2ZYGA

Apo-form of dimeric 6-phosphogluconate dehydrogenase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
466
structure length
466
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 177
structure length 466
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zygA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zygA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zygA01
3HDQA 4CLOA 2EF1A 4CM7A 3WYCA 1BXGA 1GADO 2PH5A 4R01A 5JS6A 3TQHA 3GNSA 5TNXA 4FFMA 4B3HA 1K3TA 3G79A 4GWGA 2Q4EA 3U0BA 3DOCA 4CL3A 1P0FA 4J1TA 3PWZA 1NAYA 3AUSA 2EWMA 4E2YA 1DDOA 2GO1A 2IZ0A 3B1KA 3PLNA 1PS9A 2VYNA 4JJGA 3WX0A 5L53A 4GL4A 3BHJA 2YW9A 2IE0A 1LLDA 4L73A 1NAIA 3WG9A 2P2SA 4YJFB 1ZXBA 1B26A 1E7SA 3WBBA 1WDMA 1P1HA 1YQXA 4R41A 1MC4A 1DC4A 1KETA 1RYDA 1HE5A 1RM4A 4XRGA 3ZHBA 3PJFA 4JXKA 4EBFA 1EMDA 2RH8A 4N5NA 4AJJA 4NH4A 5JCJD 4IS3A 1LDBA 2Y1GA 1XHLA 4B4UA 3GDGA 3LT4A 3EVTA 1DIAA 1E7MA 4CM4B 2HQ1A 4E6PA 4DREA 5B1YA 3IL2A 5KOIA 3AU9A 3HQ4O 1QRRA 1ARZA 4C4OA 1ZH8A 4WLFA 3NEPX 4R9RA 3AI1A 4J0EA 3ONEA 1F14A 5C7IO 1JTVA 4BB6A 4BO2A 2J3HA 4JX8A 1PJ4A 4B4VA 1PS0A 3OP4A 3EY4A 1UJMA 2Q1TA 4JCOA 4R51A 4KZPA 1Q2XA 2VN8A 3DO5A 3IUSA 1N2SA 2VT3A 1NVTA 5DCUA 3DMYA 1R16A 1JWAB 3DDNA 4DIBA 1BSVA 1MFZA 1U3WA 3O8QB 3RKUA 4CMIB 1XCBA 2NU8A 1ZKMA 1HTBA 1LJ8A 2O3UA 3UH1A 4J1NA 1I3MA 4GX0A 2X7HA 1B16A 1ZSVA 4JJIA 4XGKA 3PFFA 1BHSA 1E5QA 3I6IA 1TEHA 4DWVA 3FD8A 1NFQA 1LEHA 5T6BA 4CUJA 4RZIA 3HB5X 3JQFC 3RU7A 2JFHA 5KWEA 3F1KA 4KMSA 3MTGA 4NDNE 1WVGA 5A3VA 2R6JA 1NQTA 4ZN6A 5L3ZA 4FOOA 4UUNA 2IXBA 2QQ5A 1PL6A 3BMNA 2ZATA 4OOEA 1YO6A 2RCYA 2P9GA 4RZHA 1E1LA 3ASUA 4ALMA 2PD6A 3JTMA 2YQ5A 1YB4A 2GASA 3I9MA 1DC5A 2D0IA 2ZB3A 1OOEA 1JLLA 4GMGA 5C7OO 2CZCA 3DAPA 1A4UA 2EW2A 1RM5A 1ENPA 1ZK2A 4QECA 1ZEMA 2VWHA 4D3FA 1MXFA 4BGEA 1AN9A 1H93A 4BNXA 1KC3A 4R9SA 1JW9B 2PGDA 1UP4A 2JL1A 3RD5A 2GN8A 3U4HA 4JQCA 1SC6A 2A4KA 1U8FO 3DBHB 5BT9A 3NYWA 4PG6A 2GPTA 3WLFA 4UVEA 1ISGA 3HFGA 4YRBA 4PLFA 5GZ1A 1ZK1A 1D1TA 1LC0A 5A03A 1E3WB 4XYMA 3S1LA 2A9FA 3W4JA 4CM3A 1K0UA 1HDGO 3UFXA 2ZJ0A 5JXWA 1I5RA 4GMFA 1SOWA 5DBIA 1ISJA 4P38A 3GZNA 1PU2A 1HYHA 2DQ4A 4NJMA 3AOEA 4WNCA 3WQQA 4M89A 1LRKA 1CQJA 4NQZA 3ZU3A 4BNUA 4RVUA 4CMEA 5ICSA 2VHVA 3SBOA 3DQPA 2V6FA 5K0ZA 4X54A 3L9WA 3L0DA 3PI7A 4J1SA 3DOOA 3RUAA 3ZWYA 3H7AA 5JMPA 4PZCA 2YHUA 4W9NA 3GDFA 4Z3DA 1IULA 3HB4X 3WGGA 2W90A 2B69A 3O26A 3WGQA 1PGQA 4JGBA 1NPYA 1UXKA 3EC7A 5CG2A 3BMQB 3ZZNA 5I7SA 1ZBQA 1XSEA 2PKQP 3DHEA 1ADBA 3HUDA 4W7IA 5BNFA 4ZVVA 1E0DA 4B7UA 4MKZA 3DZIA 1Y1PA 4XR9A 3F1LA 3INGA 4IS2A 1PJ2A 3FTNA 5G0UA 4CLXA 1BWSA 2YJZA 1RM3A 4BMVA 3E03A 4J90A 2AXQA 2ZTVA 1PTJA 2VZ9A 4N5LA 3UN1A 4O0LA 3FNEA 4BO0A 1JVSA 1XDWA 2QYSA 4MPDA 4B3JA 3H3JA 4UVGA 4CLEA 2YFHA 3TRIA 5CG1A 3I3OA 4DQUA 3UVEA 5KJFA 4ZICA 4L4SA 4EITA 4CM9A 5IZ4A 3ROMA 3G17A 3ZWBA 3ZWVA 2I6TA 3KHUA 2HMSA 3ABIA 3I83A 4TWRA 3CSDA 4J43A 4CQMD 3RSHA 4GI2A 4D42A 5TJHA 1SCUA 5CDGA 2EHDA 2NACA 3PFWO 3DMTC 3MJCA 4BV9A 1X7HA 2GZ3A 3AY7A 2G17A 4YAEA 2DUWA 3SLGA 1KEPA 4QO7A 2I67A 2XOXA 4IZIA 2WD7A 3VVCA 3GUYA 2P68A 2AE1A 1ML3A 4QFCA 3SX2A 4TRNA 3RUIA 3JD3A 4BUCA 3NT5A 5KTKA 1B0AA 4FB5A 5TLSA 3ICPA 4NK4A 4XQCA 4XYEA 4FS3A 4I5DA 1YQGA 1N92A 2CD9A 5IXSA 1VRWA 3JD4A 5DULA 3HN2A 4BNFA 4MVJA 3IIEA 3JQEA 2E37A 3RCBA 1XELA 2VWPA 2Z1NA 4DPLA 2GGSA 3PHLA 4W4TA 4EEXA 4HV4A 3CINA 1PQPA 1K6XA 4QX6A 2EKPA 2AHRA 4ND1A 4TRJA 4CM9D 4RVDA 3F4LA 4ZHSA 2GZ2A 2GCGA 4BQRA 3B20A 3D4OA 3KZVA 3ZV4A 3K6JA 1GUYA 3PQEA 3VH3A 2W98A 4AJ1A 3TZCA 2PKRA 4HXYA 1UZNA 1ZJYA 4IXTA 1SEVA 5L4NA 1DC3A 3GVIA 1NWCA 4BGVA 1Q0HA 3K5PA 2D5CA 2X5JO 4LCEA 4LCJA 1H0KA 4E4YA 3TF5A 3N74A 3OBBA 4WCFC 2X5OA 2Y0EA 2EKQA 4O5OA 2AEJA 3RC1A 4B7XA 4RF5A 5JAMA 2Q2QA 3L07A 2GSDA 1Z7EA 4PRLA 2Y1DA 1X0VA 1OZAA 1YS4A 2HRZA 3H5NA 2Y1EA 3CEAA 1B15A 3U09A 2CSUA 2VHZA 2VTDA 4FOSA 4TVOA 3RUDA 2NLOA 3ROPA 1I3KA 4OAQA 4OHUA 2OFPA 3MWEB 3QVOA 3KM0A 3QWAA 4TROA 4CR8A 1NFFA 1X15A 2PNFA 5JY6A 3HWRA 4CQMB 1YOVB 4J9UE 5EQFA 5CDUA 2DC1A 2VTEA 3QWIA 1GYPA 3Q9NA 2BKAA 5KJCA 2V6GA 2UVDA 3GEGA 1N5DA 4I5GA 4LSMA 4R5MA 1FK8A 1H94A 1WLYA 2B5VA 4R3NA 5A4DA 1LRLA 2WYUA 4BVAA 2Z95A 3ZWMA 4BNMA 1LDMA 2C07A 2JD2A 3KSDO 5HBRA 5C5IA 2IXAA 4U5QA 4H7PA 5L7YA 2G5CA 2E4AA 2D4AA 1T26A 1D8AA 3GVCA 4ZQGA 3GFBA 4RDIA 4WNIA 1E7QA 3PYLA 1HDYA 5HTOA 2FZEA 1T2DA 2GRAA 2ZK7A 5A1TA 3DC2A 3UKOA 1PWZA 4DVJA 1N9GA 4HKTA 4CLRB 3DOJA 1HYEA 3E5RA 3PHHA 1KVTA 2NV6A 1H6AA 3FNFA 5T67A 3NRCA 4EDFA 3R1IA 4E13A 5B4UA 4OL9A 5HA5A 4P4LA 2H63A 4Q39A 4Z0HO 1HF3A 4BKQA 3PZBA 4B3IA 3F9IA 5H83A 4P8RA 3ZV5A 2I99A 5EJ2A 4YR9A 2D59A 2RHCA 1I01A 1E1MA 2IEBA 4W82A 4JNKA 5KIAA 3MWDB 3OA2A 3TWOA 3WNVA 5KVCA 4NMHA 2CVOA 2WD7B 4GQAA 2CDCA 1TA4A 2J5RA 2JJYA 2I3GA 4K6CA 1YH3A 4ND5A 1ZW1A 4QO8A 3NDIA 2NTVA 3JQBA 4PLHA 3TOZA 2PZLA 1HZZA 3ONDA 9LDTA 5HRUA 2Q1SA 3PHGA 2X22A 4PCVA 4YJDA 4IDCA 4OMUA 2ZTLA 3D5QA 3F46A 5JDIC 3ON5A 4DRYA 4JP2A 4WJZA 1BRMA 2QG4A 3K2EA 3L4BC 3LC2O 4TRMA 3VZRA 2GD1O 4TSKA 2HDHA 3H2SA 2YV3A 3GOHA 3TN7A 3KEOA 4GLLA 1PZFA 2O48X 3I9KA 4DLLA 5U9CA 3JQ7A 5K6AC 