A;  5EKQ D;  1D8D A;  1HXI A;  1N4R A;  1O1S A;  1ZB1 A;  2I6H A;  2P9I G;  4F1S A;  4A1G A;  3Q5M A;  1NZN A;  3TXN A;  3I5P A;  3O4Z A;  3BEE A;  4APF A;  2H6H A;  5LCW C;  3AU4 A;  4URK A;  3APF A;  4U63 A;  2WXF A;  3GW4 A;  1IQR A;  4WUY A;  1H6O A;  2V4L A;  1LD8 A;  4JB8 P;  4DX1 A;  4Y6C A;  1QZ2 A;  1N4S A;  3HHM A;  3R7R A;  3AG3 E;  2I1J A;  1FT2 A;  4UWK A;  1K8K G;  3FUK A;  5EN5 D;  2WXR A;  4BSZ B;  2A5E A;  4RVB A;  3D3M A;  3LEW A;  2X3M A;  3MZL B;  4HOR A;  4V3I A;  3ZNG A;  4AM9 A;  4RLY A;  2ETB A;  3KSL A;  5FT9 A;  3B7U X;  3T8K A;  3CQG B;  1ELK A;  5CEA A;  4UQX A;  1QQE A;  1TJF A;  1SW6 A;  3UKR G;  1V54 E;  2RG8 A;  4OAU C;  4NIK A;  4HBD A;  5B1A E;  4WNG A;  3EHQ A;  2XZT G;  2GRL A;  3IEG A;  3JYS A;  1HU3 A;  2VYI A;  5BNW A;  2KCV A;  4O6F A;  4FHK A;  5CCL A;  3S7B A;  4TXQ A;  3RRN B;  5FZR A;  3CVY A;  2BKK B;  5ARF A;  3PEV B;  1K3Z D;  1TEZ A;  1UN9 A;  3FTV A;  1UG3 A;  3L13 A;  4G1T A;  2GRP B;  4EPZ A;  3Q49 B;  3CGH A;  2PQR A;  4XKC A;  3FTX A;  3AG1 E;  2AWI A;  3UQ3 A;  4GZD A;  1X81 A;  4YDW A;  2J4D A;  3RSE G;  3PE4 A;  5FJY A;  3ZVV A;  4IYP A;  2DZO A;  4BTB A;  4MRU A;  2QYU A;  1TNU A;  3APC A;  2I1K A;  4BX9 A;  2M63 A;  1FT1 A;  3RRM B;  3Q15 A;  1HS6 A;  2KCL A;  4GTM A;  4DI4 A;  4AY5 A;  5ARG A;  3LVR E;  5EYL A;  3OXL A;  1N4Q A;  2UWJ G;  3SFX A;  4N3A A;  2HYZ A;  2AVP A;  2FBN A;  1E90 A;  2XEV A;  2XPI A;  3PZ4 A;  4CT4 A;  4GML A;  4BFR A;  4JZY A;  3ZYL A;  3UIP C;  4N3C A;  3VLE A;  4C48 B;  4KZ0 A;  4O60 A;  1OCC E;  3S2A A;  2WQ7 A;  4CYM D;  3ZU7 B;  2GRO B;  2GRR B;  1HO8 A;  2LAI A;  2F8Y A;  3LDZ A;  4ACL A;  5DIZ A;  4LER A;  1ZBP A;  4ZFH A;  5CED B;  4G8K A;  4FHJ A;  4XX5 A;  1HX8 A;  1RZ4 A;  1Y6I A;  1DCE A;  2VGX B;  5ITZ F;  4XI0 A;  4M7C A;  5C2Y A;  4K5C A;  1L5J A;  4J8S A;  4L1B A;  4B93 B;  1SQM A;  4HQD A;  3R9M A;  4I9C A;  2BED A;  3TWV A;  3QC1 A;  2QYJ A;  3KSQ A;  3C72 A;  1MHQ A;  3EHN A;  2IF4 A;  2EIK E;  2VJ8 A;  3B95 A;  3TWQ A;  2XS1 A;  3G2W A;  3UMV A;  3MEK A;  4J8F A;  3D9I A;  5A23 A;  3B7S A;  2AW6 A;  2WXN A;  4NAC A;  3RRU A;  2PL2 A;  1B89 A;  3IV0 A;  4FJZ A;  1UW4 B;  3MGB A;  5KNH D;  3CST A;  4GTS A;  4U07 A;  2XGM A;  5BXU A;  2VTB A;  5T4Y A;  1DC2 A;  1IKN D;  4GMJ A;  4HLL A;  3SQV A;  4G25 A;  2RD0 A;  4FLH A;  3G2U A;  1YA0 A;  4LRZ A;  2FF4 A;  4EQF A;  2GRN B;  4LSZ E;  2IJG X;  3ZXP A;  3LXU X;  4FAD A;  2V5F A;  4HS2 A;  2PQN A;  4HOU A;  3OAW A;  2IEJ A;  3FUN A;  2LUH A;  3E32 A;  3Q4A B;  4CDN A;  4G8L A;  2VQ2 A;  2H6F A;  3MYV A;  3Q78 A;  1H6K A;  3ZFW A;  4LEU A;  3UI2 A;  4LNB A;  1BI7 B;  5H7P A;  