2ZYGA

Apo-form of dimeric 6-phosphogluconate dehydrogenase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
466
structure length
466
Chain Sequence
b'KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 177
structure length 466
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zygA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zygA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zygA01
2FN7A 2Y68A 2YV3A 2NTJA 5T8KA 1UZNA 2POQX 4Q39A 1LDMA 3VPHA 1C0KA 1F14A 1HLPA 2J5RA 3DZKA 4J9UE 5A5FA 5B4TA 5F3RA 1V35A 3RC2A 3TL3A 2WD7B 1Y8QB 2I76A 4QECA 3MEQA 4QO8A 2TMGA 4NBTA 4HBGA 4RPGA 3NDIA 4IDEA 3ZWCA 2OZPA 2HLPA 2AXQA 3UW3A 3G79A 2DFVA 1H5QA 5BNIA 2P9GA 1XU9A 3OM9A 3GHYA 3HN7A 1MC4A 1YB1A 3S2FA 4BO0A 3S8MA 6LDHA 2O2YA 2VHYA 4U8GA 1Z45A 3HE3A 2HMWA 5TRTA 1HYEA 2FR8A 1P1FA 3KXDA 1MFPA 4TWRA 1GUFA 3VVCA 2I66A 4BNNA 4MINA 2C29D 4HUJA 4J7CA 5TX7A 4EYEA 3C1OA 1MGOA 4ND3A 1DFHA 1ID1A 4Y6SA 1LLQA 1YQDA 2QW8A 5K0ZA 1CETA 3JD1A 5A3VA 3VC7A 3ULKA 2J8ZA 1NHWA 1DFIA 4IINA 3M2PA 4I1IA 1AHIA 2Q1UA 1ISHA 4ALMA 4B4VA 4YYZA 1HDCA 3FNEA 4YTEA 2X0JA 1BG6A 1EUZA 3GNSA 4U7WA 3D3WA 4W82A 3RUAA 3D4OA 4JJGA 3ENNA 4CUKA 3ANNA 5JSFA 3MJEA 5JAMA 1KEVA 5AVOA 5JLAA 3CUKA 4CLXA 2NWQA 1JDJA 4RQTA 4TKLA 3WICA 4D42A 3SC6A 3L4BC 2EKQA 3F1KA 4J3FA 2Q45A 4R4JA 1I10A 4IUYA 3INTA 3TDKA 4WLEA 1P44A 3C1TA 3UOGA 1B15A 2IYOA 3OEWA 3O4RA 4IBOA 5JYDA 2GYYA 3MWDB 5A4DA 1DO8A 3H6KA 3QV1A 5JS6A 3H65A 4DLBA 4Y67A 1CYDA 4AJPA 5JDIC 4PLGA 3INRA 4IDFA 3D0OA 1HDGO 1T4BA 4YJGB 2RH8A 3ROMA 1X15A 1YBMA 1S7CA 5G0TA 3WS7A 5U1PA 4NR0A 5ENVA 4U5QA 1SMKA 4PLCA 1ISFA 5H82A 2AMFA 3RJ9A 2Q1TA 3PZRA 2AQ8A 3RU7A 4IIVA 3ZN2A 3FF4A 3G49A 1O94A 3KV3O 1DPGA 1TI7A 2CUKA 5CEJA 1LQUA 3L9WA 3MWEB 3D4PA 4E2ZA 1XU7A 3K8ZA 3F4LA 4W7HA 3VVBA 1CQIA 1HF3A 3FN4A 1WP4A 2FRDA 4IZIA 1N5DA 3ZWXA 1PR9A 2OORA 3OIGA 5L53A 4BO9A 3UGKA 5L95A 1BXGB 1B0AA 1KVRA 2J3JA 4LISA 4N5NA 4DREA 4HFJA 4II3A 3OIFA 3IUPA 1LU9A 3UCEA 3NT4A 4BS9A 1I5RA 3EW7A 4HNGA 5A9SA 5BSFA 3GK3A 5AXAA 4PLWA 1YDWA 2UUPA 1KERA 3AUUA 1HSZA 3CKYA 3L9XA 3QA9A 3ZDFA 1IOLA 3ZV6A 4M89A 1RYDA 1EK5A 3V2UA 3PRJA 5IF3A 4MDHA 5JBIA 1P0FA 1JKJA 4YWJA 4NFYA 2PK3A 1OAAA 3LLSA 1V3TA 1A7KA 5G4KB 4JXKA 3LU1A 4XJTA 3WGQA 3KTDA 1KC1A 3GDGA 3ZW8A 2OXIA 5KKCA 4CLRA 1ZH8A 5JDCA 3LT0A 1QG6A 1QLJA 1GQYA 3K5PA 4UVEA 4WJZA 3HG7A 4PZDA 2NM0A 2GZ2A 3I9KA 4TQGA 4DL9A 4RVFA 4Q3DA 4PG7A 1O8CA 1P74A 1U8FO 1LTHR 1RM0A 4WCDA 3W8EA 1KVSA 4L0QA 4R9SA 3HQ4O 1E1NA 5GZ6A 2OGUA 3UXYA 5A02A 2E4AA 3DZBA 3GY0A 3DOOA 4ND1A 3AY3A 1ISMA 1VC2A 2FZEA 1P1HA 3VAZA 1F17A 5CAEA 3PYXA 4J9VA 5G0VA 1I2ZA 1ZO8A 4PLFA 4EUHA 1NR1A 1GY8A 1WMBA 1J6UA 1P9LA 2GN9A 1I30A 4R16A 2AE2A 4HV4A 3HNPA 3VTFA 1I36A 1N2SA 4IDCA 3PIIA 3GLQA 4Y6RA 2BI7A 4NDNE 1GZ3A 4CM8B 3WJAA 4JX8A 1V8BA 4FSHA 4KDEA 3KEOA 4BQPA 2FSSA 3M6IA 1LDYA 5IN4A 1TXGA 2ZTVA 2Q1WA 3P5SA 3UKOA 1P77A 1H93A 1C0PA 5IXSA 3L6EA 3GUCA 2O4CA 1YOVA 1AXEA 2E49A 4MKRA 3EVNA 4LVCA 4NJMB 3ZNOA 1HTBA 1KEWA 3HDJA 2Q4BA 2PKQP 5EINA 4BO1A 4MIYA 5BT9A 3WMXA 5JC1A 2VTDA 4RVHA 4KZPA 3B1JA 3H5AA 4BNFA 2VZ0A 3QWHA 1OFGA 4J91A 1P1JA 4CQMD 4Z0PA 1UXGA 3DR3A 1HE5A 1WPQA 3GFBA 4XDYA 1OX3A 3C7AA 1PJCA 1TEHA 1LRKA 3TZQA 3BHMA 3LQFA 3PZBA 4NK4A 2DPHA 2CDBA 4R3WA 1N9GA 2WTBA 2W4QA 4HFRA 3IQDB 4NBWA 4L74A 3BMNB 3L4BA 2V6BA 3SBOA 3TZKA 3L6OO 3STHA 1EFLA 4W99A 2GERA 2QRJA 4RV9A 2V6MA 2WSBA 1YQXA 2HK8A 3R0IA 3WWYA 1AA0A 1GL3A 3FCOA 1SB8A 3I6QA 1DFGA 2Y0EA 1I2CA 1LA2A 4IMPA 2OO5A 3DHNA 4GMGA 4XA8A 2C07A 1ADBA 4J16A 4BKQA 1LSOA 4IPTA 3OIDA 5EL0A 3KBOA 4AJ1A 5JDIA 3SXPA 5A06A 3VZPA 3WNVA 5KOIA 4KTVE 4TSKA 7MDHA 1X7HA 4FS3A 3DO5A 4AJJA 4TZTA 2Y66A 3FPLA 5ER6A 2BLLA 3VH4A 1PZEA 3BTUA 2NQTA 2YV2A 1NPTO 5IXYA 3KEQA 4ZN6A 1YJ8A 4ONEA 1DC3A 3WBBA 3WGTA 2AW5A 5AQ1A 4OGWA 2CSUA 3N58A 4MP6A 4UEJA 5JMPA 1R66A 4JBHA 3U4HA 3EDMA 3PP8A 4E31A 1YDEA 4FC6A 1LDNA 4BNJA 1Q0QA 5JY1A 1NFRA 5JPIA 3RUIA 3LVFO 4I9UA 3O8QB 2IRWA 4Z0HO 1PX0A 1LLCA 4JROA 5HWSA 1E92A 3KM0A 2BELA 4ROSA 1P1RA 2WWRA 2NVBA 3GN1A 3JQGA 4RZIA 2FMUA 3QIVA 4B3IA 2PZLA 3O9ZA 3ONFA 4IDDA 4BHTA 1QYXA 1SCUA 2YUTA 3C24A 3WX0A 3H9EO 3EVTA 3GH3A 3Q2KA 3KLMX 4K6CA 4D3SA 1Z6ZA 3CPSA 1Y8RB 4DVJA 3Q2IA 1Q7CA 3DDNA 4ALIA 4TRJA 3H5NA 3WTBA 2GZ3A 1DIBA 2P9CA 3NYWA 2FSVA 5I8ZA 1XGKA 5AYVA 1LUAA 2PNFA 1ZK4A 3ROKA 1E1MA 1K0UA 4L8VA 1JAYA 2AEMA 2JAHA 3H5RA 5ENDA 3S1LA 3WIDA 4E4YA 4OL9A 3AU9A 1QYWA 2YW9A 5K9ZA 1ZJYA 3GZNB 3QHAA 2FPIA 3Q6IA 2YY7A 4Q9NA 2VNAA 3L07A 2O3RA 1WZIA 2HDHA 1OC4A 4UREA 2X6TA 2AG8A 1B26A 4LCEA 2AQIA 2C0CA 3PLRA 1OOEA 4WNIA 3VDQA 5JCXA 4GL4A 2E6UX 2EP5A 3PJEA 1W6UA 1X14A 4J4TA 