1Y81A 2TMDA 2NVUA 5IN5A 6LDHA 3WYEA 4RQTA 2FR0A 4RGBA 2IZZA 1O0SA 5T8KA 1DB3A 1AXEA 3VPGA 3C8MA 3L9XA 5U1PA 1ULSA 3FNGA 4IDGA 4CMJA 1EVIA 1PSDA 5DF1A 4DC0A 3H2ZA 3NDJA 4MJLA 4PLPA 3FSRA 1Z6ZA 4DYDA 1V9LA 1HETA 2AQKA 1W73A 4CQLA 4ITUA 3WGOA 3Q1LA 2DTXA 3RJ9A 1GEGA 3I4CA 5T57A 1HSZA 3JQ8B 2G76A 2AMFA 2LDXA 4CLHA 3HDJA 4S3MA 4IDFA 3INTA 4D7AA 1LA2A 5TRTA 4AJLA 1E7RA 1ULUA 5AXCA 1C1XA 4XD2A 4AJPA 3E9QA 3CH6A 5GY7A 5KJEA 5G4LA 1BMDA 3RIHA 3B1FA 1P1JA 2Z5LA 3OHSX 3WIDA 2EERA 1Z75A 3H3FA 4H15A 2X0RA 3ZCXA 3RJ5A 1WMBA 2PKQO 1CF2O 3LK7A 3QIVA 1JAXA 2GN6A 1NXQA 2QRKA 3F4BA 1IPEA 5KNLA 4E5KA 2Q99A 4TMFA 1XGKA 3WGTA 4RLSA 5I7FA 4JK3A 3C85A 3KTDA 1P44A 1ZZEA 2GDZA 1A4IA 5I9MA 4BO3A 3ULKA 3HE3A 4KQWA 4NZ9A 1PJSA 2A35A 3OM9A 1BXZA 1P45A 4FDAA 4K26A 1JQBA 5FI3A 4GLOA 5T64A 2C2YA 4FIZA 4I8XA 4YAJA 3M1AA 1GD1O 3QQPA 4XZ3A 2G0TA 1YKFA 3LF2A 1KY5A 3BAZA 2W2KA 4UEKA 4A5OA 1QYDA 1N1EA 1CIVA 1M67A 4RF4A 4WLUA 4MDHA 2RIRA 3D4PA 1N9GB 1VSVA 4RLHA 5EIOA 2P4QA 3MOGA 3U5TA 3GC6A 2ZB7A 3HG7A 1YJ8A 5TS3A 2HLPA 1Q7GA 1QYCA 1NAHA 3QW2A 2Y05A 3BTVA 3AU8A 4HNHA 1VKOA 1DHTA 1U28A 3D5TA 1U8XX 5A02A 1K89A 2FZWA 4PRKA 1IE3A 2B37A 4DC1A 4ONEA 3PRJA 1R6DA 4DIOA 2HMWA 4KDFA 3HDHA 3SJ7A 1LDYA 5HM8A 2FR8A 2POQX 1B2LA 2FN7A 3BMOB 4MVJG 2CDAA 5BQFA 4PN3A 3RC2A 1UP7A 1A7AA 2DT5A 3G3EA 4FR5A 4CUKA 4CV3A 2HCTA 3NGXA 4DIFA 5L4SA 1GV1A 3EZYA 1A5ZA 5JW6A 1X7DA 4XGIA 2EGHA 3R3JA 5JYDA 3TFOA 4GGPA 4RPKA 1ISFA 3QWBA 1ZUD1 3QVSA 1KEUA 5TT1A 3VZPA 1SEPA 4J6FA 3ANMA 4IUYA 1B3BA 2Y1FA 4KOAA 3NX4A 1RPNA 3K8ZA 2A94A 2W4QA 5TGDA 3FBTA 4WGGA 3ZGYA 2TMGA 4JBIA 4I9NA 4MO2A 1C0PA 1UUFA 5L7WA 2F00A 3KEQA 3D1LA 4TKMA 3ZU5A 4IY1A 1MX3A 3W4KA 1C1DA 1KC1A 1EE9A 2FMUA 3V1YA 4BHTA 1ENYA 3UGKA 4MOWA 1GL3A 1HKUA 3L6OO 1WP4A 5BSGA 2VHYA 1I32A 2ILTA 1A9YA 4GSKA 4XQGA 1BW9B 2QHXA 3WMWA 3ENKA 3ZWAA 5HWSA 4I9UA 2C7VA 4GGOA 4KQXA 5DBFA 5THKA 3R6DA 4PVCA 5AVOA 5TT0A 2EGGA 4M87A 4CM1A 3ZU4A 4YDRA 4Y67A 2WJPA 3TPCA 1NM5A 2OP1A 3IJRA 4D43A 3C1OA 1PR9A 1GEEA 2AQIA 1I2BA 5LDHA 5G0TA 4CPDA 3I4FA 3QLJA 2FR1A 4DQVA 4OSOA 1HDOA 3EUWA 2JHGA 2YV1A 4CMAA 5DCWA 2YUTA 1C1XB 3H5AA 2FWMX 4Z6KA 3A14A 1LLCA 1PWXA 3ZWXA 1P1RA 4NBWA 3W8EA 4IM7A 1U7TA 1FDWA 1VI2A 3Q11A 4ZRMA 1DO8A 3AY3A 3F47A 1YRLA 3A9WA 4OH1A 3IDSA 5A9TA 1EUCA 1GFSA 1KIFA 1EFLA 1KY4A 1PGPA 1U2GA 1X13A 5FWNA 2C7GA 3ORFA 2CNBA 5TJ9A 3V2UA 4BNNA 2AG8A 1PJLA 3E82A 5KCZA 4YT4A 1EBFA 2EEZA 3OQBA 3NGLA 2FPIA 2CDBA 2C20A 2VRCA 1PL8A 4LW8A 3EAGA 4UUOA 1XG5A 3GLQA 1SO8A 1UP6A 1AUPA 8ADHA 2BFMA 3AK4A 3K73O 4BNYA 3JQAA 1UZMA 2I65A 4XGNA 4BGIA 3A06A 3WFJA 5EINA 4GX1A 2ZYDA 1ZK0A 2XF8A 4RQUA 1SAYA 3GUCA 3I1JA 1NBOA 4NFSA 1YQDA 3QHAA 1EQ2A 1O89A 3LT1A 3ZNNA 4EGFA 2W2KB 2E49A 5A9RA 1SB9A 4LISA 3D3EA 3ZHYA 4XIJA 1NQOA 5JO9A 2FY8A 3DONA 3TL2A 1P31A 3V2HA 3VDRA 1B7GO 3RUEA 4ALNA 1YVEI 2QW8A 4ND2A 5EQDA 3PZRA 3PDUA 3O38A 1YE3A 4IMRA 3PIDA 1YDEA 2HKIA 1DLIA 1UXJA 2PK3A 2PV7A 2ZTUA 3KB6A 1E3IA 3MZ0A 4DMMA 5BSHA 5MGBA 4KWIA 1EDZA 1ZFNA 1GU7A 3I5MA 4AJKA 1PGJA 2FP4A 3WWYA 1ZSNA 4U0JA 1U4SA 4ZQHA 9LDBA 1NHWA 1QLHA 2VYND 5ENVA 3LU1A 1P9LA 1NFRA 1QYWA 4WCDA 3X2FA 3DB2A 1P1KA 3WNQA 1EDOA 4O6VA 3E18A 4J4TA 1CQIA 1GZ4A 1EK5A 4GKVA 4MP8A 2BI8A 2VZ8A 4RPJA 4TRRA 4PG4A 1SZJG 2EJWA 4IINA 4IQGA 1QSGA 1T25A 4IZHA 4YB8A 1EQUA 4R1TA 3JQGA 3RBXA 3PJGA 2JCYA 3OJLA 2HMTA 3E6AA 4BKRA 1W8DA 3O9ZA 1DRWA 1EBUA 1Y8RB 5C3MA 3ENNA 1EVYA 1KVUA 1U3TA 3H8VA 4WEQA 1DBVO 4BKOA 4M8SA 1XYGA 1J6UA 2DPGA 3R3SA 1E77A 3FN4A 3MJEA 4WKGA 2X58A 4A2CA 4QTZA 1P33A 4CMBA 2QIOA 5KJ1A 4DLAA 1W6UA 3ANLA 1T24A 2WD8A 2FOIA 1IL0A 4OXYA 4RDHA 1R66A 4RL6A 4U0KA 4FBGA 4II2A 3GVXA 5ITWA 5L51A 2NVWA 1LQUA 3JSAA 1GY8A 2EIHA 3WSVA 3KV3O 3U4IA 2I76A 3GY0A 4OQYA 3G1TA 2C29D 1C14A 5G4KA 3AWDA 1D1SA 4D3SA 2D3TA 1PZEA 1FDUA 1LXCA 1R0KA 2J5KA 2BGLA 1ZMTA 1Y5MA 3B1JA 3MEQA 4XB1A 3L6DA 3B70A 4DPKA 1PQUA 4BO5A 5IXYA 4E2WA 3FR7A 3GNTA 4CLOB 3NT4A 5H81A 1R4NA 1BXGB 1D7OA 1YL7A 1GYRA 3RVDA 1IHYA 1ZSYA 4FFPA 5IF3A 3SJUA 5JYEA 3FR8A 3LLVA 5I7EA 3TNLA 3AOEC 5CEEA 2OHXA 3Q3CA 1YBVA 2GLXA 4UVIA 4NBRA 2ZJ1A 3FF4A 1GR0A 1ZO8A 2D1YA 4BO6A 1IZ0A 4CMEC 2W8ZA 5I8WA 3ZNQA 4BO7A 4ALJA 2YQ4A 5L4LA 3CZRA 4F45A 2IODA 4E12A 1MGOA 2DUUA 4FSHA 4PIVA 1EK6A 3AM5A 1LLQA 1NVGA 4YQZA 2FHSA 5J23A 1HDXA 4W9NC 3FTPA 3WQRA 4Z9FA 1LDEA 2JAPA 3I52A 3GK3A 4XEHA 4D45A 4KP7A 3HNPA 2X86A 5A5EA 3OECA 1KVSA 2CUKA 2DBZA 3QE3A 5DNAA 4DPMA 4HFMA 5I9NA 1SMKA 3UCXA 4II3A 3COSA 1V0JA 5T5QA 1TI7A 3Q9UA 4EEZA 2FPGA 5ES3A 1UXGA 3L77A 2OP0A 3ZN2A 4HBGA 3ETDA 4FPXA 3RC7A 2DFDA 1OMOA 3C1AA 3LZ6A 1LQTA 3WBFA 4I5FA 1FDSA 4BO8A 3DEYX 3C1TA 1TT5A 1Y6JA 2HJSA 1ISIA 4R5HA 3AI2A 2X23A 4HP8A 3JYOA 1DSSG 3GG2A 3NTOA 4E0BA 5HS6A 4PLZA 2DAPA 5TC4A 1IY8A 4A10A 4AJOA 1K6JA 1ZK4A 4P22A 4RO0A 1KS9A 4FJ1A 4MKRA 4PG7A 4U7WA 1E7YA 2J8ZA 3JYNA 1QKIA 4XYGA 5LDGA 3VVBA 4CMCA 2WYWA 5GMOA 3IKTA 1U5CA 4BB5A 2XXBA 2Q46A 3NKLA 1V6AA 1ONPA 4GX2A 2HK7A 3AJRA 3K96A 4BNLA 1PGNA 1OAAA 4IDAA 3RUCA 3ZV6A 3BIOA 3S2FA 2JCXA 5JNLA 1AVYA 1NR7A 2CMDA 2PFGA 1HL3A 3QVWA 3P7MA 3RFVA 1MP0A 1QP8A 4IIVA 4F6CA 