4J8Y A;  3HXC A;  4KZC A;  1SZA A;  4CEM A;  1Z6T A;  2IY0 C;  5BW8 C;  3CVP A;  3ASF A;  1HG2 A;  2PZI A;  4NRH B;  3FWV A;  3SGH A;  2XEH A;  3UKU G;  3QKY A;  4DX2 A;  3DPD A;  1E8X A;  4HFG A;  5ENQ D;  1KZP A;  1Y8M A;  2OOE A;  2WQH A;  3FUD A;  4RSY A;  3UM2 A;  1K1B A;  5JJT A;  2WMO A;  3UUX A;  5J08 A;  1N0Q A;  3FTY A;  4OVV A;  1WY6 A;  3EUV A;  1D8E A;  1PAQ A;  2JAB A;  5AQ9 A;  1E8Z A;  3LY9 A;  5D0Q D;  3V2O A;  1IHG A;  4LNU D;  3QOU A;  4UQY A;  3HYM B;  4BER A;  2V5Q C;  3OXG A;  2DCP A;  4HI8 A;  2Y1L E;  3LKU A;  4X8Q A;  3ML8 A;  3ESL A;  3EHR A;  2ETA A;  1DVP A;  4L2L A;  4AIF A;  3EIQ C;  5BUZ A;  3NB2 A;  1S63 A;  3B7T A;  4GTP A;  1KPS B;  3ONK A;  5LX8 A;  3EJN A;  5G05 J;  4TXP A;  1MQS A;  3CKB A;  2YQ8 A;  4A55 A;  3P1U A;  3DSS A;  3CVN A;  2LAH A;  4YND A;  4I43 A;  1UN8 A;  5AEN A;  3FH8 A;  2XPY A;  5AJL A;  4MBG A;  2ILR A;  3SBS A;  2WXG A;  3E34 A;  3TWW A;  1V55 E;  3I3N A;  2L0I A;  3E33 A;  3JCK C;  3Q47 B;  3UM3 A;  4I2W A;  3NOG D;  2LXL A;  2OND A;  1SA4 A;  1XNF A;  3UM1 A;  4EHM A;  3AS8 A;  3PH0 C;  3CLJ A;  4DI3 A;  3DXM G;  2LXM A;  4JA7 A;  3CK9 A;  1HE8 A;  4ME2 A;  4XEI G;  5FZS A;  2J49 A;  2R2L A;  4GA1 A;  5CEC B;  4G26 A;  3PNT B;  1PC2 A;  4GYW A;  4JHJ A;  3ZYM A;  1Q2Z A;  3ZGQ A;  3CVU A;  1TN7 A;  3KD7 A;  4U0Z A;  4PDX A;  2GW1 A;  4YVO A;  2R02 A;  1H2U A;  4EEC A;  5JMN D;  3SF4 A;  2VSY A;  4LCT A;  4FUL A;  2NYJ A;  3CK7 A;  3FFL A;  3D9L A;  2CHX A;  3NQP A;  4TUU A;  3PVL A;  3SBT B;  4PS7 A;  3D9O A;  5JJ7 A;  4GCO A;  4RG9 A;  4IUL A;  5LP0 A;  4UWL A;  2J9Q A;  4AOF A;  3ENE A;  1LF8 A;  2DYS E;  2DBA A;  2ETC A;  3HVE B;  3NZU A;  1OCR E;  2MRI A;  4O1P A;  1O1T A;  3CVX A;  1NP7 A;  3RIB A;  5CMW A;  1HF8 A;  2B6C A;  3TWR A;  5FZQ A;  3B7R L;  2OVB A;  4U04 A;  1EYH A;  3GZS A;  2L0T B;  1S0P A;  3D9P A;  2AXV A;  2C2L A;  3FEY A;  3Q9U C;  1NI1 A;  1E8W A;  5EYP F;  2WXP A;  4WWP A;  2WXH A;  4WNE A;  3BU8 A;  3IHY A;  2DIW A;  2I2O A;  3ISM C;  3ZPJ A;  3AG4 E;  4J0U A;  2OV8 A;  3QJZ A;  4G24 A;  1S70 B;  2AXZ A;  1JCR A;  1N54 A;  3FEX A;  4YDO A;  4BEP A;  3AJI A;  3CHS A;  2RFA A;  2ZXW E;  3LY7 A;  5AQA A;  2XPZ A;  4GTR A;  3HRA A;  1U3D A;  3AS4 A;  3L54 A;  3SY2 A; 
#chains in the Genus database with same CATH homology
 3AG3 E;  5IY5 E;  2DYR E;  2EIN E;  1OCC E;  3ABM E;  3ABL E;  5B1B E;  3ASO E;  1V55 E;  2Y69 E;  3WG7 E;  3AG2 E;  1OCZ E;  2ZXW E;  1V54 E;  3X2Q E;  2EIJ E;  3ASN E;  2EIL E;  3ABK E;  5B1A E;  5B3S E;  1OCO E;  2OCC E;  2EIM E;  3AG4 E;  2DYS E;  3AG1 E;  1OCR E;  2EIK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...