5JFOA 1ZK0A 3DTYA 3QWIA 5BNFA 3WOHA 2EKLA 2VYNA 3F9IA 1O89A 5DF1A 1H94A 1N1GA 3FRJA 4KQWA 1ULUA 2BGKA 4CMIA 2VUTA 5G0UA 4TRMA 4WPGA 2GR9A 3F46A 3AUAA 1ZK1A 2VRCA 4OOFA 1J0XO 4ZICA 2DM6A 2EP7A 4J1QA 4CM4A 4KUEA 3ZHBA 1XSEA 4J0EA 2I3AA 4ZQBA 4L4SA 1PQWA 2O7QA 4WECA 4HXYA 2B4TO 3A1NA 2PH3A 1E3LA 3RKRA 4PVCA 4KP7A 1KIFA 1NVTA 3RBVA 3TPCA 4EZBA 1IPEA 1HT0A 2CDAA 2NTNA 4BIIA 3BHIA 4N5LA 1NQTA 2LDXA 1QXSA 3LF1A 4E21A 4FB5A 4BKUA 1E5QA 1R16A 4E5YA 1E6UA 3NEPX 1B8PA 1ADCA 2Y67A 3WG9A 4LVUA 4NIMA 4WE3A 4L75A 3GHHA 1C1DB 2PD6A 2WYVA 5JMWA 2O4UX 2WE7A 2WEKA 4J1NA 5DN9A 3I9NA 2PZJA 1XKQA 2WD8A 2X1HA 4ESOA 1MXHA 5KVQA 1PGJA 4LW8A 2C54A 1R0LA 3JQ8A 3LZ6A 1XR3A 3RQSA 1R4NB 2CVQA 3TQHA 4J2HA 3JCZA 4XR9A 4JBGA 4RDIA 3E5RA 1F0YA 5EN4A 4UULA 1E3JA 4BNIA 4CM7A 2F00A 1SOWA 4YT8A 1PL7A 4EEXA 1YB5A 1HDYA 1TT5B 2WE8A 3Q1LA 4YPOA 4IDBA 3GF4A 2B5WA 3IDSA 3JQCA 3KUXA 3BA1A 1VM6A 4A2CA 2YHIA 3JV7A 3DBLA 2NADA 1BXKA 3D7LA 3HUDA 3AFNA 2P68A 1F12A 5A3JA 2O23A 3OFSA 8LDHA 4HY3A 1ORRA 4WOJA 4RL6A 2C20A 3TJRA 1NNUA 3H4VA 2AG5A 4ZGWA 5EERA 1KETA 4Y8VA 3WB9A 2W2LA 3GEGA 1D4FA 1JA9A 3BMQA 1B14A 1R4MB 2HMUA 1EBUA 3FNGA 1Q1NA 4YJHA 1H6CA 3JQ7A 4EGFA 4DWVA 1CRWG 2D4AA 4XQCA 1B8UA 2LDBA 7ADHA 3GMDA 4XYMA 1M67A 1R0SA 2DBRA 1LXCA 3ZWMA 3D1LA 5JY6A 4B3HA 5L7WA 5IZ4A 3OJEA 4CMGA 4GAEA 3KSUA 2I67A 3HB4X 3EK2A 3U09A 1S6YA 2A94A 5JNLA 2H9IA 4IS2A 2E37A 2V6FA 4EDFA 4IY1A 2I3GA 3F5SA 5U9CA 3KVOA 3ZW9A 4CQMA 2FPPA 5LDHA 2DBVO 1DIAA 1X7DA 2UV8A 1MG0A 3EYWA 4NI5A 4CR6A 4E2WA 4AG3A 1XIVA 2BFPA 1EEHA 4Q3EA 4Q3BA 1ZEMA 4U6QA 4YAEA 4BMNA 1W4ZA 4ZU3A 4XB2A 2Q1SA 1G6KA 5JW6A 3UUWA 1GDHA 3B6ZA 4AJIA 1UXJA 2Y99A 3CMMA 4EJ6A 3GNQA 1PQPA 4CLHA 2P4HX 1ENYA 1GAEO 1VJTA 3ON5A 2IZZA 3JQEA 2XPCA 2I99A 3GRPA 4L4XA 1NM5A 4D45A 3CMCO 2AEFA 1QP8A 2A9FA 3ZWYA 1T1RA 4OSPA 3RSHA 3AK4A 4BO6A 2W8ZA 1UP7A 2DQ4A 1KEPA 4P4LA 5COBA 5TC4A 1M6HA 4YEDA 3VH3A 3OF2A 1E7RA 3QLJA 3JQFC 3GG2A 1HLDA 3FI9A 3GC6A 3DZHA 3ZU3A 5JXWA 3K9QO 5LDGA 5I7SA 1EDZA 3BXXA 3FNHA 3GAFA 4UUPA 3BTOA 3WQQA 2C2YA 3UAGA 2O50A 1Y81A 4YB8A 2CVZA 4N7RA 4HP8A 4INAA 4KUGA 5AXDA 3OHSX 4GSKA 1J4AA 2G0TA 1ADFA 1N7HA 1XWFA 3BMCA 2EJWA 3TZ6A 3DZFA 4RQUA 3LT1A 1K6XA 4R69A 4PLZA 3WNQA 4YCAA 3IAHA 4MKXA 1JN0A 1AE1A 4BNWA 1SAYA 3A4VA 2Q50A 3GGGA 3PWKA 4PG6A 3WTCA 4FFOA 4CL8A 3QP9A 2AHRA 2DFDA 4DIOA 2BHLA 4AJOA 3O38A 1XCBA 2DKNA 1HDOA 1PL8A 4O6VA 1XHLA 3X2EA 1PGPA 3HHPA 4BO4A 3N7UA 4QTZA 4B3JA 1X1EA 1MUUA 4YT4A 5CG1A 3WXBA 1VKNA 3E1KA 1V3VA 1ZUD1 3MTJA 3GGOA 3VHRA 3TL2A 1RPNA 3JD3A 1ZNQO 3H9UA 3QY9A 1B16A 1NAYA 4E13A 2CVOA 3PFFA 3WGYA 4D0RA 1K6JA 3W8DA 2ZYDA 3G17A 4ZQHA 2BI8A 1OC2A 3I1JA 5DP2A 4CMHA 1KC3A 3DBHB 4YRBA 2B36A 1E6EA 2Y1EA 4FJ0A 3JQAA 4GLLA 1LC3A 1KVQA 4JGBA 1AN9A 3PHGA 3PGJA 2DTXA 4ZQGA 1V6AA 3GAZA 5T64A 1IY8A 1FDUA 3HZZA 3TWOA 1GQQA 3QW2A 4HFNA 3DXFA 2JHFA 1GYRA 3CINA 1E7WA 5FI3A 3RUEA 5I8WA 1R12A 1VJ1A 4A5OA 4RPJA 2Z1MA 5DCWA 1ZSVA 1NFFA 1ZXBA 5T5QA 4C4OA 1EE2A 2Y93A 4DC1A 1U4SA 4AJ4A 4FQ8A 3ZV3A 1ENPA 1DLJA 3E82A 1R6DA 2EG9A 3ZWBA 2FZWA 4Z0TA 1U3WA 2ZJ0A 1Z74A 3U0BA 2DAPA 4CUJA 1C3VA 4I08A 5EESA 4ND5A 1U7TA 4UEKA 1Z7BA 1ZCJA 4LGVA 2V65A 4EEZA 2J5QA 2BFMA 2GO1A 4GBJA 1UXKA 3MJ4A 3OJLA 3TN7A 3RWBA 2VHXA 3TOXA 1H9BA 2BFOA 2ZB8A 4B7UA 5F21A 4M55A 4IQGA 2SCUA 4PIVA 3WGZA 2ZQZA 1B2LA 3FPCA 4HFMA 1NR7A 3HWRA 1JVBA 2HJRA 3NJ8A 1YL7A 3VZQA 3WR5A 2OP0A 1JQBA 4CM5A 3DBRA 2C82A 1DC4A 1P0CA 2C59A 4AJHA 1TVEA 4XYBA 4BQRA 2PGJA 4FGWA 5G4LA 1UP6A 1RWBA 3S2EA 4CLDA 1RM4A 1NASA 2O2SA 4UUMA 5H81A 4EUFA 3TZHA 3WFIA 4CQLA 2O3UA 1NAIA 1JLLA 3B20A 4ZQEA 2DVMA 1ONNA 4JLWA 2EERA 1HYHA 1A72A 3FBTA 3INGA 3CZRA 5KVCA 2Q99A 5JC8A 1HETA 1XDWA 3QWBA 4XCVA 4WEOA 3ANMA 1D1SA 1O9BA 3LK7A 3OA2A 4ZRNA 5KVSA 1FDTA 1I3LA 2NUAA 3ZWOA 4MPDA 4L4RA 3A9WA 4G65A 2XAAA 3R6DA 3PTZA 3WYCA 1UDCA 4AICA 4R1NA 1E7QA 3KYCB 3GEMA 2DTEA 4R1SA 1W0CA 1SNYA 4OKNA 5IFLA 2IZ0A 4GMFA 1GV0A 5TGDA 1NFQA 4E5MA 4R01A 1PS8A 1WVGA 4Q3CA 5H83A 3ZHYA 4J6FA 4PLPA 5C7IO 3B70A 4R51A 2NSDA 4RF4A 3DBVO 4XGNA 3JQFA 3W6UA 4BOYA 2O7SA 5HS4A 4FCCA 2JD2A 2VYND 3RFVA 2YDXA 3W4KA 3T4EA 1NTOA 1NXQA 4MIEA 1MC5A 4R5HA 3HDHA 2GCGA 1LSSA 4RVUA 3JQ9A 1R15A 3GR6A 1T24A 4IJVA 1GUZA 4W9NA 4J1SA 2VRCD 2VWHA 3JD2A 4RLHA 4UVDA 2DT5A 2Q3EA 4XD2A 3ZNQA 1U3VA 2H5LA 2Y1FA 2X0IA 1VPDA 4ZHSA 4PG8A 3M2TA 4KOAA 3TZCA 1CJCA 4M54A 4DQUA 5HA5A 3AI1A 3I9MA 4MIOA 4CL3A 2X58A 3PXXA 5ES3A 3D64A 1ZXLA 5I9NA 5L4SA 4BVAA 4XIYA 3MCVA 4BGEA 4XGIA 3KSZO 1HWYA 1AXGA 5CDYA 3JQDA 1X0VA 5AXBA 2YHUA 4GH5A 3VPSA 4K1LA 1KBZA 2Y1OA 4FJ1A 4PLTA 2OP1A 2NVUA 3K73O 2OOSA 4KMSA 5I7EA 4BO8A 5KCZA 1PL6A 4AJKA 1E7SA 