2O2YA 1T2FA 4EZBA 4YJGA 3MTJA 3NJ4A 3K31A 3JQGB 3BMNB 4WE3A 3WSWA 2PGJA 2J3JA 1N1GA 1CWUA 1XU7A 4J9VA 2WM3A 3S8MA 3SLKA 2NNLD 4RV9A 2Y0DA 4MVJI 1MB4A 1PS8A 4YA6A 2FSSA 3DZJA 5A04A 3GRKA 1B14A 1ENZA 3ADOA 1RKXA 4EJ6A 3HFSA 4FFLA 1J4AA 4I1IA 2NQ8A 1WAMA 2Q50A 2B83A 4A26A 1DAPA 1ADFA 3GHHA 2AA3A 3GHYA 3TOXA 2PA3A 3ZWWA 1T2CA 1HE2A 1L7EA 2NU9A 3WJ7A 4CV2A 3IP3A 5JDCA 2X9GA 4RVHA 3TSCA 1F0YA 3EVNA 2W2LA 2BD0A 3MCVA 2DKNA 2HRBA 1U7HA 4INAA 1XEAA 5H82A 3OEWA 1IOLA 4O59O 5G4KB 3JQCA 3ADPA 2FSVA 4NPCA 3ASVA 5KKAA 1VE9A 4DQXA 4Y8VA 2BFPA 1JDJA 1J0XO 3LT0A 1X0XA 4IJUA 5IZCA 3HZZA 4D44A 1UDBA 4IGFA 4WECA 3UUWA 4E5MA 1DFIA 5FYDA 5JAZA 4B79A 1GZ3A 2QYTA 5DT9A 1SBYA 4NBVA 5EESA 3S2IA 3GZNB 1R4NB 1Y9EA 4ZU3A 4L4XA 4NJMB 2PZMA 3DZHA 3I9NA 3ICCA 1AGNA 1JKIA 5COAA 4MVJD 4L76A 2O3JA 5EPOA 1D4FA 1VPDA 4HADA 3IKVA 4L4RA 4BO1A 5DOZA 3SC6A 1E6WA 5IG2A 4K6FA 3DBRA 4RCVA 1GDHA 4LMRA 1B8VA 3QV1A 5DOVA 3CE6A 3M6IA 3VKVA 3E5MA 5TIIA 1DJNA 3UOGA 4YJHA 1OI7A 2Y68A 4DXHA 1C0IA 4BOYA 2PD4A 4L0QA 2WE8A 1WWKA 2VYVA 5AXBA 1M2WA 2W2LD 2WEKA 2IDZA 4R69A 5FEUA 1EFKA 3S55A 4KTVE 3QSGA 5BSFA 4MP3A 1LTHR 3KYDA 5A9SA 4NIMA 3IAHA 1E7WA 1Z74A 3VPSA 4E2XA 1AXGA 1I8TA 5JAIA 2OO5A 4C7JA 4XIYA 4KTTE 4PZDA 1MLDA 3LLSA 2BF7A 1C0LA 2UV8A 1ISMA 2Y66A 4YRAA 1V35A 4F6LA 1FMCA 1RWBA 3UCFA 1UR5A 4JN6B 3ZNPA 1TT5B 5B4TA 5JSFA 1Q0QA 3TL3A 3I9JA 1TT7A 3VPXA 2VHXA 5DDIP 3TZKA 2DFVA 3K2BA 4NJOA 2NVBA 2X6TA 4NFYA 3H9GA 4MIEA 3OJEA 4TKLA 2YFQA 2BRUA 4PG5A 2NWQA 3DZGA 4CV1A 3AUTA 3OIGA 1HRDA 4ZRNA 1DAOA 1JKFA 5ILOA 1DPGA 4BQPA 2VWGA 1HLPA 3Q0EA 1HXHA 3WGYA 4J7XA 4DBZA 2C2XA 4DMLA 5I9LA 5TX7A 4PGFA 2QX7A 5EMHA 4YT2A 4IDEA 3GZ4A 3LSYA 3TZHA 1T1RA 2I66A 3KYBA 2PTGA 3WIEA 1WDLA 4YJGB 4FQ8A 2YY7A 4AJIA 1MG0A 4BO4A 3DR3A 3LYLA 4A73A 2O7QA 4PFJA 1E3EA 4NBUA 1M76A 3JQBC 3WQSB 1DIGA 3ETGA 1BVUA 3D3WA 2V7PA 4NG5A 4KUEA 1N7HA 4P4NA 1YBMA 2BGMA 2ZTMA 2C0CA 1NQ5A 3OQ6A 5TSDA 3UICA 4HUJA 2VNSA 2B5WA 5CHEA 3ZW8A 1H5QA 1KYQA 3L6EA 2EKLA 3KSZO 1QYVA 2JD0A 3DZFA 4YTEA 3JV7A 1T4BA 3OETA 4WUVA 4XDYA 2XAAA 1R12A 2AE2A 4G2NA 5CAEA 1EVZA 4ILKA 4EUFA 1K5HA 1ZXLA 1L1FA 1I24A 5T8KC 5A3JA 5COQA 5ILGA 4LK3A 3BHIA 1YGYA 3DBLA 1DIHA 4RVSA 1O6ZA 4QFDA 3S2GA 3RASA 1YONA 4AJ2A 4DTIA 3KOUA 2DTEA 4HX5A 1R4MA 1P77A 1CJCA 2EG9A 1HDZA 1LDNA 2CFCA 1SPXA 2C82A 4PLVA 3K30A 4Z0TA 3RROA 2O3TA 3VH1A 3F3SA 4GH5A 4IQ8A 3KO8A 2BGKA 2DBQA 3GAZA 1X1TA 2EP7A 1KVQA 4XX0A 4Z9YA 1UH5A 4GWKA 3SC4A 4NFHA 3FI9A 3P5SA 1JAYA 3GEDA 3CPSA 3NTQA 2HAEA 3BXXA 4PLYA 1KEWA 4YRDA 3RBVA 4F46A 2A92A 1PZHA 4MP6A 4M54A 2HSDA 3JQ9A 3H4VA 4DBVO 4E3ZA 4A0SA 3AUUA 4BNWA 4D0SA 4YJHB 4DLBA 4W99A 4I9HA 4BMNA 2DLDA 4CUZA 1G0OA 1XLTA 3ZDFA 3FPCA 2CY0A 3M1LA 4D0RA 4UUPA 4YXFA 1BTOA 1OC4A 3G49A 4XA8A 1DIBA 1P74A 5KKCA 3KYDB 3W4IA 1YB5A 2P91A 1M6HA 3GN2A 1WNTA 2CVQA 3WICA 3KLMX 3U4DA 3ZI0A 4XYBA 3VZSA 2UUPA 4IGEA 2YHIA 3OMLA 4K28A 4ALKA 5IN4A 3IS3A 1Z7BA 3PJEA 4Z0PA 2Q2WA 4TQGA 2P5YA 3I9LA 4GVXA 4YT5A 3ITDA 3RU9A 4S1VA 1E1KA 1VL8A 3IC5A 2H6EA 3MJ4A 4OXKA 3E9MA 2D2IA 1L7DA 4FJ0A 1R15A 1Y8QA 2JFGA 3GN1A 1H9AA 4OSPA 2AEMA 2Y0CA 3G0OA 3CKYA 5GZ6A 3NJ8A 1BXKA 3JCZA 3OIFA 1EVJA 4K1LA 4UVDA 5BR7A 1YWGO 4HFNA 2PD3A 1EZ4A 1V3UA 3M2TA 2OXIA 1K2WA 4YPOA 3WR5A 2NSDA 2RBEA 5TQVA 3RBZA 2Q4BA 2WWRA 3DTYA 2Y1OA 3CIFA 3AY6A 4BIIA 4JBGA 2NM0A 7ADHA 1PJCA 4BKUA 3H9JA 5JE8A 3HDYA 5CDSA 2CF5A 4OO3A 4DYVA 5AXAA 5L9AA 1P1FA 1U3VA 1OBFO 2J3IA 2RAFA 5CPFA 3WTCA 4CM8A 3RUHA 1OX3A 4CMIA 3DWFA 3N7UA 2DBVO 2JHFA 2O50A 2YV2A 3RKRA 5ITVA 2H1SA 3OA0A 3ZHZA 4DL9A 3VTZA 1PJ3A 4J4BA 2GF2A 5A5FA 2JD1A 3X2EA 4UUMA 3JQ7B 2R00A 3AW9A 2UYYA 3MJTA 4WLEA 3MOIA 2NVUB 1GUZA 1RM0A 4YT8A 5B12A 2NQTA 3ANNA 1LLUA 2RHRA 3GPIA 3H9UA 2C5EA 2ZB8A 2WTBA 3PIIA 2V6MA 1U9JA 4ND3A 4NHEA 3GVHA 1PIWA 4UVHA 2VQ3A 4FGWA 4NU5A 4JJFA 5G0VA 3WLEA 2ZQZA 2Q49A 5A06A 1XWFA 1WZEA 3DBLB 4CQLB 3BA1A 1UXHA 1VJ0A 3H6KA 1E1NA 4Z3KA 1ONNA 3GRPA 2NUAA 3WWZA 3T7CA 5ADHA 5F1OA 1R4MB 3CZMA 3ZWOA 4RJTA 3VAZA 4BNJA 4Y98A 1DEHA 5EL0A 4F3YA 3ZWPA 2IZ1A 4QSMA 1XA0A 2Y1CA 1TVEA 5CDYA 2B4QA 4CM6A 1W0CA 4YAGA 1XQ1A 2AW5A 3DXFA 5JCJA 1LI4A 4R54A 5G2OA 3WMXA 3R0IA 4PLWA 4Y9DA 3DZKA 4EYEA 3ZWCA 1B3RA 2VHWA 5DCYA 1M6WA 4YWJA 5DN9A 1LSOA 3GF4A 1H6DA 4ID9A 4MVJH 3SVTA 2EW8A 3P19A 1N8KA 4Q3NA 1QV6A 3K9QO 4XKJA 2VT2A 1EEHA 2ET6A 3E48A 3MJSA 5KVQA 4C7KA 4EJ0A 4WK6A 1EUZA 2DBRA 5L7TA 1UAYA 1ADGA 1VLLA 1HYGA 5ENDA 4AJ4A 3CMMA 1HEUA 1DIRA 2PGLA 4IQ0A 2OGUA 4L75A 4LVCA 1BGVA 3QY9A 3INRA 3W6ZA 2HUNA 3WGZA 1VM6A 6ADHA 3DHYA 3JD2A 1GPDG 2DPHA 4E33A 3WFIA 4J3FA 4K9DA 1JKJA 1YBAA 2GN4A 1Z45A 2YHIB 3EK2A 3TZQA 3I23A 2GNAA 4MVJF 1M75A 1S7CA 4XDZA 3T4XA 1ID1A 5DP1A 1MC5A 4R3WA 3JD0A 3RFXA 1AHIA 4XYLA 4IXWA 1F8FA 3IP1A 2DM6A 4BNGA 1E92A 1V3TA 4U6SA 4E5PA 3ROQA 4JLWA 5F3RA 1HLDA 3BMQA 5FF9A 3VTFA 1Y8QB 4E5YA 2BELA 3GG9A 1AE1A 1LDGA 2GR9A 1GQ2A 1WDKA 4KUHA 4ROSA 1ZIDA 2X9VA 4YQYA 3WGHA 4LVUA 2HJRA 4N5MA 4UEOA 4PG8A 1YXMA 3H65A 3ONFA 5JAQA 1G6KA 4AJHA 2VRCD 5L95A 3BTSA 1ENOA 4J4HA 2DU8A 1ZVMA 4KDEA 2WMDA 1U2DA 2X0NA 5B4VA 1H6CA 2PLAA 3GAFA 1QV7A 3FNHA 1YL6A 2ZKLA 5A05A 3QWHA 3JQAD 4GBJA 1PJQA 4EI2A 5G0SA 2HMVA 3PVZA 3GGPA 1Y7TA 4B4OA 2J5QA 1ZMOA 4Q3DA 1HWYA 1E3SA 4B4WA 4CM8B 3BZUA 1PX0A 5G0WA 2V65A 1CEQA 3LF1A 1JU9A 4XJTA 3C7DB 4O1MA 5BNTA 2YZ7A 4EJMA 4N7RA 4L74A 1YJQA 5DP2A 2O3SA 4CL8A 3JQFA 3TFQA 4NR0A 4GSLA 2QZZA 1E6UA 1JA9A 4HY3A 1B8UA 1GPJA 3JYQA 2BFOA 4PLTA 1LU9A 2O3RA 1XIVA 1C1DB 1T2AA 1VJTA 1PEDA 1T2EA 3A4VA 4Z9XA 2QRJA 2Q1UA 4MVJM 3OFSA 4IDDA 4KUGA 5LCXA 3U9LA 4RF2A 3ZNOA 3S2EA 5CFZA 3OICA 2OUIA 5KJ6A 1I30A 5FI5A 3KETA 3PGXA 1EUDA 4LGVA 3LQFA 4I5EA 2NTJA 1PJBA 4HWKA 5C7LO 2OOSA 2OBNA 2Y99A 4ZD6A 4OXNA 3I6QA 3N58A 3D0OA 1LNQA 3NTRA 4M86A 3UF0A 2B4TO 4U6QA 4R4JA 1NYTA 2NTNA 1JVBA 2X4GA 1GCOA 3SXPA 4YVFA 1J49A 3CMCO 2O23A 2WSBA 3NDRA 3WJAA 3H5RA 3VC7A 4WLNA 3VDQA 1LSSA 2O2SA 5IJZA 4BNKA 2ZYGA 1CRWG 2JKVA 1LUAA 1R0SA 3DL2A 3JYLA 1K6IA 3OSUA 1M66A 4RPLA 2O4UX 3BTOA 1J5PA 1I10A 1GTMA 4Q3CA 3LVFO 4XQEA 3WDSA 3W8DA 1O95A 1NVMB 4RORA 4RF3A 4BGUA 2FRDA 4IIUA 4GAEA 4YACA 2X0IA 3A28A 1T4DA 3PQFA 4TZTA 2D5AA 4IDBA 4QXMA 2GUGA 3PLRA 3P2OA 4CMGA 4YAIA 1CERA 2IEDA 2VOJA 2E48A 4BNVA 5EN4A 4MIOA 3ROKA 3H9QA 3QA9A 3W6UA 3JQAB 3GPDG 5IFLA 4FN4A 4W7HA 4BKPA 4QUKA 5GZ3A 1PJTA 3EYWA 2ZIZA 3B6ZA 3PYXA 4Q9NA 5THQA 3A1NA 1TB4A 2EXXA 4RPHA 4G65A 4J49A 1V8BA 4RVGA 4Q3BA 2PR2A 3JQDA 3OEYA 3GMDA 4CQMA 3O03A 1YOVA 5F21A 1X1EA 1WMAA 5JC8A 3PJDA 1VKNA 1S6YA 3GGOA 3CTMA 1HT0A 1A9ZA 4LRSB 2H5LA 5TF4A 4YEDA 4R1UA 4RPGA 3PDJA 4ZGWA 1ISHA 4HFJA 1F17A 1GCUA 4MIYA 3PPIA 8LDHA 4E32A 1MG5A 2B36A 4UAGA 4ZQEA 4I08A 1KBZA 1H2BA 3AFMA 2NU6A 4ZJUA 3IOYA 5F5LA 5BSEA 1HE4A 4OIMA 1I33A 2VNAA 2F1KA 1WPQA 1I2CA 4CLRA 4FFOA 2ZCVA 3TJRA 4J7UA 1UXIA 3U49A 5IDYA 1E6EA 1Q7BA 4XCVA 1YDWA 3GNQA 1SNYA 2Y67A 4YAKA 3AI3A 4EW6A 4FW8A 3ST7A 1E3LA 3FBGA 3PWKA 3U4CA 1AA0A 5JFOA 1GV0A 1JWBB 1IZ9A 3DMTA 3L4SO 4D79A 3KLPX 3WOHA 1GAEO 4J0FA 5IDWA 1E5LA 2AG5A 1ZEJA 3W1VA 1Y5RA 4XQ9A 1MA0A 1FDTA 2OBYA 3V8BA 5ICMA 2VCYA 1BVRA 1G0NA 3GR6A 1IB6A 2VUTA 1GYQA 2P9CA 2YYYA 4FC7A 4KWHA 3Q6IA 2P4HX 3E8XA 4XB2A 3OJOA 1W4ZA 1Q0LA 2IYOA 2X0JA 4E5NA 1OFGA 3AFNA 2E82A 1KEVA 3I9OA 3F6YA 4A03A 1ZJZA 4R68A 3EMKA 4BNIA 4EUEA 3PP8A 2VWQA 4AFNA 4NK5A 1Y9AA 3LDHA 5JDCC 1MFPA 1EE2A 2OZPA 1X14A 5I8ZA 4NNJA 3OJ0A 4CM5A 1SOVA 5IAAA 3NT2A 3RAJA 4QQRA 3JYPA 3OH8A 4EUHA 4URFA 3LC7O 3IMFA 4L8VA 4DUPA 1X7GA 2VOEA 7MDHA 3GT0A 2FPPA 4LMPA 1OC2A 2BFAA 4IBOA 3WGIA 3WXBA 5IZCC 5CEFA 2QZ9A 5JY1A 3KYCA 1HSOA 3QP9A 4WCFA 1PQWA 2NADA 1YB1A 3P2YA 2XXJA 4GX5A 3DAFA 3ZHXA 1VSUA 3VKUA 1F06A 2ZQYA 4NU6A 5JLAA 4ND4A 3LT2A 4OKIA 1NASA 3JQ8A 4JP3A 1WW8A 5F1PA 3U62A 4CMKA 4CV0A 3WS7A 4CJXA 1DLJA 3QVXA 2Z1MA 4WASA 1NPTO 3BTUA 1H6BA 4HFRA 1NWHA 2SCUA 1KERA 1MV8A 1R37A 3QWFA 4WLOA 2C59A 1O8CA 3Q2KA 1LSUA 1ONOA 3DAGA 2JCVA 3DBVO 4BO9A 4E2ZA 2JAHA 1VJ1A 1GZ6A 2QRLA 1F8GA 4J2OA 4PZEA 4ZQBA 1NR1A 4B7CA 1IPFA 5DZSA 5LC1A 3EHEA 4AVYA 1RYEA 4PLCA 5KVSA 4IJKA 1QORA 2Q1WA 2UDPA 4QEDA 4TZKA 1PR3A 2IYPA 2HU2A 5JC1A 3PK0A 3Q2IA 4GVLA 3PTZA 5F1KA 3KBOA 4UEJA 3EZLA 2EP5A 4FFRA 4DA9A 4CODB 2JFFA 2BHLA 5C37A 2ZCUA 1ZCJA 1QG6A 4Q3EA 4FGSA 3BMCA 3DTTA 1NHGA 3ZWNA 1MXHA 3RWBA 1KVRA 2HK9A 1DJQA 4MKXA 4P4GA 4Y6RA 4W6ZA 5F5NA 1FJHA 4D41A 1GUFA 1CDOA 4ESOA 1D3AA 1LBEA 3GEMA 5MDHA 4M1QA 2VYVD 4UREA 1NX6A 4O63O 1I0ZA 1ZK3A 1CETA 4D3DA 4B8WA 2XPCA 4FJ2A 3E1KA 2V6BA 1Q7CA 3KXDA 3EW7A 4PLGA 2J6IA 5FFFA 1WZIA 4B8ZA 3WYBA 2BLLA 1DXYA 3EDMA 2PH3A 4IMPA 1WXDA 5AYVA 4MINA 3VHRA 2P5UA 1C3VA 4GKBA 3UHAA 3PYMA 3UCEA 2BMAA 3BMOA 1E3JA 4NBTA 3HN7A 5JCXA 3F5SA 2I9PA 2BI7A 2R2GA 3IJPA 1NNUA 1NPDA 5CP8A 1ZNQO 5CPBA 1BDBA 3IQDB 3AOGA 3C7CB 3FWZA 5AOVA 1DFHA 3GA0A 1KOLA 3VPHA 4R1NA 5B37A 1DC6A 3AM3A 4A7PA 3LC1O 2ZYAA 2X5KO 4MVJE 3T7EA 4OKNA 3VH2A 3CTVA 3FPLA 4M55A 4CLDA 3OIDA 5JDIA 1XU9A 4OM8A 1Z73A 1TLTA 3CXRA 3L4BA 3BYZA 4FC6A 4XJSA 3RI3A 1GQQA 5K6AA 4QT0A 1QLJA 3HSKA 3EGOA 1NP3A 1IYZA 5ER6A 3M2PA 2B35A 4J16A 3RUFA 3V5NA 5JO0A 4ZA2A 1UDAA 3ZV3A 3C24A 5L45A 3V1TC 4WOJA 4U8GA 5U4QA 3HHPA 2GYYA 5JBIA 2E6UX 3C3XA 1V3VA 5K9ZA 5JMWA 4YBZA 1BW9A 3ZH2A 3KYCB 2P9EA 1U3UA 4WCFB 2YDXA 4JROA 3KRTA 2C54A 5ER9A 4CMHA 4H16A 1Q1NA 4J2HA 2EV9A 4BMSA 4CR6A 3K92A 3PHJA 2O3QA 1ORRA 2VZ0A 3DBRB 4OGWA 1DFGA 1O5IA 4YCAA 1O9BA 2CF6A 4E21A 4D46A 3FCOA 2O4CA 2PZKA 3FWNA 4ALLA 3NUGA 3KUXA 4OOFA 1DHRA 3KVOA 2AQHA 2HMUA 3JQ9C 4BS9A 3GH3A 4J1QA 1ADCA 1TXGA 5KVVA 3IUPA 4IJVA 4FCCA 2Q2VA 3SEFA 2X1HA 3E9NA 4J7CA 1NTOA 4R1SA 3T4EA 1DOHA 4E30A 5A9SB 4AJNA 3PEFA 1IHXA 1R0LA 2AEFA 2J3KA 1A71A 2GERA 4LN1A 1UZLA 4GPD1 1XR3A 3QVTA 4J91A 3HADA 2VUSA 3DHNA 3JD1A 1A72A 3PQDA 3PXXA 5AQ1A 3DFZA 4BNTA 3UXYA 1DRUA 2OMEA 3GGGA 1PZGA 4G5HA 1RJWA 1I36A 1FDVA 4YJFA 3GQVA 3PWSA 2WE7A 4LRTB 4XRRA 3FHLA 3GVPA 4JBHA 3CUKA 5HS4A 1BG6A 1H2HA 4UULA 3V1UA 3OF2A 1N7GA 3PHIA 3VPFA 3BMCB 3D7LA 4LSWA 1A27A 4CM4A 1LRJA 1C0KA 4FFNA 4HNGA 3G1UA 3TDKA 1A7KA 3QJ5A 4BNHA 3NV9A 2LDBA 1CYDA 3RFTA 3C7AA 2UUOA 2VRBA 1BDMA 2WDZA 1PGOA 5CDTA 1LC3A 4AG3A 3UAGA 1U5AA 1P1IA 1O94A 3OQ1A 1MUUA 1XQ6A 4IJWA 1H9BA 4FD3A 3RQSA 5I7VA 4WPGA 4BV8A 4XR4A 1P3DA 2VUUA 3ZU2A 1UDCA 