3GVXA 2R00C 9LDBA 5F1OA 3MJCA 4E0BA 1U7HA 1DJNA 4NNJA 3QVXA 4OXKA 1MX3A 1NWHA 3BZUA 2O3JA 3DL2A 1BVUA 2UVDA 3JYPA 4K26A 3SJUA 4BO5A 1O6ZA 2Q2WA 3IKVA 1GUYA 2GPTA 4WGGA 1I32A 2NVWA 4J0FA 4A03A 1EE9A 1H6DA 1DDOA 2D2IA 4YJGA 4BGIA 3P19A 1XELA 5B4UA 3TSCA 3D4NA 3LLVA 2QYTA 3FWNA 3V1UA 3ANLA 3WSVA 1F06A 4J1TA 5B4VA 1LC0A 3U5TA 3D5QA 2D5CA 3OQ1A 4IJKA 4QO7A 1QV6A 4JCOA 4E32A 3T7CA 3RKUA 2JAPA 1O95A 3GRKA 3W4JA 4FJ2A 1XEAA 4IDGA 4G81A 5IAAA 4BB5A 2GLXA 4YR9A 4QUKA 3VPXA 3I3OA 1Z7EA 2W2LD 4CJXA 5L7YA 2HK9A 1PZGA 4GGPA 1CF2O 2C2XA 1T2CA 3GVCA 4JN6B 2GNAA 1FK8A 1UH5A 4JIGA 1BXGA 3PJGA 1I01A 1ZBQA 4E5KA 4RGBA 1DRWA 3ZV4A 4WLUA 4MKZA 1BMDA 4I5EA 1PWZA 2QRLA 1L1FA 4JJIA 1E3SA 2WDZA 4OQZA 1EZ4A 2C5EA 3WIEA 3KO8A 3LC1O 5A9TA 1JWAB 1UP4A 3OH8A 3PDUA 2D1YA 4WCFC 3BTSA 4GX5A 4H16A 1P1KA 1PZFA 1OBFO 5CDSA 4D3DA 4YQZA 1CDOA 1PR3A 4MVJI 5G4KA 3DQPA 2DTDA 3ADPA 5DP1A 3KLPX 4PG4A 4UUNA 5EQFA 4E30A 1WZEA 1E3WB 1MV8A 1X1TA 3ETDA 2O3SA 4XX0A 3H2ZA 2YYYA 2P2SA 3FSRA 5B37A 4DBZA 4LSMA 1T1SA 1LEHA 1Y9AA 4ZD6A 1CQJA 3DZJA 2PGDA 2BD0A 2PZMA 3VZRA 2G5CA 3HSKA 4ND2A 5CPFA 3JQGB 3ZWPA 1DBVO 3I4CA 2RH4A 1LX6A 1WAMA 3NTRA 3GQVA 3RASA 5KJCA 3WGIA 1T2EA 1HDXA 1AVYA 2B5VA 4JQCA 3ICCA 1GCUA 3DHEA 1U8XX 2I65A 4B4WA 4BNHA 4XYGA 1D1TA 2QRKA 3KZVA 2YJZA 3Q11A 2DLDA 4XQGA 3I4FA 2UUOA 4E6PA 4E5PA 1VE9A 3FR7A 4CM8A 3ORFA 4OIMA 2J3IA 2VN8A 4RJTA 3AUTA 3BTVA 1T26A 1SO8A 1GYPA 3GZ4A 5CDGA 1N7GA 5ICMA 5THKA 2F1KA 5TT1A 1IPFA 2DBQA 4XRGA 1Y9EA 2DU8A 1SOVA 2H63A 1KVTA 3VZSA 3EY4A 4U6SA 2EV9A 3IKTA 4GX1A 5F5NA 3LT2A 5A05A 1LBEA 3V5NA 4ALNA 1K3TA 3AM4A 4GVLA 4GQAA 5KIAA 3QSGA 2AQHA 3G1UA 3AJRA 1GV1A 5TNXA 4AFNA 2BGLA 2O48X 4PZEA 1HDZA 3VH1A 3WLFA 2VRBA 3U3XA 3VPGA 4CM9D 4DA9A 4UUOA 3C3XA 1YONA 3ZNNA 5JCJD 2X9VA 4HNHA 1QR6A 4CM4B 2FR1A 2VQ3A 1CERA 3GA0A 3UCFA 4CM3A 3LF2A 3BMNA 3VOSA 3O03A 4BV9A 4XR4A 2ZKLA 4GVXA 4CMEC 1ARZA 3EUWA 3RD5A 1A4IA 5L4NA 1M2WA 2R00A 2R2GA 4PVDA 2HMSA 2WYUA 1I33A 1SC6A 1H9AA 3OMLA 2NU6A 4FIZA 1A9YA 1JW9B 2A92A 4NHEA 3JQAD 4Y9DA 3QVSA 2OFPA 2X9NA 3IMFA 2ZK7A 5EQDA 4DBVO 2FWMX 3HFGA 3WYEA 3H3JA 1EQ2A 1DRUA 2RHCA 2JD0A 3HDYA 3AOGA 2VYVD 4OMUA 4BGUA 3JD4A 4ID9A 4NPCA 1BW9B 3E8XA 1VJ0A 4YJDA 1QYVA 1LDBA 3QVTA 3E9NA 1BSVA 3M1AA 1NQ5A 3LC2O 5C3MA 3A06A 5MGBA 1T25A 1ZEJA 3AM5A 5IDXA 4TRRA 3JQ8B 3RUDA 5TS3A 5I7VA 4TZKA 2EJVA 1W73A 4L73A 4IQ0A 3VPFA 3DMTC 4NZ9A 2BH9A 4A27A 2HRZA 3JSAA 4BKRA 4YAKA 3WMWA 4FDAA 1J49A 4OKIA 5KKAA 4B4UA 4RPKA 3ZWNA 1UXHA 1V3UA 3O8QA 4XIJA 3GVIA 3RJ5A 4BNGA 2Y1DA 2VT2A 3M1LA 4YAGA 1L7DA 3G3EA 5COAA 4CV3A 2DC1A 2ZQYA 4CV1A 2Q46A 4E33A 2PFGA 4O63O 4CR8A 5C7LO 5FWNA 2P9EA 1Y8RA 2EWMA 3RAJA 4D7AA 1I24A 4ALJA 4WCFA 1E7YA 3BMQB 3E03A 4M49A 1PZHA 1T4DA 4DLLA 5ER9A 2PZKA 2Q49A 5THQA 4K6FA 5ITWA 1ISIA 4YJHB 2A4KA 3JQ7B 3U4IA 3WGGA 3H9GA 1SEPA 1UZLA 2ZCUA 2AQKA 1V9LA 4P8RA 4PRKA 5ICSA 2BRUA 3RIHA 1PTJA 4IXTA 4J2OA 5DBIA 1VRWA 3TOZA 3GFGA 1GTMA 3FNFA 3GZNA 5IG2A 1EDOA 2HCTA 4AJNA 3PI7A 3PGXA 4OO3A 4CM1A 5CDTA 1DC5A 2R6JA 4IGEA 1ZSYA 1BWSA 2OBYA 5ILGA 4BO3A 1IB6A 2VZ8A 3RI3A 4YQYA 4QX6A 4YJFB 4PN3A 4JJFA 5BSHA 4CQMB 4YA6A 2NU8A 1H2BA 1IHXA 4UEOA 4CLEA 4CV0A 3MOIA 4GX2A 3PYLA 5B1YA 1VL0A 1MA0A 1RJWA 4ND4A 1LDEA 1GU7A 1GPJA 3KYDB 5T67A 1DHRA 1HRDA 3I6IA 4ZVVA 1K6IA 4K9DA 4YBZA 3GDFA 3PQFA 4XB1A 1FDWA 3RU9A 2J6IA 5DBGA 3RUHA 3ADOA 3DAFA 3B1KA 4Y98A 4XQ9A 3ROPA 4C7KA 4QQRA 1NP3A 3K2EA 4CV2A 3ONEA 3S55A 4HKTA 4Z9YA 2D8AA 1IUKA 1C0LA 2FR0A 4AJLA 1WWKA 2G17A 3SX2A 2JD1A 3EHEA 1ONPA 1LI4A 3R3JA 1O0SA 3ZV5A 5L4LA 4OAQA 3L4SO 2PA3A 4D79A 4FN4A 1IL0A 1VL6A 1H2HA 3G0OA 4PRLA 4DMMA 3UFXA 2EGGA 3DAPA 3KB6A 1UJMA 1WLYA 4IMRA 5T6BA 4BNKA 1ZZEA 2Q4EA 3WGOA 4Z9XA 3C1AA 4G2NA 2G82A 3SEFA 5FFFA 3Q0EA 1XA0A 2B35A 4MOWA 3UICA 4NFSA 1EUDA 1KY4A 1GR0A 2EW8A 2JL1A 3DWFA 3NDJA 4H3VA 3WYBA 1U2GA 1U9JA 4P38A 2QX7A 1YH3A 4YAIA 2JFGA 4RORA 3I52A 3O26A 3BMCB 5JO0A 4A73A 1ZMTA 1C1XB 1PGOA 3R1IA 5DOVA 4R1UA 3UCXA 1LRLA 2VHZA 5BSGA 5EIOA 2W2KA 5F1PA 4JBIA 3ZU2A 1PJTA 1SZJG 1Z75A 3L6DA 2ILTA 3BMOA 1PS0A 1R4NA 3DC2A 4CMEA 5C37A 4DMLA 1C14A 4GPD1 3QE3A 1YQGA 1E6WA 4BV8A 3F47A 4NU5A 5IZCC 4ZJUA 2IZ1A 3ZU4A 4PZCA 1LRJA 4IGFA 3NT5A 2E48A 1LJ8A 4FFMA 1TT5A 4GKVA 1GYQA 4HX5A 4RVDA 1PJ2A 3A28A 5TJHA 4CLOB 4WLVA 4R3NA 1K2WA 2OMEA 3PJDA 3HJAA 2C7VA 5CPBA 3KYBA 1C0IA 4JP2A 3JQ6A 1HDRA 3GNTA 3F4BA 1N8KA 3HFSA 5JAZA 1OMOA 3V1YA 3AOEA 1WDKA 4MVJM 2WMDA 2VT3A 5U4QA 2I9PA 4I9NA 3ICPA 1A71A 2EXXA 1GFSA 5JE8A 3GVPA 1M6WA 4DQXA 1DEHA 3DMYA 5DNAA 3PDJA 3C8MA 2VHVA 1R4MA 5TT0A 3PWZA 3JYNA 4NH4A 2VWQA 3WLEA 2X5KO 1M75A 5HRUA 5A9RA 2IXAA 4CM6A 3JQ9C 1DC6A 4II2A 2GN8A 