1DRVA 1GQYA 4M49A 3GFGA 1F12A 3O8QA 5IDQA 1P0CA 2PZJA 3VH4A 3MJVA 5EERA 1XKQA 3UW3A 3D3WB 1YL5A 4DGSA 2PWZA 3GDOA 1HDRA 4NI5A 1PL7A 3HJAA 1HE3A 2BH9A 2GN9A 1VL0A 3ETEA 4PVDA 4Y6PA 2X8LA 1SB8A 1AHHA 1QYXA 2NU7A 1T1SA 3BHMA 3VOSA 3ITKA 5AXDA 2EJVA 2O7SA 4IPTA 2OORA 2Y93A 4E31A 4BNZA 1G1AA 1Z82A 2WYVA 2R00C 2ZB4A 3AUAA 2AQ8A 5COBA 3V2GA 4YYZA 1NQAO 2RH4A 3WB9A 2HO5A 4OJNA 1U4OA 2HK8A 1UAGA 1VC2A 5CEJA 3OJFA 4CR7A 2GZ1A 4ZQFA 1FF9A 1I3LA 4N54A 3O4RA 1Y8RA 2H9IA 5L40A 4OYRA 3F5QA 2YDYA 4TVBA 4ALIA 1QXSA 3JQ6A 3NAQA 1VL6A 2OL4A 3AM4A 4AJEA 4Y6SA 1I3NA 3H9EO 4WEOA 3ZW9A 2I5PO 5DBGA 1IUKA 2X9NA 1JN0A 1QR6A 1FXSA 4Q3AA 4G81A 2IRWA 1LX6A 2G1UA 2G82A 2PY6A 2DTDA 4JIGA 3D4NA 4OQZA 4XWYA 3FRJA 2D8AA 4WLVA 3QRWA 3W8FA 5JPIA 2I3AA 2UAGA 3GMSA 3STHA 1HDCA 3D64A 3KSUA 3DBHA 4N18A 4R16A 3VZQA 4WOKA 3PGJA 5IDXA 4L9RA 2CVZA 3TZ6A 4RVFA 1U1IA 1LSJA 1I2ZA 5BNIA 4A27A 4AICA 2Q3EA 1E3WA 3RC9A 4AL4A 2B4RO 4H3VA 3DFUA 3DZBA 3WTBA 4MVJP 1B8PA 2Q45A 2C5AA 2B0JA 1QMGA 1HZJA 3U3XA 4BL5A 2DVMA
chains in the Genus database with same CATH superfamily
4YROA 3MJFA 5EE9A 3D6FA 4JDPA 2BZSA 4Q6BA 3N3BC 3DOCA 2VSQA 4D80A 1NAYA 1XLUA 1H23A 4PTZA 4EG4A 1B26A 1QCCA 4R41A 1DC4A 4AJJA 4EYKA 5JCJD 2AOTA 1FYEA 2AYXA 3IL2A 1DIAA 2HQ1A 2JEEA 1D2CA 4J0EA 1PJ4A 1TECE 1PS0A 3OP4A 3EY4A 3V4LA 1Q2XA 3Q2YA 1G98A 2E89A 5DNEA 4R71A 1SIBE 8ATCA 2RGYA 5I9SA 5APYA 4P83A 3F1KA 3EPPA 3LTEA 3TZLA 3A3KA 4KN5A 3KAKA 4TV9B 4OOEA 5KTOA 1Q3HA 4MO9A 1ANKA 2LV8A 2YVAA 2FCRA 3QF7A 4OGQB 3PUIA 5EUMA 1D4AA 4V0OA 3HYLA 2WU0A 2WM2A 3K9CA 1H93A 2P9HA 1UP4A 2ZVOB 1CRZA 3D3JA 2IHYA 2E4WA 2BEUB 5BT9A 3DMDA 4F1WA 2FUNB 3K9WA 3QPBA 3EXEA 1K0UA 2ZJ0A 1KJ9A 2OAQ1 1PU2A 3LUBA 4C21A 2CHUA 1NBMA 4P98A 4MEAA 2V9PA 3L9WA 4ZRDA 1SVFA 1Y8CA 2YHUA 1Z7WA 1ZL2A 2AB0A 1SA0A 1NPYA 3EC7A 3FXAA 2A45H 3MCUA 2VYQA 2VT7A 1XSEA 2ZBFA 4JQYA 3DCJA 4QRHA 1O95D 1JEEA 3U13A 2YRFA 1E0DA 6PFKA 2QLFA 4MKZA 4KQIA 4XTCS 3K0AB 1RM3A 4J90A 1N1DA 3FF1A 5AW9A 4CLEA 3QKUA 4P0QB 3I3OA 4DQUA 5IT0A 5FR1A 4OEHA 1MDFA 1VSBA 4BLTA 1X7HA 4UHFA 2WU3A 1EM8B 3W2FA 1IBKB 3F7MA 3AETA 1M6YA 1T4MA 2QUHA 2IS4A 2YOGA 1QQ5A 1WHSB 3IUYA 4W7ZA 3PRHA 5FNVF 4PBTA 4YH1A 3TTYA 1G2PA 4U3FD 3ABRB 1ZPDA 3ITNA 1VIVA 2PJRA 3HC7A 3C3BA 5A2GA 3TZCA 4HXYA 2JBAA 1KDVA 5LYYA 1DEAA 1TJ5A 1C0EA 3TW0A 1T3LA 5SYNA 2IUTA 2PPLA 1K75A 4DSAA 1OX4A 1SUSA 3U09A 1FFXA 2YWXA 2G5GX 2GDJA 1KWKA 1X15A 5JY6A 3HJCA 4CQMB 3SS8A 3QWIA 1RWNA 3JRWA 2V6GA 4I5GA 2EHJA 3UC5A 1BU5A 1XK7A 2Z95A 3VOBA 4BNMA 1MO2A 1MQAA 5L7YA 3F2IA 2G5CA 4LF8B 2RGNC 5C46F 2GRAA 2AXTH 1N5OX 3ZDZB 4CLRB 4KPUB 3PHHA 2WHYA 3NRCA 4WY5A 1UT8A 5ALVA 4JSTA 5B2ZA 4UFPA 5LL6P 3K70B 1WXGA 1E1MA 3ZKWA 1ZN2A 1PR5A 3PD0A 4HC4A 3WIOA 1QRTA 1Q77A 1GA1A 4NPEA 3F90A 4LJYA 4MUHA 3QI2A 1VQMP 1QHYA 1SQQK 4LYDA 2HDHA 1O97D 3DQQA 3WK9A 1PZFA 3I9KA 4HTFA 2APJA 1F51E 1U0GA 4Q01A 5ECYA 3RM3A 3FVRA 5T8KA 1A7UA 1XCPA 1ULSA 3D2CA 2VK1A 5DF1A 4OUKX 1HETA 4WXEA 4RJKA 2N47A 1PL5A 4IDFA 2C97A 1W85A 1J25A 1D1QA 1T9CA 4AJLA 2VG8A 4C29A 1ID8A 3RS8A 2B89A 5CT8A 3JVEA 3RJ5A 2PH7A 3NTNA 3HE4B 1VL2A 2YN0A 2GDZA 521PA 2ZWIA 5H9WA 3NU1A 4UTRA 4YAJA 5BUQA 2QLLA 3LF2A 4O2AB 3QFSA 4BTEA 3TAHA 2PBRA 4OK3A 3SM9A 4D4IA 1T35A 5JROA 1VF5C 2HLPA 4QIHA 4DANA 4OCZA 3QW2A 4YP7A 3D5TA 1IE3A 4TGLA 4GT1A 4KSCA 5BVGA 2DT5A 2OBFA 4I8DA 4PC3A 3NBAA 1Z7GA 1T6YA 4GR9A 4XGIA 3R3JA 4B6SA 1ISFA 3EPJA 4RJJA 3VZPA 3MTEA 4J6FA 1NU8A 4LRYA 2B0CA 4DXDA 4YPFA 3WMRA 1MX3A 5HKOA 3W5HA 4BHTA 3K4PA 1SG9A 3FCYA 1MIOB 4LDPA 3L6OO 2AXPA 1UWVA 3QU4A 1GKKA 3II6X 3OZFA 3WMWA 1X70A 1OGIA 2ZYIA 5THKA 2ZRDA 3ZU4A 1MVOA 1Q91A 3CNBA 2LCQA 1DXQA 3P9IA 4PNEA 2A9KA 2G09A 4OSOA 1MJNA 4IL6H 1XL1A 3SEAA 4ZRMA 1QH1A 1VHDA 1GZUA 1OLSA 4R3WA 2CNBA 2BM1A 2EBWA 1IC6A 4IV0A 3TW8A 1KK0A 1IJKA 2OSBA 3EAGA 4GMHA 1CUGA 4IF6A 3AK4A 2A0XA 3BQ9A 4XGNA 3DE2X 3MQ4A 4HDNB 1DAFA 5KYXA 1KYWA 4Q02A 2JIDA 3N2EA 4NZPA 4IKPA 2ZBGA 2FY8A 5JNWA 2A57A 1QC5B 3V7FA 2VP2A 3PDUA 3RHFA 4IDNA 3K2QA 4XUCA 4JI0B 1Y3AA 3GEBA 1NHWA 1DT5A 4GDMA 5EHIA 1HR0B 3EXIB 5F77A 3L1KA 4GKVA 4HSEA 4PSVA 1USUA 4A23A 1OU4A 5B66H 2BMDA 5AW8A 1SBCA 3IXQA 2AN4A 2I33A 4HDMA 3NZEA 5REQB 1PP9G 3M9XA 3P27A 3G5UA 1P33A 4IUDS 2I2XB 1Z8HA 1LNSA 3LX5A 1Z8FA 4U0KA 3C70A 1JDPA 3WWCA 2AR9A 5JCOC 1K1EA 3DH0A 4OQYA 3N0RA 1W30A 1P5ZB 1R0KA 5F33A 5JS7A 3A1DA 3AEUA 3KAJA 3OHPA 3CC2P 4P80A 1MOQA 3V4ZA 3CCJP 1UBNA 3MWYW 3L40A 1YZVA 3LLCA 5CEEA 3Q3CA 3AR3A 5CT9A 1WZUA 4C4PA 2FPIB 4E12A 2W6CX 3PQ7A 1YQ4C 2QRXA 4XW2A 4KPGA 4Z9FA 3VR4D 4MR7A 5FOQA 3I52A 3VTKA 2R8BA 3V34A 2BZGA 1JR4A 2DBZA 5G1NA 3CT6A 4NCAA 1POXA 3C6KA 4HBGA 4C78A 1KY2A 1TF5A 2IYUA 4BO8A 1UZUA 4KQCA 3PPVA 3VMYA 2QMEA 2DAPA 1G9XA 2XIQA 4EUKA 5LZ9A 1K6JA 1M0WA 1E7YA 4XYGA 5GMOA 3MZWB 2XDAA 1E2FA 1Y7LA 3LRXA 6REQB 1CQIB 1OAAA 4IDAA 3IOCA 3K8YA 1B1CA 3BIOA 1KO5A 3RFVA 3QVWA 4N49A 1EHCA 1KI6A 4M0FA 4YJ2B 3H1LD 3F0TA 1SQBE 3ELUA 2AF4C 2ZRBA 5F76A 1Z8DA 5AUOB 2WM3A 4KHZA 3THOA 1ZLXA 4AUKA 1UF9A 3M0AA 1S4XA 4FFLA 3EDOA 2JB9A 4J7AA 4CKWA 3CNHA 4TL8A 4LJ8A 1YS7A 3TSCA 4HG2A 4MR8B 3MCVA 1KWGA 3TR6A 