1HKUA 2PD3A 5IDWA 1ZVMA 3DMTA 4MP8A 4W9NC 4R68A 1XQ6A 5MDHA 2GZ1A 2QIOA 4EITA 5G2OA 1DSSG 5KVVA 1VSVA 4WK6A 1KEUA 2ZB3A 4LN1A 1B8VA 1EVIA 2GF2A 2AEJA 3NV9A 3ROQA 1L7EA 4J43A 1PGQA 4CM9A 4RCVA 5TF4A 5CEFA 2CZCA 4KDFA 1WDMA 2J5KA 3V8BA 3RC1A 3UH1A 5JCJA 4J7XA 1YBVA 1UXIA 3F6YA 3L0DA 3H9QA 3NUGA 4WKGA 1ZK3A 3DEYX 4WNCA 2VZ9A 4ZRMA 3R3SA 1E77A 2UAGA 4ILKA 2IE0A 2ZB7A 1VI2A 3DAGA 4PFJA 1HE4A 2Y05A 2YFHA 3LC7O 4ITUA 2PV7A 3GG9A 4BUCA 3EMKA 4DUPA 5L45A 4YDRA 3CSDA 4QXMA 5TIIA 2CMDA 4JP3A 4CMCA 4RZHA 4EJ0A 4MVJH 2X7HA 1ML3A 3G1TA 2BKAA 2BGMA 4O5OA 3DBRB 4FFPA 4Z3DA 1YWGO 4GI2A 2UDPA 2VYVA 4NJOA 3ZWWA 2OHXA 4EW6A 1NWCA 1PGNA 4N5MA 4J4BA 3OA0A 3PLNA 4WLNA 2Z95A 4CMKA 4J90A 4DLAA 2YQ4A 4MP3A 3D3WB 2HKIA 3T4XA 4F6CA 3NAQA 2DUUA 2CY0A 3E9MA 5JAIA 2ZTLA 1P1IA 3Q9NA 4E5NA 5C5IA 2VNSA 3ONDA 4LRSB 3MZ0A 4IXWA 4GSLA 4I9HA 4YACA 4LSWA 3UHAA 2AA3A 5ADHA 2NACA 2X5OA 5TSDA 2NV6A 4XYLA 1YVEI 1NPYA 5KNLA 1SEVA 3JTMA 2C7GA 3TF5A 4FD3A 3D3EA 4HWKA 4FPXA 3HADA 5L3ZA 1OI7A 3MJTA 2ZYGA 1FXSA 5I7FA 4IZHA 3V2GA 4TMFA 3FTNA 3OJ0A 3GPDG 4IDAA 1DHTA 1QV7A 4W7IA 3S2IA 4RDHA 2NU9A 3QVOA 4XDZA 5TQVA 2D5AA 4RLSA 2TMDA 5J23A 3PHLA 4YRDA 1ENZA 1K5HA 3SVTA 1E1KA 4XKJA 3EGOA 1FMCA 1V0JA 4BNMA 1YRLA 1PJQA 4MVJD 1DXYA 1JWBB 2UYYA 4DC0A 4IJWA 4M87A 5COQA 1E0DA 1CEQA 2B4QA 3GEDA 3RUFA 1U5AA 3DBHA 2X4GA 3LYLA 4NBVA 3I9OA 9LDTA 2P4QA 2RIRA 5ITVA 1ENOA 1HXHA 1GADO 3ZI0A 4TROA 2FOIA 4BNTA 5IZCA 1IYZA 2HUNA 5FF9A 1W8DA 5DCYA 3GUYA 5AOVA 3UVEA 3NKLA 3ZHZA 2Y0DA 4XZ3A 3WQSB 4GKBA 4CUZA 3OEYA 1IE3A 1UAYA 2A35A 3MTGA 5A9SB 5JAQA 1RKXA 2QQ5A 2WD7A 1Y8QA 3BHJA 3HN2A 2QHXA 4ALKA 1I8TA 3GDOA 3MOGA 2NVUB 1IULA 4RF2A 5I9LA 4OOEA 2WJPA 3UN1A 3LSYA 2ET6A 4QEDA 4GWKA 4S1VA 4TVOA 3LDHA 3WSWA 1X0XA 1YS4A 1I3KA 1NQOA 4CLRB 3L77A 1WW8A 1Z73A 4FBGA 2D59A 1NX6A 2EIHA 4NFHA 2PKQO 4D41A 2ZYAA 3ITKA 1B3RA 4W4TA 1GQ2A 6ADHA 3FR8A 3DOCA 5FEUA 3ZHXA 3QWFA 3FHLA 4DIFA 1YKFA 1JTVA 1SB9A 4QT0A 1Q0HA 2GRAA 1U3TA 1OZAA 4PGFA 1ULSA 4DPKA 2JFFA 3GOHA 1ZMOA 3NGLA 3P7MA 2CD9A 5DT9A 1QKIA 3BAZA 1ISGA 3OSUA 3ETEA 2CFCA 3DFZA 3QQPA 1Y5RA 4XRRA 4GWGA 1EFKA 3U4CA 1PJBA 4D43A 2EEZA 4HADA 5BR7A 3I23A 2V7PA 4EI2A 3TFQA 1BVRA 4I5GA 1WDLA 3PQDA 3NTQA 1IZ9A 1DAPA 1JAXA 4EBFA 5GY7A 4UAGA 1IZ0A 1JKFA 3V2HA 3KRTA 3NJ4A 3AWDA 3KYCA 1UAGA 2Y0CA 2PKRA 2G76A 3Q9UA 2RHRA 2IXBA 1XLTA 4BNYA 1YOVB 1UDAA 4LCJA 2VWPA 3EC7A 4BL5A 3FTPA 1G0NA 4X54A 5KJEA 2PLAA 2FP4A 2JFHA 3VKVA 1A5ZA 1RM3A 3K92A 4Q3NA 4BO7A 5AXCA 5KJFA 3FD8A 1ONOA 1TT7A 2HK7A 4OXNA 1E5LA 1A7AA 5CP8A 4B7CA 3WQRA 5HS6A 3RC9A 1DB3A 3IC5A 3JD0A 4A10A 3PFWO 4Y6PA 2PH5A 2RBEA 1VKOA 4DPMA 5FI5A 2RCYA 2AE1A 3OQBA 1Q7BA 1CWUA 1N9GB 4OJNA 3E6AA 5A5EA 5DDIP 4M1QA 3ST7A 2HU2A 3WJ7A 3PIDA 3DONA 4K28A 1YGYA 3P2OA 3DOJA 3AY6A 1EUCA 4LRTB 1NQAO 2OBNA 4FFNA 2VUSA 3K6JA 4DTIA 2H6EA 3C85A 2XXBA 4ALLA 4YRAA 4CMBA 2GDZA 2OL4A 2BFAA 4WOKA 4B4OA 1DIGA 1MP0A 4CR7A 1QORA 5A1TA 4F3YA 5C7OO 1NVMB 4DQVA 1E3EA 4P22A 3ZCXA 5L51A 3MJSA 4PCVA 3CZMA 1H6BA 3GMSA 4IIUA 3RROA 3T7EA 3X2FA 3GGPA 3AU8A 1YE3A 4NK5A 4NMHA 4FFRA 3H3FA 3RCBA 2VHWA 3CTVA 1EMDA 1NBOA 2JCVA 3RFTA 3NX4A 1D7OA 3RBZA 3PWSA 1T2FA 4XJSA 1KYQA 4OHUA 4URFA 3HDQA 3ZU5A 1YL5A 4IS3A 4U0JA 3AY7A 1ZFNA 3ENKA 1AHHA 5IN5A 3CTMA 1PS9A 3ITDA 1O5IA 3WDSA 3IS3A 1N1EA 3OJOA 1HL3A 2NU7A 3OQ6A 5DZSA 4MO2A 2B69A 4WASA 4FR5A 8ADHA 2B37A 1B7GO 4OM8A 2CDCA 4A0SA 4Z6KA 2WM3A 4MVJF 5CEEA 1UUFA 3I5MA 1NHGA 5KJ6A 1DJQA 5L9AA 2ZTMA 5GMOA 1U3UA 4F45A 5IJZA 3BYZA 3RBXA 4N54A 3ABIA 3PHIA 5HM8A 1EBFA 1ZKMA 5KJ1A 3COSA 4UVHA 1Y7TA 3E18A 4EUEA 1TA4A 5CG2A 1P45A 1M66A 1QYCA 3VDRA 4XQEA 1G1AA 1PJLA 4R9RA 5DULA 4YAJA 3W4IA 1QMGA 2Y1CA 1PJSA 3DTTA 3PPIA 4XWYA 2P5UA 1YB4A 3AW9A 3PEFA 5L7TA 2EHDA 4TVBA 4KWIA 4O1MA 2B83A 3B1FA 2NTVA 4CPDA 3I9JA 1LSJA 5F1KA 4S3MA 4MVJP 4NJMA 4R5MA 5KWEA 1EVYA 4BNXA 1ZIDA 5EJ2A 4M8SA 1T2AA 1J5PA 4BMSA 3AFMA 5BQFA 4AJEA 1LNQA 3KOUA 1FDVA 2HSDA 3OECA 4O59O 1IHYA 4MVJA 5JYEA 3ZH2A 3CH6A 5GZ1A 1ZW1A 2RAFA 3HB5X 1NYTA 3PJFA 4OQYA 4CMIB 5TLSA 3JQBC 3SC4A 1A9ZA 1U5CA 1E3WA 1SPXA 1R0KA 3N74A 3PQEA 4RVGA 1X13A 3ZWAA 4DGSA 4FC7A 3W6ZA 3DZGA 4A26A 5KTKA 1AGNA 2Q2VA 4M86A 3OETA 2HJSA 3OBBA 3RC7A 1YXMA 4JNKA 1F8GA 3TRIA 3NTOA 4PLHA 4KTTE 4Z9FA 4KQXA 4GX0A 4I5FA 1BXZA 5ILOA 4NQZA 2ZIZA 1HZJA 2GN4A 1DIRA 1PEDA 1BRMA 5IDYA 3E9QA 1PJ3A 3IP1A 3JYOA 1M76A 4I8XA 3DHYA 4IJUA 4WCFB 1WNTA 1GEEA 4BO2A 5K6AC 3E48A 1P31A 3NGXA 4QSMA 2YDYA 3AOEC 4FOSA 4IQ8A 2IYPA 5DCUA 3U4DA 5CDUA 5A04A 1U4OA 4E12A 2ZJ1A 5B12A 3ASUA 1G0OA 1TB4A 3DB2A 2JJYA 1UZMA 4KWHA 5T57A 2PY6A 1NAHA 3Q3CA 3CXRA 1GD1O 4A7PA 3DFUA 5L40A 3SJ7A 4NBRA 2EF1A 