2Y1WA 5TGZA 1ZICA 3ADPA 2G9NA 3ONVA 1ZCZA 3NBKA 5DVZA 3HZZA 1S96A 2H9AA 5FYDA 2I80A 1Z4OA 3DNPA 3I9NA 3U56A 1CI6A 1Y1TA 3BL5A 1P29A 5DOZA 4D56A 5IPFA 1PYDA 1QGAA 5F51A 1G64A 5JH7A 3HEAA 1P5FA 1C0IA 1WLSA 2BMFA 4WA8A 1M2WA 4C6TA 3TLKA 5FPSA 1GU4A 3PDWA 3IAHA 1Z74A 2OVFA 3MVEA 4XIYA 3DAOA 4PZDA 1Q44A 2QGFA 3A5TA 1MB9A 3FDZA 5LIPA 5AT1A 5JSFA 3TL3A 1V5EA 5J4LA 2NVBA 2A9PA 4NFYA 4PPFA 1PDVA 3EXG1 4B2LA 1QGDA 3A9SA 2RHJA 3Q0EA 2WIBA 1FZCA 5JEDA 3UMYA 4BX3A 1CDZA 3BRCA 2B21A 1JTHA 2M3BA 4R84A 3W5JA 2OM2A 3ET5A 1U0NA 1SKYE 3DO6A 2ZTMA 4LYGA 2B4KA 1J0DA 4PR3A 3MMZA 4N6JA 4NOKA 5LXTA 4D9JA 3U61B 4X7PA 2ZS9A 3VRHA 1L7VC 4EUFA 3VPBA 1EI9A 3SSOA 1K9VF 3DBLA 1FDRA 4NWIA 2X8JA 3BB4A 5F73A 2PX0A 5LWQA 3ZCQA 2OSVA 4HX5A 3DGFC 3DVQX 4R1MA 3IJ5A 1KFCB 1U0OC 2DBQA 1NN0A 2VAMA 1X92A 2X15A 4POAA 3IP5A 4PLYA 1KEWA 4JNCA 4XPZA 1PZHA 4DLBA 4W99A 4I9HA 2BBOA 4RY8A 1G0OA 4R3UC 1XT6A 5KNCD 5FA6A 3DLIA 3WYAA 3KTAA 1IFPA 1MZVA 2P2ZA 2FN3A 1VI5A 1A0OA 3BWXA 4ERNA 2X14A 3W7BA 1V2GA 4JXXA 2Z6UA 2VI5A 3RRZA 3H5WA 1E6MA 2OHOA 1U28C 3VYWA 1EZVD 4PBRA 1SQBJ 5ETJA 3K20A 3R75A 2ZDHA 4Q3LA 3SYKA 1KYOI 5B7QA 1SQQG 3LUKA 4CM8A 4F97A 2CLSA 1SN7A 2WJGA 1FXWA 5KINB 4RHXA 4UUMA 2ODEA 3IXMA 2WKQA 2B82A 4M0UA 3E3LA 3AIIA 1OXSC 1K2VN 3AIOA 1GT91 1WZEA 4O33A 1AIPA 2ZFCA 3DKRA 1YFKA 1OXTA 5ADHA 2XHZA 3VAZA 2I3DA 4B3XA 3ZDAA 2VF2A 1QFJA 5BOSA 1KJWA 2GTHA 3RHSA 1Q0TA 4F3YA 4NCNA 4QSMA 5JRDS 3QUSA 1XQ1A 4Y6OA 1LI4A 2V7VA 3R0IA 3DZKA 3RFCA 1LSOA 1JJAA 4WNYA 3P19A 1N8KA 4WBNA 1EEHA 1G1MA 1OYOA 1HYGA 5AM0A 4NBKA 4F3NA 3GHGA 3A1EA 3U48A 1Q2UA 1Z45A 3NMUF 2PUJA 1OAOC 1TZBA 4UDYX 5HRAA 4PS1A 1U4NA 4BAUA 2HNBA 3MS4A 4CF7A 1QX4A 1YFJA 4E5PA 2AX4A 4B75A 4DHWA 4N5MA 5KHOC 1XVIA 1J2TA 4EZIA 4LBZA 4KDEA 2PLAA 2HZBA 4EFMA 1FFAA 2IY7A 3ZIDA 5EFWB 5G0SA 1RLUA 4BN0A 2OB1A 1PX0A 1G8PA 4MQ6A 2DFPA 4NR0A 2WJ4A 1OZHA 1E94E 1B8UA 4EGAA 1SKBA 2BFOA 3CVWA 3GI1A 3MRTA 4Z9XA 3K5BA 3TIFA 4ZD6A 2RB5A 3N58A 5H2FE 3ZVKA 5M29A 3UF0A 4R4JA 4URZR 1JUDA 1JEQA 2XB4A 1T4CA 3E84A 3DL2A 4RPLA 5JV5A 1J5PA 4EB6B 3LVFO 4D6YA 1NVMB 3HKBA 3AJEA 4ZV7A 4YACA 1H8HA 2R0QC 2W6NA 1E1CA 1KXZA 5K4GA 1VQ8P 1DC7A 3QA9A 4AS3A 3JQAB 4HPJB 3EYWA 5DX1A 1BCCJ 1DQZA 3A1NA 5BYKA 4G65A 1BD3A 4RVGA 4P1ZA 2DCMA 4P3NA 3MCTA 1EUYA 3KQGA 1NLYA 5JOQA 1JHZA 4WXHA 2ZJZA 5TF4A 4YEDA 4RPGA 1PR4A 4C89A 8LDHA 2XXAA 4QUDA 1IXYA 4P08A 3B9PA 4QYIB 2XRFA 3K09A 3VX4A 4Q16A 2DULA 3AIMA 3BK2A 3KPJA 4J7UA 4WKCA 4JASB 1XJ5A 1IFXA 1ZA1A 3I72A 5ALPA 2Q6OA 3KVRA 3NC1C 3MMXA 1N25A 3MMPA 1YJCA 1IB6A 4RZXA 2Z2IA 2B92A 1FNDA 7REQB 4RA6B 2WVAA 2Z2JA 1P91A 1LJUA 1RHZB 4E4TA 3E05A 5SV2A 1IY0A 3TVTA 2J48A 2W7TA 4AYXA 1OJLA 2OZPA 4JEHA 3L70G 4KR6A 5IAAA 1OW6A 3IDFA 1GLVA 1X79B 4HOYA 4QRIA 3X1KA 1OC2A 2AWNA 1F06A 4NU6A 4ND4A 1W87A 4DA4A 3PH0A 5B5EH 3BTUA 4P92A 4HFRA 4O1HA 2XB6A 1E69A 4D6PA 3Q2KA 1IOZA 2XUDA 3FKQA 4BO9A 2O1SA 2RHTA 1RE4C 1IMOA 1FJPA 2OGWA 2JK1A 3RT7A 1SJ9A 2O8EB 2WAAA 1RYEA 4E09A 1US8B 3OZEA 3WGMA 4D0LB 2C3OA 2ZCUA 4QFBA 3ORHA 3Q40A 3VU9A 4MRMA 3ZZMA 4ZDJA 2CNDA 3PNVA 5I5EA 1NC3A 3PGKA 1V5IA 3D7RA 4MEBA 4D4MA 1VMEA 5BSWA 3L02A 4YNBA 2V4UA 1Y9DA 1XEWY 3GLGE 3TOCA 3PQCA 3VP9A 3QELA 1TKBA 1WUYA 1NPDA 2WD9A 1T3TA 2OYIC 3NHLA 5BRAA 1YZHA 2X5KO 3FVTA 4YJKA 4OAPA 1O08A 2HEIA 1RZRA 1E1QA 5HBGA 5IULC 2EVWX 4NC9A 5U4QA 4QG3A 1NQVA 2ZBPA 10MHA 1U3DA 3ZH2A 2AKEA 4A91A 4KBYA 4H35A 4H16A 4J2HA 1L2PA 2HYNA 3PHJA 2ZUTA 4F5DA 1WM1A 1OILA 3FCOA 2CCKA 1GPMA 4JLKA 3T5CA 2FQXA 3KCNA 1QM5A 3DVRX 1N4AA 2QM7A 1NTOA 1UDXA 2D74A 1VLMA 3AR6A 1IHXA 3KOOA 2GERA 2G4CA 2GYVA 2EBHX 1LQ2A 4DCGA 4G63A 1BHO1 2VF4X 3UXYA 2HYIC 4ASUD 3G7NA 1BIFA 4LRTB 4XRRA 1CUBA 1NT2A 3PHIA 4NDAA 4LOHA 3EG9B 4BN4A 3IVAA 3TDKA 3II6A 4GLFA 5HE8A 2IDKA 3RFTA 3C7AA 4X91A 4L50A 2NO0A 3LY9A 4MWBA 2Z5GA 2XH8A 1XQ6A 2PRIA 5KSYA 2YZGA 5E1BA 1Y4UA 3O8QA 1HTTA 1V8PA 4L15A 5D1HA 4K6MA 5CCDA 4NI5A 1PL7A 1PZMA 1RHQA 4D57A 4WVFA 1K7YA 4DYHA 4HDQB 2NPSB 2BM8A 3SHVA 1OTYA 2H9IA 3T4UA 1BCSA 2GT1A 2H08A 3KKPA 2WYHA 4WJLA 2XGMA 2YVLA 3G7SA 4HDKB 2J7PD 1RQGA 3QOWA 3D64A 2JIMA 4YI3A 3GRRA 4DV1B 2CE7A 1XYVA 1U1IA 1I2ZA 3MLBA 2HMAA 1JE0A 4R2XA 1OR8A 4LMBA 1OXXK 2FEAA 1X80B 3PDHA 3ZJVA 1IJDB 2PH5A 2QL7A 4DLVA 4Y9TA 2EZ8A 3G79A 2OQVA 4LC9A 1MW8X 1RI3A 4M88A 1FMLA 1UMCB 2K88A 3STVA 2IE0A 1C7JA 3SSUA 1VBMA 4FCTA 3RL0D 2ZPUA 1RYDA 4GKGA 3PJFA 2WJVA 3T1HB 4IS3A 2C2OA 5B1YA 2E42A 4YO8A 2ZANA 4KRGA 4JP8A 1OPRA 2HPHA 5IWAB 2FW0A 3L1HA 3PRYA 1HJ0A 4R51A 5EMKA 3G3ZA 1IOVA 4OGGA 1RHMA 3LCCA 1N3BA 4B6QA 2HU8A 4MGHA 1ZKMA 5C2JB 5FH9A 5KYYA 3HB5X 4OB6A 1CJTC 3QKWA 3Q5EA 3GJQA 2AIRA 2ZATA 2XNHA 2KS6A 1VIMA 2J0SA 4PWZA 1QRUA 2ANBA 1NG1A 3JTMA 3RE1A 1TO6A 4QQFA 2ECFA 1UKBA 4QE3A 4EECA 4IH9A 4FMDF 4OVNF 1SVSA 2E55A 3RT9A 2QTVB 2ZM6B 4R9SA 1NAFA 3LOPA 1XLWA 4EATA 1DU4A 1RNLA 1H05A 2HLHA 1LPAB 2HOQA 4HS9A 4DBLC 4IKOA 3DAHA 3KBBA 2BUCA 5A03A 3CBQA 2A9FA 4OHRA 1DARA 3R20A 1C3OA 1YS2X 2RIPA 1RLJA 4OGLA 4UKDA 2ZI5A 4L2IB 1U04A 3E7PA 3G6EP 4TQAA 1KTMA 1NH4A 4AS2A 1PT7A 3L1JA 5CYFA 4OQFA 1OBCA 1M1JC 4U7JA 2IHUA 5D1NA 5CMZA 4AX4A 