4LMPA 1BDBA 4DYVA 4UVGA 2EKPA 1XQ1A 2XOXA 4WLOA 1YBAA 2IEDA 2QZ9A 3OJFA 1GCOA 5F5LA 5JO9A 4YXFA 2E82A 2YQ5A 4RVSA 2YHIB 1Q2XA 2IODA 3DBLB 3E5MA 4RF3A 5FYDA 1A4UA 1PQUA 2EGHA 3K31A 1DAOA 1XG5A 4RPHA 2FY8A 1HSOA 1JU9A 1U1IA 1ZSNA 2X5JO 3IJRA 1MLDA 2HRBA 1PWXA 2IDZA 2X23A 4J7UA 2PWZA 2GSDA 2VCYA 4AVYA 1X7GA 1MFZA 3K96A 1FDSA 1QLHA 2X86A 1KS9A 1RM5A 3GT0A 3KHUA 4Q3AA 4YVFA 2DUWA 3NT2A 4B79A 4E2YA 3IJPA 5LCXA 3C7CB 3EZLA 3EZYA 4LMRA 4WEQA 3CE6A 2HQ1A 3SLGA 1SBYA 1HEUA 1A27A 2X22A 2PTGA 1ZJZA 4DIBA 4Z3KA 3GPIA 4BNLA 4IM7A 1Y1PA 2VOJA 2PGLA 4DYDA 1PIWA 3ZNPA 2I6TA 4CMAA 3U9LA 1LLUA 4GGOA 3I83A 3TFOA 4ZQFA 2ZB4A 4MVJE 1BDMA 4DRYA 4D0SA 3W8FA 1EK6A 2GN6A 2OUIA 4E3ZA 4YT2A 4O0LA 4BNVA 1MB4A 1HE2A 3WWZA 5CFZA 4R1TA 3WFJA 2Q2QA 1BW9A 4BB6A 1LLDA 3W1VA 1PSDA 2IEBA 1I0ZA 1ADGA 3WBFA 1KVUA 4J4HA 1U2DA 1PU2A 3ASVA 2W2KB 4PLVA 4FW8A 1CIVA 1EQUA 2J3HA 2O3QA 3BMOB 2V6GA 5BNTA 4L76A 4AL4A 2B4RO 1MXFA 1YL6A 4BMVA 1BTOA 2GUGA 1YJQA 3U62A 4DXHA 1UDBA 2H1SA 5T8KC 3QWAA 4PLYA 4FOOA 3KETA 1LQTA 1YO6A 4F46A 1R37A 1I3MA 1BHSA 1FF9A 1E1LA 1DOHA 3H7AA 2HO5A 1NVGA 3CEAA 3QJ5A 4R41A 5HBRA 3FBGA 3OICA 4RO0A 1GZ6A 2NQ8A 2VWGA 3OP4A 1U28A 3PHHA 3PYMA 1N92A 4YT5A 1RYEA 4L9RA 1DLIA 1P3DA 2PR2A 4XGKA 1QRRA 3ZWVA 1H6AA 1Q7GA 4TRNA 1KOLA 4OYRA 3K30A 2NNLD 3GVHA 3NDRA 2JHGA 3AM3A 2W90A 1ZK2A 3K2BA 4E2XA 1C1DA 3D5TA 4CODB 2VTEA 2JCYA 3JQBA 4AJ2A 2GASA 3QRWA 3RVDA 4CMJA 4F6LA 2BF7A 4R54A 4FGSA 2GGSA 2X9GA 3EAGA 2VUUA 3A14A 4OH1A 1D8AA 5EPOA 2YZ7A 4TKMA 5HTOA 2DBZA 3AI3A 4P4NA 4P4GA 3F5QA 3RFXA 4BGVA 1PJ4A 1KY5A 2ZCVA 3MJVA 1QSGA 4G5HA 2QYSA 1NPDA 1DIHA 2CNBA 4YJFA 2XF8A 1EVZA 1K89A 2D0IA 2J3KA 4BNZA 3LT4A 1ISJA 4W6ZA 2PD4A 3UF0A 3VTZA 4I5DA 3VKUA 3KYDA 1WXDA 2CF6A 3IL2A 3VH2A 1H0KA 1UR5A 2Y1GA 3H8VA 1I2BA 2X0NA 3AI2A 5K6AA 1MG5A 2DPGA 2BMAA 3FWZA 2D3TA 2YV1A 3AUSA 1GPDG 3U49A 2O3TA 2XXJA 5G0SA 3S2GA 1VLLA 4NG5A 4MJLA 1Y6JA 2CF5A 2G1UA 1HYGA 3JYLA 5DBFA 3V1TC 3IOYA 1BGVA 1AUPA 4H15A 3JQAB 4OXYA 1WMAA 3NRCA 2WYWA 3ZGYA 3P2YA 5EMHA 4FFLA 5BSEA 4H7PA 3IUSA 1I3NA 4XYEA 2HMVA 3CIFA 3IP3A 1D3AA 1JVSA 2FHSA 2X8LA 4B7XA 3BIOA 2GD1O 4U0KA 3F3SA 1B3BA 4B8WA 2QG4A 1GEGA 5I9MA 2EW2A 2ZTUA 3JYQA 2FPGA 3PVZA 3H9JA 3QVWA 2YFQA 5LC1A 1LSUA 4JK3A 1T2DA 4NBUA 4BKOA 4N18A 4OSOA 3ZZNA 2C5AA 1GZ4A 1E7MA 2B0JA 2I5PO 3KSDO 1C1XA 3F1LA 3IIEA 3RUCA 4KUHA 4BNUA 1VL8A 4C7JA 3I9LA 4GLOA 2P5YA 1Y5MA 1F8FA 3SLKA 4DPLA 4B8ZA 5A03A 4WLFA 5GZ3A 4D3FA 5G0WA 1TLTA 4UVIA 2JKVA 2QZZA 2HMTA 4CLOA 5TJ9A 1LDGA 1VSUA 5CHEA 3GN2A 1Q0LA 4D46A 1EVJA 2P91A 3TNLA 2VOEA 2Z5LA 4QFCA 3DZIA 4LK3A 2W98A 4WUVA 4ZA2A 5DOZA 5IDQA 2ZATA 4RPLA 4XEHA 4EJMA 4PG5A 3H2SA 3PHJA 3PK0A 3C7DB 4BKPA 4CQLB 1E3IA 4NU6A 2JCXA 2HAEA 5JDCC 1QYDA 1Z82A 4RF5A 1JKIA 1XYGA 3ETGA 1HE3A 1HZZA 4QFDA 2Z1NA 2NLOA 4J49A 4D44A 1P33A 2X0RA 1DRVA 4MVJG 1FJHA 3WGHA
chains in the Genus database with same CATH superfamily
3DUFA 2JVJA 1N4DA 1U5BB 2I76A 3OHPA 2TMGA 3DXYA 3HWWA 3AHDA 5FKJA 1NE7A 2AG1A 4L8FA 3IBCA 2O2YA 5AK6A 2H54A 1LI5A 1FY2A 4ZDWA 1XJ5A 4P0PB 1K7EB 1YK0A 4UQLA 4NDAA 1SQQE 4MS3A 1TEZA 1RP1A 4RZQA 3SPXA 1P80A 1XTTA 2OLJA 2A1TR 3KC2A 5EPEA 4W82A 5F3WB 5JSFA 2QXUA 4RKUJ 1KEVA 1X1AA 3SX4A 4D42A 1RKVA 2PUGA 2VO1A 3B3AA 3HMQA 4AF7A 1SQVG 4ZALA 4DCPA 2JF0A 3BICA 1VLHA 3V34A 4IBOA 5AOCA 3U31A 4RC9A 3T61A 1DUIA 2WKWA 3PXDA 3D0OA 1HDGO 1S1MA 4EUKA 2IBMA 1S7CA 4DUGD 1YAJA 1NBMA 1CULC 1LPSA 1SMKA 3AEKA 1UKZA 1VJGA 5EZYF 1F51E 1IQPA 4H31A 3K6KA 1FLVA 1PT8A 3VJKA 1XZEA 3OIGA 1I6KA 3R3XA 1JYFA 4UBKA 1N3LA 1LJUA 4LISA 4MEAA 1N2JA 3OIFA 5B30A 2IYNA 1LU9A 1QGZA 3AUKA 2ISCA 3F97A 2WU1A 4BQIA 3NAGA 2PX5A 1QH1B 2HK6A 4FI3F 1EK5A 4UM7A 5KC8A 3AFOA 4LHSA 4NEGA 4JXKA 5EZYA 4CLRA 4CEJA 4WJZA 1N3BA 3OOJA 3DMPA 3EFBA 1T8WA 3NWJA 1Z36A 1CHNA 1E4VA 2CXPA 4R05A 1J1EC 1G4HA 3QUCA 4INOA 2E4AA 3GY0A 2JAWA 3PYXA 3KAJA 1RSZA 1I30A 2C31A 1BFDA 3VU9B 4X8OA 1BFUA 2BI7A 1N2XA 3OOYA 5C35A 4QULA 2NZUG 2WV9A 4EFNA 2ODAA 2PTHA 1MR3F 3UM9A 2XMZA 3FGZA 1N2GA 4WZBE 1CJMA 2VAXA 4RADA 4X65B 1BCCG 4IZ6A 2QR3A 5AICA 4QG3A 3GB9A 2QVGA 3M33A 2BGNA 4LBVA 5CX1B 1X1RA 3DE4X 3A6ZA 2I34A 1LTTC 3SZMA 3T7KA 1KEKA 2HK8A 1N32B 2QY6A 4L50A 4KVGA 3KYIB 4Y7DA 1YU6A 1L5VA 1RU3A 4XA8A 2OK7A 4BKQA 2RIPA 2W5UA 2XUPA 3AKDA 1M2FA 2LUOA 1RXEA 3EEOA 4U2BA 2H43A 2OVBA 4K0KB 1FJGB 2YMPA 1IM2A 1V1RB 5DTQA 5H4HA 3HBMA 3H5TA 1QO7A 4LRYA 3RUIA 3GJ6A 2WQ6A 1LLCA 4JROA 5IKEA 3BIFA 3TKYA 3P9RA 2I7XA 4C14A 1XZ8A 1M34A 4MCHA 4TRJA 1P84E 4KNWA 5KHAA 2YR0A 1LUAA 2X0DA 1IBCA 3S1LA 4U7JA 5D00A 1X1BA 4ZO8A 5DNEA 2QTGA 1K8XB 5CMLA 4GL4A 4RJJA 5TQ0A 1X14A 1TD1A 4A0RA 1VDFA 2O2CA 4MCJA 1HM5A 1NVEA 4TS4A 3CB2A 2P35A 3A0HE 4ASWA 3FNQA 1QAMA 3OBIA 4F1JA 2WILA 5G0UA 4TSRA 1C4XA 2DM6A 2OKCA 3KT0A 4ZQBA 1L5YA 3F98A 2ZLBA 1DP4A 4EZBA 2PH7A 4L3VA 5UKDA 1IEVA 2LDXA 3N87A 4AYWA 4K9OA 1K9SA 4GBED 2I4RA 1LK5A 2OBBA 1YOBA 3KPUA 4MRMA 1ODKA 4QTYA 4MQEA 1VRVA 1PGJA 4KACA 3NM6B 1KYOE 2R6DA 3RQSA 3CW9A 4TWAA 4EFDA 3TBHA 3SIRA 2WWIA 3FWHA 3JQCA 4NCAA 1IU9A 3D7LA 2IYTA 3I61A 2FI1A 4YCLA 1XC7A 3KU4A 2OC4A 4C1BA 3LLCA 3GEIA 4F71A 5HIIA 4WI1A 1VJDA 1DBIA 4YJHA 3CX6A 4R2XA 2ZDHA 1K05A 1LXCA 4WKCA 5D3ZA 5IZ4A 4CMGA 2VXBA 3DE3X 4QELA 3HVKA 3K72B 3HB4X 1S6YA 2P5SA 3DJYA 2BKLA 2BCCE 2QW0X 2A3RA 5H3CA 4IL5A 2JEZA 2RHTA 3TLGB 4A8JB 5ANRB 5K3SA 5C8XA 1G6KA 2J31A 4BRUA 5FL3A 2Y99A 4KK3A 5FT9A 5LOVF 1ENYA 4BVKA 2IZZA 1X79B 2DLNA 2A9FA 5KS2A 1TD9A 3FCAA 2G71A 3HH8A 1Y9ZA 1T91A 2IYUA 3ZBPA 1E66A 5JXWA 2RGCA 1KO4A 4CKEB 3AL2A 4INAA 1N7HA 1I6MA 2PLFA 1P9WA 2EJWA 2XUGA 2XTJA 4GXRA 4YCAA 2BDUA 3GFSA 1AE1A 3HYLA 3Q8KA 2JEEA 5LOVA 3A4VA 3BWVA 4CL8A 1P84D 1XCBA 3TW6A 3G5LA 3HO1A 1MH9A 3UT6A 2E85A 2P9TA 1NU1D 3TL2A 3RJTA 4ITRC 5CIWA 1AZWA 4FVTA 2CVOA 1M7HA 4MUNA 3PSHA 4DKJA 1AO0A 3CNOA 3W8DA 4BUJA 2HF2A 4PSVA 3PUKA 3DBHB 4HG2A 3HZRA 4ZQGA 4HFNA 2OM6A 1P2BA 4AW9A 4K2AA 2HL6A 4OVNF 2F59A 4NZNA 1FZEA 2Q3JA 5J3JA 4BKMA 1THMA 3LHKA 4WB4A 4WXHA 3V97A 2VHXA 3TOXA 3P9KA 3ITNA 4PIVA 4H1HA 3G8AA 2I4NA 4JLJA 3NJ8A 1I4EB 4NICA 1WVMA 3KPWA 4CNQA 2RKLA 2GYWA 2XNDA 1WPXA 1Y6GA 1TZBA 3DCJA 3TLEA 5JXHA 1ONNA 4R1OA 3TW0A 4XCVA 1GA1A 3DMDA 1MQ8B 1D1SA 3MTQA 2RK6A 3NIGB 5IFLA 1VPWA 1RZRD 1PS8A 3G7UA 3RTEA 3UPDA 4ER5A 3DKVA 3ZWDA 1EM8B 3X0DA 2R6FA 1MC5A 4QPCA 4RVUA 3JQ9A 3L79A 1DNPA 1V45E 1GUZA 3RC8A 3JD2A 3V3KA 1M72A 2IYSA 4NOKA 1EXIA 2IPXA 4BGEA 1AS3A 4UTRA 5D6OA 3LX6A 1OGYA 5I01A 2WP8J 2KM1A 1DJNA 3KB2A 5AESA 4MQBA 1GUYA 2GPTA 4WGGA 1EXWA 3JU3A 2GWHA 3S70A 5I7WA 3QFRA 2ZYWX 1M6EX 2VNJA 3FFAA 4OBXA 1H2XA 1NQWA 2AZTA 3GVCA 2VJQA 1BXGA 4DSNA 1G5IA 1PWZA 4LF5B 3K32A 1DKUA 1GLNA 2OGWA 3AR5A 3LC1O 3NVAA 5E3JA 1QFMA 3CN7A 5APWA 2PYZA 1L2TA 1TJYA 2DOKA 8MHTA 2AUNA 4B5KA 4RIGA 3IEKA 4NOLA 3MWYW 1KPIA 1PWEA 4D6YA 1L9KA 3HBLA 5A3QA 4GRAA 3M0EA 2FDXA 3V48A 3KWLA 2B5VA 4JQCA 1QVZA 1U8XX 2EBUA 1VB5A 1FBMA 3URMA 1IUOA 4JOCA 4XVQA 2J58A 4NU8X 2LWIA 1E96A 1ABFA 4QJ3A 3RH0A 3AUTA 1IPFA 3PUXA 4XRGA 3COYA 1Y9EA 5HDBB 2H63A 1FZCA 4WAUA 4U2GA 1JHAA 5CT8A 4P86A 2YV5A 2P3LA 2VZEA 3S2UA 3P9SA 3LT2A 1XHEA 2XA9A 1JPJA 1G42A 4TTPA 4HAOA 3O92A 4L7VA 1Z4IA 4H13D 2IFMA 2OCYC 3OA7A 4OHXA 2MYPA 2VQ3A 1NYRA 4BV9A 2X0FA 3RD5A 5K0EA 2GEVA 2ERCA 2YY5A 2WYUA 5HF6A 1XD2A 2D2XA 2M1ZA 4M1EA 1SXQA 5CLHA 2YOHA 4MWDA 3TNYA 2IHJA 2X2OA 1M10A 4HGOA 1KAQA 3HK2A 1CJKC 5CT9A 4FNMA 2R1ZA 3AF0A 2OV2A 3V8QA 2SBTA 1J99A 1POXA 1TQDA 3O8QA 1R8XA 1KZGB 4EL5A 3TDNA 4H13C 2ZQYA 1QQ7A 1Y3FE 2GA8A 2JPDA 3RSGA 4MLPA 3OAKA 1I24A 1J06A 2JFOA 3DQQA 2ECQA 2FPOA 2PUFA 4GXQA 1CI6B 2YMKA 3RL0D 4JLVA 2A4KA 1OREA 2AQKA 3IQGX 4I1OA 3I12A 3FMFA 1PP9E 4BZWA 1GNSA 4HH0A 5REQB 4IGEA 4BIMA 1XTGB 5LQCA 4C7OB 4R1PA 2WNIA 4ZJYA 2C5HA 4CV0A 1E2DA 1RJWA 1GPJA 4DG8A 4ARVA 3FKJA 4K9DA 4EAAA 3QKUA 4HGYA 3K2EA 4MRNA 2KLBA 4KO3S 3HRKA 1H0SA 2RHOA 4C29A 5ALOA 5DT2A 2W2NA 3C3AA 2MMGA 4RK5A 2W6JD 2DULA 1AGXA 4IWXA 5JZMA 3UFXA 3H75A 3N2YA 4EG8A 3EIEA 1RKUA 1HT2E 1KY4A 2FPGB 3NDJA 4GZ5A 3CV3A 3EGIA 5JO0A 1ZMTA 3F9RA 3DNMA 5DOVA 3N2NA 3EF3A 4L08A 1YR7A 3SM3A 1UPFA 3TE6A 3I09A 5B53A 1E6WA 3O3CA 2IZ1A 1SVSA 2O01N 5TJHA 1Z0FA 4D8VA 2FYNB 3KYBA 1U3GA 2BH2A 3GEEA 2BZSA 3JVEA 5JALA 5EHNA 2WG2A 1WDKA 5KCMA 1O4VA 1UJ6A 4N8EA 1P9OA 1P5HA 5E9JA 4XGQA 1FYVA 3MUEA 2WUEA 4IIGA 4XWKA 2WHQA 1NU6A 4UMDA 1IIRA 3U4GA 3ZU6A 2CJWA 5G2OA 2QROA 4C6RA 4HH4A 4LJKA 5TGZA 1ZH0A 2QEXP 4C4TA 3LUPA 2P2ZA 1IG0A 4KE6A 1CRQA 3TO5A 3K5HA 4G3XA 4DW8A 2ZBEA 1XPRA 2H5IA 1IAVA 2WMOB 5L45A 2IF0A 4DUPA 1ZL0A 3UQZA 4CGYA 4YDRA 1UWVA 5TIIA 1CUAA 1XROA 1RC8A 4Q02A 1PJZA 4I7ZC 3FCYA 4CMKA 2BEUA 3T4XA 1RXVA 4IL6H 3ONDA 5EXTA 1MAHA 2JFPA 2YX1A 2I4LA 4FPXA 3LW5J 1SKMA 2RBKA 4Z9AA 4NC9A 5L8VA 5JXGA 4YRDA 3L8FA 3G2OA 4TWJA 1V0JA 2XNHA 4J76A 2UYYA 3WMEA 3QE2A 3NIFB 2BR5A 4P7GA 3ZOZA 4UNRA 1FL9A 2P4QA 1BEUB 4JYMA 4KXQA 1NVAA 5ITVA 1JHRA 2HC9A 1MFTA 4XUEA 1W8DA 4INZA 3RQIA 3ZHZA 1FUKA 3R5FA 2A35A 1W5FA 1ZS9A 1ZM3A 3A6EA 5CCHC 4NL4H 4PZPA 5A1JA 1IULA 3O2QB 2ZB2A 3OF5A 3PE6A 3SQDA 3BXOA 3B38A 1XRPA 4TVOA 1BH2A 3CZ9A 4RENA 2WWGA 3QVLA 1VHLA 6ADHA 3KQQA 3SJZA 2RHLA 1V6CA 4DIFA 1SCKA 3AVUA 2P6OA 3KU1A 1TPYA 2FEKA 4O4JF 3NCHA 1SHLA 3KE8A 2AL7A 4ZDKA 1FFXB 2EEZA 5AJZA 1B4DA 4MKGA 5BR7A 1KAMA 4NG4A 4OXIA 3KXLA 1JAXA 4HDOB 2NUBA 5L3SB 1IY9A 1NBHA 3DZDA 2R48A 4MUGA 1P84I 