3O26A 2XYQA 1ZOSA 3LKVA 4KQEA 1EXJA 4MW9A 1D6NA 2UU9B 3GJTA 1ADBA 2FN9A 4W7IA 4B7UA 3ZD8A 3SOZA 4PV1B 3GJ4A 2JFXA 4BMVA 1WB9A 3UN1A 1GL2A 3L6CA 1J24A 3TD6A 2VQDA 2YFHA 2R4QA 2F3SA 1PLJA 1JTEA 1U0LA 3OLCX 3RSHA 3EZXA 4ND6A 1A8UA 4Y2SA 1J1IA 2LR2A 2NACA 4EPXA 1W1UA 1RAFA 3AONB 3H8WA 2G17A 3SLGA 2R3SA 4NTZA 1SQBK 5IXSA 2VDLB 2P79A 3LP6A 3PA8A 2PWBA 2GFQA 1PV4A 3QFTA 2XE6A 4QPDA 3B13B 2Z1NA 1OVRA 1XZEA 2YC4C 1Q22A 3B20A 3VH3A 1GUYA 3L7JA 5ALKA 2GAFA 4RETA 1ZJYA 2J59A 1N32B 2EQ5A 2GUWA 1RHRA 2D5CA 1K9MQ 1FSPA 4HRYA 3GWGA 1F0NA 1VYUA 1EIZA 4W5NA 2N1TA 1KQFA 2LW7A 2J5UA 2ETVA 1VCNA 2Y1EA 3KYIB 5K8IA 3PNYA 3AEKA 4Y9RA 2YKQA 2C7OA 3OESA 1ZGZA 4WB4A 5B1DA 5TMDA 3H3XA 5KJCA 2P65A 2IGBA 421PA 5C5EA 5LB2A 3J7AC 2C07A 3L43A 4DDVA 2F8MA 2NW6A 2EFYA 3AF6A 3G8BA 4DZOA 1VMIA 1YF3A 2IEIA 4YONB 1EE1A 1HUCA 3HVKA 5D85A 3H6PA 5HTKA 3EMBA 1SKMA 2CE2X 5K0SA 5H83A 5BWMA 1L0NE 4JNKA 1E1YA 1TA4A 3WJ2A 1YH3A 1YR3A 2BFWA 3TOZA 5AW5B 4G9BA 4C4AA 1WUIS 1N5RA 4JR0A 1ECBA 4IDCA 3F46A 3RK1A 1ZM2A 1RI2A 2HV9A 3VR1A 1UZAA 3I05A 4K3UA 4M0LA 2M9MA 4ITVA 1FX0B 2ZROA 2PVSA 4A2PA 3FNGA 1EVIA 1SXJA 3LAWA 3V8PA 1G5IA 1PT6A 3D02A 2CBGA 3OE7A 4HAVA 2DTXA 1O9HA 4F4FA 1C9JA 1SU8A 1F7VA 2IF0A 1WCYA 3H32A 3HE5B 1YA6A 2ZBVA 1GFWA 3TUJC 1Z9BA 1XTBA 3AI7A 3C87A 5KX5A 1ZM9A 2H1VA 3OM9A 1X77A 3HZRA 2ZI3A 1NR5A 3I2JA 1T91A 5AKIA 4WY2A 1Z17A 4GOEA 1TA9A 1KY5A 3Q41A 4A5OA 3D4BA 3HU3A 2J3LA 2OZLB 4ZPXA 3BXZA 4S1PA 4B32A 1ZOLA 3C3AA 5TS3A 1XZNA 2C1EA 2RH9B 4EO9A 4YUWA 2LKDA 2ZW9A 3RV3A 2VDJA 5T41A 1V2HE 5LYJF 4MTLA 2Z8XA 1YS9A 4ZMSA 3URKA 4POOA 3KJGA 4E15A 1N2DC 121PA 4KL8S 4IX9A 3I2YX 3BCCE 3FVWA 4LBVA 5TT1A 7YASA 3R41A 3ZHTA 2J9ZB 2PMBA 4KOAA 2F48A 4NYJR 3LD9A 4DUGA 4OMDA 1N2CB 2L19A 4WGGA 2XUAA 4IGAA 1XFDA 5B7PA 4IY1A 3CRRA 1C1DA 2L5GB 2FMUA 3BIXA 2BEWB 4MOWA 4AUEA 3G02A 2YIMA 1IBCA 1CSBA 2QHXA 4KVZA 1A3CA 2XLBA 3GP5A 2P1DA 4QUIA 3LJKA 1M6VA 4DT0A 3CPHA 5LDHA 5DXFA 3TSZA 4NCXA 4HAXA 3MTQA 2R4TA 3EUWA 1FRNA 2J4DA 2BT4A 1LLCA 5IJXA 2Q3DA 4DJEC 4JLPA 1CZUA 3IDSA 3ZQ6A 1PGPA 3KQPA 3QJGA 1C3EA 1XCGB 2V0NA 4OX9Y 1S5LE 1YRWA 2JNWA 4X8HA 3R9IA 3I9FA 3BE8A 3LYHA 2J6HA 1KMNA 2I65A 3A06A 1TW3A 3U7JA 3VISA 3CRZA 3I01A 3I1JA 1W2EA 5BW5A 4C08A 2NUPB 2ZAGA 3D59A 1O89A 4MQUA 4OHPA 2ZT7A 2FYNC 4BVFA 5A9RA 3AY0A 2IUYA 3QQ5A 1JLSA 3DONA 1VQ1A 4FBMA 3TGUD 1NG9A 4ZOLB 1EK0A 1YE3A 2HKIA 1L0NJ 1G20E 4KWIA 4Q5IA 4A8JB 4FMBB 3ICQB 4R0NA 4INJA 5JNSA 1GNVA 2ZJYA 4EPRA 3JC22 1QSGA 3JALB 2O05A 2K87A 2FEOA 3EA5A 3EAFA 3H97A 3U37A 3L7OA 1KVUA 1XKLA 5DH9A 2II6A 3WUVA 2VJKA 4TWZA 4C0HA 2CJWB 4DLAA 4WGFA 3AO0B 4ZTUB 1J2JA 1NKZB 1F4LA 2QRNA 2N9YB 5CVVA 5A62A 1A82A 2PKYX 5FFMA 4H7IA 1G5PA 2PYZA 3KPYA 4BO5A 1YIJP 4D98A 5JXGA 3CO0S 4KXMA 4JUBA 5I7EA 5IF9A 3KKKA 1WG8A 1XTRA 4HQOA 4RD3A 1TK2A 1TTPB 2JLQA 2B7LA 4P3KA 5KDDA 3UM9A 2PKXA 1CHDA 3FRIA 1S9DA 5HZGA 4KP7A 1W75A 4DPMA 4D4HA 1I2AA 1H3FA 1JIXA 4EFNA 3NBFA 5ES3A 3EOZA 3L77A 2QOEA 5EJ8A 3VGPA 1FDSA 1H4SA 3R4VA 3RK2D 5HS6A 4LHSA 4PHGA 5ARDA 3NH9A 3IE2A 3EQZA 1ZK4A 5J2UB 2BDUA 3Q12A 4MKRA 3G4SP 4QAJA 5LDGA 1XRLA 2FUG6 3J80A 4ER0A 1FZTA 3BCCJ 1ONPA 4GX2A 2QE7A 2XCIA 1PGNA 4KYUA 1ES9A 3RUCA 4DNXA 2O8FB 2A3NA 3QVJA 4JC8A 2R5BA 1MP0A 1VCHA 2PYDA 4F11A 5LP6B 1KJJA 1XU7A 4JLJA 1PS8A 1Z12A 5DGXA 1E2MA 3HFSA 3SZLA 5J9FA 1VLQA 3WJ7A 4F91B 1VXRA 1C7QA 3EVNA 2WVJA 5DI3A 1I94B 2PYIA 2R86A 1M34B 3EWAA 4TMWA 2VPIA 1Y89A 4DG5A 3DDCA 1DFIA 1UPUA 2PZMA 1AGNA 4DW8A 4P84A 4DZTA 1R5BA 4Z1MA 3MGNA 4UFNA 1E6WA 5IG2A 1S1MA 4EQZA 1Z8NA 1DOAA 4B5KA 3QV1A 2OZEA 1YC5A 1D9XA 3I5UA 2QZJA 2NO7A 5FEUA 3S55A 3GA5A 2WU1A 4E2XA 5KOYA 1WV0A 1ODKA 4DB4A 4RK5A 1VKZA 4KTTE 5DYNA 1SQFA 2CV2A 2BF7A 5K0JA 2VEOA 4KMOA 1UR5A 2WWIA 3VPXA 4G89A 2B2XA 4NJOA 2X6TA 2CK3H 2WSCH 1T8PA 2QV7A 3O2SB 1EWRA 1SQBG 3VR2D 5I9LA 2XUHA 2XR1A 3TS1A 3TZHA 1M1YA 1WDLA 4G1VA 3UH0A 1E3EA 3FKSA 1DEKA 3DYIA 2MKVA 2REBA 1BVUA 1E89A 1IHUA 2C0CA 3Q88A 2ZSHA 3BXHA 4AQRD 2CWWA 4DA8A 1GD2E 3TBHA 1QYVA 1DUIA 1ESMA 3KQOA 2HCRA 2RFLA 4G2NA 1LWNA 2WHEA 2B78A 5T8KC 4CG1A 1JSXA 5J4HA 2CVPA 1P9RA 5KHLB 3GNLA 4OJYA 1BE3D 1SC9A 1UEIA 2KYRA 3RROA 3LBNA 3F3SA 4FYPA 5HUQA 5AVVB 3IP8A 4BVGA 2GPBA 4C7NB 1JMBA 3Q1MA 5JXIA 3BXXA 4NENA 4C9BA 4DBVO 2VPPA 2QRMA 4BNWA 1H4QA 1Z5PA 5BMVF 2WA1A 3GZTB 1BTOA 1SCNE 4JMLA 2DOKA 4OD0A 1QVZA 1VQPP 2J0UB 1KPIA 3VU8A 3I9LA 2R7NA 2H6EA 3HCBA 2AF3C 2D2IA 1UCFA 3ZIAA 3GN1A 3RLIA 3JCZA 1CZLA 2MYUA 4REQB 1YWGO 3DF9A 4HFNA 1J1EC 4RMJA 4QOFA 4WOPA 4JLSA 4NVRA 3ZGVA 1GPKA 3R23A 1OFTA 1NYQA 4PQEA 1SU4A 1OBFO 3ESXA 5LZ8A 3RUHA 4CMIA 3QBEA 5AW3A 5ITVA 1LTTC 4MA0A 5CFLA 4J4BA 1LTJA 2YZKA 3DFIA 4BDTA 2ZSFA 3NHWA 4GL2A 4JI2B 1Z15A 3IYLW 4J0QA 4IFIA 3BA1A 1E1NA 4S1TA 2CN1A 1DEHA 1E8MA 3GLMA 5HKBA 3ZWPA 2QJKB 2Y1CA 2B4QA 4RA9B 4ISBA 4FE4A 3PNPA 1ZXGA 4MNTA 3UBTA 2ET6A 4RJLA 1VLLA 3GFFA 3QPCA 2NAPA 1RBQA 5BN1A 1PFGA 2HUNA 4EHHA 1BCCG 1BGXT 2C2GA 3JARB 2O0JA 2JRCA 4JI7B 2JLAA 4X97A 4BNGA 4RXUA 3FPKA 2VP9A 1P5HA 3F9RA 3RVLA 4X3PA 4LVUA 5GIOE 4M0KA 2N9BA 5DTRA 4AJHA 2VRCD 1AUVA 2QL5A 4HDRB 1H6CA 2D2VA 1SCKA 1YL6A 