4YUVA 4BNYA 4KRXA 3B8EA 1A5ZA 5KJFA 5AXCA 4YAOA 1TT7A 3LQQA 3THRA 3WB1A 2XUDA 2ZEJA 3ZHSA 4KRGA 1XMXA 2PH5A 3FPGA 4O4JA 2EFDB 3OQBA 3CZAA 5FWYA 3EVZA 3AE8C 5U4XA 2ZUVA 5HK9A 1VDZA 3FB4A 3IVMA 1LJ2A 1SVIA 5AM0A 1YYCA 1QB7A 4B6FA 2BJVA 2QPTA 1K7XB 4JBWA 5ISMA 4QGBA 5AI4A 4EFMA 4X66B 3RFTA 2H2WA 1CP3A 2XT0A 2PZGA 4FGLA 4XPIB 2Z2KA 3UKDA 2ZAOA 3PDCA 2WSFJ 2NZ2A 4Y6LA 1O5IA 4EQ6A 1LTSC 5ALGA 5JI3E 1N1EA 2NU7A 2V98A 1KYOI 4D9EA 1EQ7A 4MVJF 1VKZA 2J3MA 3T3PB 3BGIA 1XEXA 5L9AA 3PR3A 1GGHA 2HLOA 5G53C 1OWNA 1YZVA 3E18A 1P45A 4YAJA 4HYTB 4C7XA 3MIWA 2EHDA 4DA8A 4U7HA 4MUBA 4KR0A 4B6QA 3FVWA 3ICQB 2JFWA 1LVUA 4QUHA 1XCPA 3M4JA 2BFWA 4F0JA 2ODQA 1WZ2A 3C6KA 4MVJA 2RAFA 1FMTA 3A7EA 3E7FA 3NKVA 1WB6A 3GDHA 2QSJA 4RELA 1SHKA 3AEAC 3VZCA 1YCDA 4H6PA 3TLBA 3WDKA 1T4MA 3OBBA 2FUKA 1NJSA 1EDKA 1WXHA 1GSOA 3YASA 3EQZA 1MKYA 4GX0A 2NO1A 1SUWA 3JYOA 1I2DA 4QSMA 4PNHA 1YB7A 5A04A 2K2WA 4D96A 4EKGA 4KPUA 2V3WA 2FMIA 1AQUA 1KI9A 1VJRA 5G1NA 4HZGA 2VPIA 1ZM2A 2WVRA 2HO4A 4CU2A 3NTVA 3W2GA 1GCOA 2D4HA 5DFAA 1XG5A 4Q4HA 1JU9A 2X5JO 1F1JA 5DMXA 1FQWA 5BRJA 3KHUA 3GPLA 3PFKA 1MC8A 3MJHA 3D7NA 3HJNA 2N9YB 2I6TA 1OW3B 3L1UA 4ME6A 1NN0A 1MB4A 2H52A 3RB8A 3RVPA 3W06A 5CFZA 3ZDDA 1JPNA 4WOBA 1URQA 2C00A 3EZFA 1W46A 4DA0A 3LY8A 5EXSA 2B5OA 1EQUA 4R9VA 4TPKA 4CPGA 3L72J 4G26A 1YO6A 3OLVA 4BLUA 3H7AA 2HO5A 4HMOA 5L3VA 1RMYA 2XCIA 1TKCA 4F3KA 4L9RA 1OJ7A 2J0UA 1W4AA 4NV3A 3CEJA 3GVHA 1C9NA 1U9CA 4X0EA 3D5TA 4CODB 4ON9A 3PGVA 3AVYA 4F6LA 1U7DA 4NECA 5LMUB 4TKMA 3RU2A 2XF8A 5GWXA 3R74A 1NTKK 2YFYA 2WNSA 4OHBA 2O8BB 3E8MA 2P9YA 3VH2A 1H0KA 3HE4A 1G4AE 4MUKA 1P84H 1T8TA 1G6OA 1N6IA 4N1AA 5INTA 1GPDG 1R00A 3WU2E 5LJIA 4MGEA 3UMGA 4PGGA 3T52A 4H15A 1F60A 1GPMA 1OY1A 4H7PA 2OYIB 4TLMB 4I4NA 1K6EA 2X8LA 5FBQB 4L51A 5I9MA 3WRXA 5C53B 1AKNA 1T3SA 3A0HH 1FIUA 4X94A 1JH9A 3K0AB 2VQFB 2B0JA 3IIEA 3RYIA 1C30A 3VKFA 3IKJA 1Z0SA 4CLOA 4GUAA 4YPCA 1N25A 4R83A 2P91A 3A6LA 2ACVA 4QFCA 3KQUA 1Z4KA 3CMAP 1CZHA 1GUDA 2X76A 3PHJA 5ALEA 1ZL2A 1BGYE 2XV5A 3ICWA 4DR4B 3ETGA 1HZZA 4GP7A 1A9QA 2NLOA 3R9XB 3BH0A 2YIJA 3ETHA 5T8KA 4TT3A 1JTHB 1QHHB 3MGAA 1VIVA 4C01A 3KHSA 4DMGA 3UIEA 1PQ4A 5EMMA 2G4CA 1FSSA 5L6LB 2JGMA 1CIPA 6LDHA 2DUNA 2HMWA 4N3YB 3NHUA 4KSYA 2CLOB 5K0NA 1J7JA 1HL7A 3C1OA 3GYGA 3SDBA 3D4BA 3WI7A 4PZAA 3N07A 2PZAA 1UC9A 2RHDA 4U3FG 5GADl 4EGAA 1FP1D 1WTAA 3FG9A 2GBCA 4O5AA 3DYVA 4IHJF 1BU5A 3ANNA 3NEYA 1JDJA 3RT9A 4J3FA 4Q15A 3W0LB 2KB0A 3T5PA 2YWXA 5A4DA 3IP5A 3HP4A 4PYQA 4BXOB 2ZDQA 4BP9A 3TQCA 2Z6QA 5G0TA 1DX4A 5U1PA 4AIIA 3TLXA 1SM4A 1YS9A 3TJMA 3C3YA 4IHJA 5SYMA 3PZRA 3RU7A 3G49A 3S29A 2H4XA 1N2CA 3CVVA 4IGKA 2NZ8A 3OZ7A 1H2WA 3FUVA 1PR9A 3IOMA 1B0AA 3EQ9A 3RS5A 3T5DA 4I1RA 4OQNA 4D02A 3LVQE 1PJAA 4Q1AA 3L9XA 3W6OA 3HD7A 4NJEA 1OLOA 3USES 3ZDXB 2A88A 1R88A 2ONYA 1ZH8A 5KTRA 4XX0B 2GZ2A 4QIHA 1ZN5A 4Q1BA 4JI2B 2BSXA 1RM0A 2WUWE 1OVUA 1DKNA 3DZBA 1P1HA 2G1AA 2C3YA 2I6GA 1JEKA 5CW2A 2QW1A 4JLSA 1OYWA 2YKPA 1L1RA 4EB8A 1NXSA 1N2SA 2F1IA 3WJAA 4JX8A 1XZLA 2DQZA 1VA4A 4UEWA 2CV0A 3K1YA 1V8OA 3NANA 1H93A 4WY8A 3WGLA 3OKAA 2GA9A 4LVCA 1BGYD 3RS9A 2ZJ6A 4PIMA 1VHDA 5JYBA 1V8DA 3M06A 5HX7A 4AK9A 2P67A 4HQNA 2BUBA 4FE7A 4LGDE 3A1TA 3TIXB 1K73Q 1M5RA 1PBNA 5KVAA 3L6OO 3KOWA 2GERA 4QT4A 5K51A 1CYEA 4XLZA 1I4OA 1U0JA 3LL7A 1CUIA 1LA2A 3HYTA 2CXRA 1ADBA 2EBHX 1DG1G 1ZIXA 4HEJA 4HNRA 2H7HA 1S3SA 2OCBA 3CCQP 2OZEA 3L7DA 2NQTA 1UOEA 2TMYA 1JA0A 2AW5A 4YGYA 1AS0A 4C0XA 2PFSA 5HFNA 1K3FA 4C3OB 3GJ5A 1Q0QA 3IO5A 3OZAA 4LOAA 4I9UA 2C0XA 1BCSB 2BELA 3ND8A 4NPFX 3JQGA 1L4FA 1P0IA 4B3IA 5K7SA 3EVTA 4D3SA 1Z6ZA 3BD7A 3C3BA 4DVJA 1NC3A 4C89A 1VLMA 2QL9A 3J81k 5LQSA 1CNMA 4PZLA 3R4YA 3G0BA 4I5IA 6YASA 5KTPA 4E4YA 3AU9A 1DKPA 2O1EA 5CR9A 3I28A 3NBYC 1Y89A 1KQ3A 1FUUA 3DDCA 4RE6A 2WG0A 2AG8A 3LXXA 3ZXYA 4V38A 1YKGA 1JHXA 2PRSA 2W6IA 1IOWA 2CPBA 3KKEA 4PYLA 3F7TA 4RWEA 2MHCA 3U7QA 4KMOA 4CMIA 3UK6A 2VUTA 5FPYA 4TRMA 3F46A 1ZK1A 1J0XO 1JDUA 4ZICA 4W1RA 1AQ6A 5BPFA 4L4SA 3MS4A 5IT5A 1C0EA 4B3SB 1NULA 1UIMA 3A11A 4N5LA 1AVTA 2RGGA 5D6NA 3ILYA 3TOVA 4RY2A 3EGXA 4OA8A 3TGWA 3VSDA 4Q4JB 1F8UA 2XGOA 3BASA 4IOLA 4ARUA 2C4HA 2WEKA 3EWAA 1GXSA 3FCSB 4EK9A 2F1OA 2VP6A 4GPZA 1MXHA 4LW8A 1RAIA 3CB4A 2A59A 4NMLA 3VAAA 2FQXA 3ZD6A 1N9KA 2HGZA 1M34E 2DQYA 1ORVA 1TT5B 3Q1LA 2XQKA 4KDCA 5AP9A 2IDKA 1U0TA 3DL7A 2GXQA 1NBMD 1HUQA 3VO8A 5GV8A 1CPYA 4QJIA 3ROXA 3ZGNA 1A4XA 2NV2B 3OPQA 4F3RA 2FZVA 1OVGA 7ADHA 4ZXFA 3KLNA 4N48A 1YT5A 3MCZA 4G5QA 5C4GB 4IY1A 3A6GA 3F5SA 4M9ZA 4GMKA 5CT6A 2XB2A 3E9ZA 1XTQA 2G80A 4JQ0D 5FTNA 4Q12A 4V0OA 4HVAA 4GZMA 1HA3A 1GDHA 3B6ZA 1YZFA 2HDNB 3UGQA 