3QWHA 2HMVA 3GGPA 3PUZA 4ACAA 4TWJA 2QQEA 1YZQA 1QHSA 1C1YA 1AKYA 2Q5LA 2IPAB 1ODIA 4QYWA 1ZCAA 4ANFA 4G5SA 1IN5A 4MPPA 2ZSKA 3A4VA 1WSBA 1RCTE 3Q9LA 2GPJA 5EIAA 4CDNA 1YRYE 2XWBF 4H13D 1TTHA 3PGXA 2ZIGA 3SIXA 2ZIXA 4HX9A 1RYYA 2V5VA 4IRUB 1A88A 4OLBA 1Y0BA 3D0OA 5EJ7A 3CL3D 1NYTA 4NYMR 1XF1A 4HGQA 5ESWA 2WSBA 2QPTA 4LC1A 2WNHA 3UMMA 2O2SA 1T9BA 1RWXA 1JCDA 4ATNA 3W8DA 3KU4A 1OBHA 4X7RA 4QREA 4Q4HA 3P2EA 3Q5GA 3HUSC 3EY9A 3B5EA 1XXHB 4J76A 4GPTA 3SKVA 4ARIA 2E48A 1TAQA 1R4AA 5IFLA 4QXQA 4FZ5A 1PJTA 4DDUA 2XNXA 4HGRA 5APQA 2F62A 2V74B 4WZZA 3H9BA 3WLIA 4BNDB 5JC8A 3VQTA 2I1QA 4P82A 4QXOA 1ZXXA 2OFOA 3ZGOA 3ICVA 2H5LA 4YP9A 4TVSA 3OPQA 4E32A 5FWXA 1KIMA 3V00A 4I08A 2QVBA 3OZRA 4H31A 2A78A 5H16A 3QUAA 4PAMA 2PH1A 4WAUA 1UK8A 1ZU4A 1Z6AA 5D2CA 4PQFA 3ZU6A 5HEKA 2GEKA 2WI8A 1DXHA 2VCYA 1QS0A 2PU7A 4X1IA 1DDGA 1PUXA 5KKZC 1CUEA 4KIUA 2ZWMA 3DZCA 1QGZA 3HMQA 5FL3A 1W4ZA 1EUDB 2WTAA 1LPNA 4TN5A 4H6VA 1MKMA 3PP8A 3T41A 1ECLA 1E18A 2O0LA 2I6GA 2KQUA 3G2PA 1CUWA 3JYPA 4Q9AA 5AK5A 1OI3A 5JTUA 1QIMA 1X7GA 2VOEA 1ECPA 2GF9A 3L2OB 5CEFA 4TZ0A 1R8YA 1HSOA 4WCFA 1UKZA 2ZQYA 3QFHA 2DFTA 4OKIA 4DF3A 4HNQA 4M1SA 1X86B 3CZCA 3QOFA 2XYVA 2SCUA 4S1WA 2OUKA 4FVTA 1IZ8A 2WOOA 2W0MA 4UDOA 4E2ZA 3U6BA 4EELA 1F8GA 1GNPA 5ALYA 4GFDA 4AVYA 4PLCA 3UXEA 5AI8A 3L0CA 2PX2A 4TZKA 4FNGA 3N8DA 3KKMA 2Z08A 5FL7D 4GVLA 1X1RA 1KARA 2VVTA 4HUQA 1RI1A 3K53A 4CW7A 3P9QA 3RLFA 1S4QA 2OCGA 5HCUA 2FW6A 2A9JA 1F7UA 3B9RA 1AU9A 1GUFA 4XD7A 4AULA 4M1QA 2VUHB 3M6MD 1Q95A 3OTOB 2ZUUA 2XUJA 3BIJA 3KXDA 1FZCC 2H51A 5HQ3B 1I7PA 2BMAA 1L0NK 3DEJA 2RJOA 4KR9A 3FAZA 3F49S 3I32A 1GTWA 1Q83A 3JZMA 5KB3A 4BXOA 3H4MA 1ZYUA 2JLYA 2Y0PA 1PSZA 3KJQA 3TW6A 3CXRA 1B41A 3L4BA 2BBWA 1D09A 3L71E 5ALWA 4AMYA 1NP3A 3Q0TA 3LDFA 3M2PA 2OGSA 4B81A 2QU7A 4ERXA 5JZOA 3BD6A 4AZ3B 2JJLA 2R96A 4G1CA 1NYHA 4Z4CA 1F2TB 3GL9A 2O3QA 2HA2A 2VZ0A 3WLAA 3WSTA 3NUGA 5I4BA 3MYYA 2AQHA 1FC2C 1XN4A 1R27A 2B87B 4FHGA 2IVFA 5A9SB 3P4UA 2J3KA 2D2CB 2CBXA 4LN1A 5KKNB 4GPD1 3QVTA 3KZXA 2E4XA 3DHNA 4EHDA 4IDOA 3DFZA 1BYIA 5LA6B 2XITA 4M1KA 2FPXA 3GD5A 1D6MA 5FUWA 2W83A 4XASA 3VYTB 3RTGA 1F0KA 3D7LA 2C5FA 1X2BA 4YRFA 4XH9B 1P9NA 1RKVA 1S1CX 1CYDA 1VRCA 5L3QB 3VZBA 4IH4A 5EIFA 1RXCA 4OYYA 3L18A 4X60A 1CUHA 1CX9B 3EZ9A 2QA4P 1CYEA 2VDMB 3SK0A 4ZJYA 3KP1A 2DPMA 4HLDA 4HRVA 1HDRA 2OTCA 1YJWP 3N28A 2PZGA 5I9IA 3B3GA 4IPTA 3NXSA 4X95A 3IBTA 1FF9A 1U1EA 1IDN1 5CVDA 1FX1A 821PA 4EKGA 2EFJA 2ECOA 4Q3AA 2G63A 2JANA 2EJCA 4MS3A 2XV5A 3X1YA 3EIWA 4YV2A 1OT3A 2FKWB 3QW4B 2YC2C 2B1RA 4MGEA 3ANSA 3QZUA 3N0VA 4MVJP 1S72P 1MZPA 2WG0A 2LVBA 3WYCA 1GADO 3R7AA 3FZEA 4YV1A 2HLNA 3GHGC 3NWPA 5CA0A 2SECE 2WFAA 2W00A 1C4OA 2P8JA 1V16B 4GS5A 3BXGA 1E8DA 3E9ZA 3ZHBA 4N5NA 3MT9A 2Z2KA 1COZA 5BYBA 1XHLA 5ICGA 3T9BA 3H87A 2R5DA 1GXSB 4WLFA 3NEPX 5SZHB 5GWXA 2V8OA 2IP2A 2P35A 4B4VA 2IUUA 4KZPA 2VN8A 3FPHA 1QIHA 2EL9A 4DSTA 3NHBA 3AEQA 5JAPA 4GX0A 5IK2D 2RD2A 3KR9A 3FD8A 4YQEA 4JA2A 3L71J 4O4LB 3E9DA 4UUNA 5AM4A 2HT6A 4MCAA 3T7SA 3HO8A 1HH4A 1L5HA 4OMFG 1JUNA 4DCPA 2ZRKA 1ZEMA 4G1UC 1L1QA 3IVCA 4G0QA 3EN0A 1EWQA 3TQCA 4OHMA 1QFSA 4QJIA 5BSMA 1SOWA 3FFTA 4RK1A 4GIFA 4NJMA 3DHVA 3QKSB 2DHCA 4NQZA 4Q4JB 1P2TA 4HXGA 3NETA 1VHJA 1JKJB 3RUAA 4MZXA 1N6LA 4Z4EA 2NXJA 2NZYA 1HMPA 3PE6A 3O1HB 2CEKA 5EP3A 1V9CA 3FLBA 1OLXB 1J00A 1KMHB 5KQLA 1DELA 2Q0XA 3UYKA 3A11A 2GZAA 2TMKA 4IS2A 3EA4A 5A4AA 3R7DA 1BQ4A 5EEHA 1JVSA 2MSKA 3A04A 4YDQA 3K09C 2C1ZA 2I2BA 3C6ZA 4HNUA 1JHXA 3KHUA 2ZT9B 2Y9ZA 1C2TA 1MPXA 4GI2A 1OZFA 1SFCD 2MSLA 2Y2VA 4PYKA 3O3MB 1V1MA 1S0UA 3ETLA 3T38A 4BE9A 5CITA 3PVCA 5HOQA 1B0AA 1Q12A 3ICPA 4I5DA 3CLTC 1N92A 1VCOA 1HF9A 2QF7A 2PJUA 5HFAA 4BUJA 3CUSA 3HN2A 1MORA 1X1SA 3HLTA 3QWOC 5EZYF 3CINA 2ZVQX 2C4TA 4WXPA 3EEYA 4L0MA 2W6IA 1VLHA 4AJ1A 1PBNA 4OX9B 1YCGA 3UFBA 3K5PA 1ZUIA 1LVUA 1WUKS 4GE0A 3K32A 3O6QA 2QSIA 2ONJA 4PHHA 2Y1DA 1WOMA 1B15A 1HDEA 2VHZA 2MU1A 3NVAA 3HKDA 1W2GA 4YRGA 2BFBA 3KM0A 3TB4A 4MJ7A 4AY4A 3B53X 1YOVB 4B3TB 3AR5A 4U1RA 3H1LE 3V46A 5CT5A 4Y6PA 1T8ZA 3EXFA 4LSMA 2CDRA 1KDPA 4NCIA 4ENWA 4EJSA 4AP6A 1JM0A 4D8VA 1JGTA 4JI3B 4JU8A 4H7PA 5I3ZA 4ZQGA 3IB3A 1VLZA 2XTMA 1YUBA 4HNSA 4P4LA 4E6EA 5LM3A 3H5IA 3F9IA 3ZV7A 4R6WA 1MU0A 4F2DA 1FZQA 3MBOA 1WKVA 5J4VA 5LOVA 1TADA 5TEVA 4D5EA 5J1SB 4ZHQA 3M1YA 4DCCA 1W1WA 2X22A 2X42A 1X3LA 1UIIA 1FRZA 1AV1A 1L8AA 1Q74A 4JP2A 4EVSA 4DR7B 1JQ3A 3GLUA 1HQDA 4GLLA 4DLLA 1IAVA 2PL1A 2KM1A 1N6IA 3W8RA 1RWOA 3M9WA 3I2KA 4M9QA 3TLXA 1SQ6A 3A3YA 2FWAA 3W3AA 3DE5X 2YMLA 1RQNA 1TM1E 1VBKA 3WLLA 5K6TA 4XWWA 1L3IA 1TMGE 2FXPA 3AE2C 2ERCA 2WJAA 3P5BA 5GY7A 4FYWA 1P1JA 1VECA 3MTIA 5E0KB 4H15A 3QIVA 4C3UA 1HJBA 3F4BA 5KNLA 3BWMA 5BY2A 1JB1A 3QOXA 2AJBA 5I7FA 5LUAA 3CURA 3C85A 5KDLA 1JJVA 2VLBA 5JWHA 2FPMA 3O1LA 3MUDC 4B5LA 3ZDYB 4O4IB 3H0EA 1L4YA 1PCXA 4P81A 2GXSA 3QVLA 4G97A 2W2KA 4UEKA 3TCNA 4DVGA 4RTLA 4PD4E 1BCCE 4KO8A 3U7EB 3U5TA 1I5OA 3GROA 3QVMA 3OUZA 2K6GA 1L0NG 4LBYA 1Z0FA 3TQOA 1ZD1A 2GBIA 1YJAA 3SJ7A 1PG5A 3NR2A 3HO6A 4QATA 5IAOA 3WDLA 2Q1YA 3N6XA 4C22A 1C8LA 5HK8A 3PXGA 2CCGA