2XPCA 3BDAA 4L4XA 2C97A 3U3JA 4EA7A 4V1CA 2O1WA 4YP9A 2CZGA 2DHCA 4KQ1A 1WXGA 3K9QO 1EDZA 3H19A 4Y2UA 5CIYA 4X5OA 1P7CA 3N7NA 1JG2A 3DO6A 1ZAKA 3LT1A 3GXBA 1SAYA 2A86A 4YRFA 2Q9BA 1TVKB 2WZBA 3X1KA 1Y3HA 3TRHA 5FQOA 3RVNA 3GGOA 4MYDA 3VDXA 5FUXA 1RQXA 4GRDA 2J33A 2AF4C 2BI8A 5DJUB 1OBOA 3U9SA 1LC3A 1KVQA 4PZ0A 1YC2A 3CNHA 1K9VF 4HNVA 3CINA 1CY6A 4HDRA 1VJ1A 1A5BB 1WCYA 1E9AA 4G1EB 4J3NA 1D2RA 3T5MA 3TTXA 4ZZ2A 3EFHA 4Z0TA 3GU3A 3TGUD 4WKBA 2X0KA 1HJ0A 3SBEA 4EEZA 4GBJA 2QZPA 1F7VA 1LWUB 2WWWA 1RJ9A 1KZ7B 3C87A 3CUUA 3VZQA 4MPJA 3TXXA 1UP6A 1KEZA 4CLDA 2C03A 1NASA 3ICVA 4UUMA 5LQUA 4KPGA 3TLCA 3KVRA 2E4VA 2I2FA 1MO6A 4ZIRB 5EIBD 2C9ZA 4K8RB 1N8TA 3TNDA 3GEMA 4R1SA 2NSJA 3ZV7A 1GV0A 3BK2A 3V00A 1LTJB 1W88A 4RH1A 4F4CA 1NVDA 3AYZB 5HUQA 3EHDA 5AQEA 3S1AA 4BOYA 1DO0A 4HDAA 2H2AA 1T6AA 2CLKB 5J2UF 4EM6A 3T4EA 3PEWA 1TJPB 1KI6A 3R3WA 2HHJA 2MSNA 1Y5NA 3HY6A 4REQA 2I55A 3WL7A 5AIAA 3HLTA 4F4DA 3I42A 3UK1A 1N8NA 1V47A 4XGIA 2XWQA 1X0VA 1C8KA 1FAVA 4PLTA 4WESB 3CZ4A 2JLQA 2OOSA 4KMSA 5J2UA 5EIBC 2EIXA 3FVQA 3VRHA 5FR2A 1KQGA 2O3JA 1QKKA 3MWDA 2Q2WA 4GRIA 3IKVA 4TWIA 2C2ZA 2P90A 2EKZA 4MA0A 1Q16A 3TQQA 3V1UA 4KH0A 1F06A 4IOKA 2XE6A 1QV6A 4GM4A 1JPVA 3I4LA 2QS9A 1REQA 4C3VA 4G81A 1IY1A 4QUKA 1G8PA 2Q5IA 1AV7A 3QLUC 3ETCA 3N1UA 2OSBA 3LUCA 2B8JA 1DC7A 2GK6A 1J07A 1GCIA 1EM6A 1AKYA 4D6TE 2PZBA 1GVNB 1N73A 1OBFO 2BJHA 4PZ9A 2DTDA 2XYPA 3HO8A 2RHJA 4FP9A 1BS1A 2LKDA 4BZXA 4DBZA 3DEIA 4MQLA 5LMCA 3ICOA 3Q3JB 3I4CA 1MO2A 3SQNA 1SFCA 4XYGA 3DW1X 3JAMA 3BL6A 2JGRA 1VE9A 1LGYA 4ZGBA 1SO8A 4EHDA 3ME5A 1JEEA 3IVRA 3CEMA 1LBEA 3GLRA 1ZGJA 4GVLA 2G72A 3OCWA 3N0VA 1NAFA 3IIJA 1HDZA 2XDQB 1XQYA 4DA9A 5TEVA 4GQIA 1S01A 3GA0A 1R2QA 3UCFA 1R4ZA 3BXPA 5G3ZA 3UGJA 2ENWA 1QHIA 4LWQA 4I99A 4OHRA 2IVFA 2DF8A 4EA9A 3QPWA 2IEGA 3QVSA 3IVGA 2L2QA 3KQKA 1BW9B 2F43B 4YJDA 2QJOA 3R75A 3X1MA 5IDXA 4Z86A 3KJIA 1IY2A 4TZKA 2BCGY 3KHKA 5LBUA 1YQ9A 3MK31 3DFFA 3WMWA 1UJBA 1UF9A 3G5MA 1H0TB 9GPBA 4AKGA 4S2UA 3I2KA 2M9MA 4HQ0A 2UZ4A 4EEKA 4CV1A 1HH4A 4YMSA 1K97A 5THQA 4K6FA 2K4MA 2XNDD 2YIMA 2EDAA 4PRKA 3TEFA 5HZKA 3FNFA 3ID6C 2P6MA 2QJRA 1R6VA 4PN3A 4CQMB 5AUOB 2ACKA 3D6VA 4JI7B 4ND4A 1A9TA 3HR8A 3I6IA 5AM2A 3V32A 3B1KA 1C29B 3PXEA 4GYJA 3TZEA 1CY7A 4CV2A 3ONEA 1V8FA 4AUWA 3A9SA 4U3FJ 4EABA 4ZNCA 4AJLA 4D6TD 4TWZA 1KWGA 2C94A 4EG4A 3VTKA 3FWLA 1I7SB 1J0CA 2EGGA 3KEFA 5AVRA 4KEAA 9ATCA 1SCQA 4YXDC 2WFLB 1GPYA 5KX5F 1SOMA 4WDQA 2IU4A 4MRRA 4YAIA 2JFGA 4RORA 4WBNF 1RQGA 3T1NA 2VNKA 3RYTC 4R1UA 1RY3A 1E2LA 3NONA 2AFVA 1C14A 3CEPB 3E9EA 4NBLA 3SS7X 3WKDA 2C8VA 1BNCA 2KS1A 3B7PA 2R79A 4ZVQA 1KMQA 3LQKA 2Z3ZA 1I1QB 2XW6A 1ABBA 3V1YA 5KX5A 2K1AA 2XNJA 4WBNA 5AW0B 4WXYB 2X5KO 3JQ9C 4PEVA 4MP8A 1OI3A 1UADA 3KR1A 1KAOA 2WUFA 4UTNA 1VSVA 1R8JA 4MWCA 2RGRA 1E2KA 1L4EA 1KO7A 3X1XA 1LT1A 1QFXA 1RS0A 4KWTA 3V8BA 3RC1A 2J9GA 1YBVA 1UXIA 3NBFA 4WNCA 3KS9A 1T3JA 1Q84A 3A6HA 2G9VA 1P4HA 1CJBA 1ESZA 2O01J 4DR7B 2J67A 4C0WA 1DEKA 1SQVK 2KXPB 1LF0A 4Y18A 4WWHA 2I2CA 4JASB 4I9HA 4LSWA 3UHAA 3P8CE 5ADHA 5TSDA 2NV6A 1SCIA 5A5VA 1GPLA 5CW1A 5KNLA 1N7SA 3T9BA 1JTEA 4HWKA 5JEDA 3LYHA 3IPRA 2OLKA 3NHWA 3FTNA 3VV2A 3HWSA 1JT2A 2UUBB 3ECCA 4KFUA 2WIAA 1JWBB 3V2RA 4IJWA 2E89A 1QDEA 3LYLA 3PFHA 1MOSA 1XEWX 2H0RA 2IY9A 2MINA 5FF9A 3UVEA 3COPA 5IT0A 2PJRA 2WD7A 3HN2A 1OZGA 4F6RA 4I50B 1SVFA 1J8QA 1ESDA 3H2GA 1CE8B 5DE3A 3WU2H 2D2VA 1OMIA 1Z5VA 2DEUA 1SQSA 2PZEA 1NJGA 2F62A 4W4TA 4Y30A 3RVKA 5E9WA 3RK2B 2O1KA 2D7DA 2AJDA 2QX4A 3DFZA 1M90Q 2V7PA 4ND7A 1U2SA 3T54A 4DJGA 3AEUB 3SHTA 2DFLA 4MLCA 5LMNB 4GOLD 5DRTA 4V02A 2HWKA 1W7AA 5IJ9B 2WJWA 3ZWQA 4TYYA 4LCJA 1RJDA 4YJKA 2R5DA 4LG1A 2PLAA 4X1KB 3N2ZB 1Y7LA 1VPEA 1RE1A 5P21A 5EJMA 1OW7A 1WB4A 2VJYA 4L6IA 5HS6A 1DB3A 3MYRA 2BSAA 2OD2A 1AUQA 5AKEA 5LQRA 2HW8A 1N6LA 2QXTA 3TKLA 1YUNA 2R25B 1JR3E 1EUCA 4LRTB 2YZKA 4MAMA 4MUMA 5DBHX 4TXMA 4WOKA 1WXFA 2FYUG 1EAMA 4F21A 1WU7A 1NXTA 1PPJE 2IDBA 1TTTA 3QFSA 2O59A 4CCYA 4M1MA 3DKRA 3HU2A 2JCVA 2QD4A 3QJGA 3PWSA 5BW6B 4XJSA 2DR2A 4P31A 3NC4A 2HWWA 3ZXXA 3F8TA 1C80A 4RESA 3RYCA 1FBNA 4BTVA 3KKOA 5LQAA 1N2HA 2XIQA 3UBTA 3D6UA 4IVNA 4KQIA 3IS3A 3KJFA 2VPWA 3B9QA 5CEEA 1DJQA 1YBKA 1QZUA 3CX5E 4B82A 3K2IA 1X9IA 3P32A 3DVSX 1MDBA 5BNWA 2W71A 1Z5ZA 5EOVA 3N5KA 5L8RJ 1NLZA 1JXOA 1S5LH 2P5UA 4IDNA 2W2QA 5TISE 3A3OA 4NDZA 3QUBA 3II6A 1SQQD 1UL1X 5DEOA 1GIAA 3X1WA 2R86A 2CPSA 1R0KA 3ZWAA 1CG6A 2CHGA 1QH8A 4A26A 1OIVA 3RC7A 4ZEXA 1SELA 4Z9FA 4I5FA 4AG6A 4CIAA 2PHZA 4DCGA 4HB0A 1WNTA 5K6AC 4UB6E 3W90A 1V16B 1XYYA 2JATA 5LVAA 1OWOA 4JKYA 1EA5A 3AHFA 3CRVA 1UZMA 2F9FA 1V9SA 2I2WA 4FEGA 3DMRA 4GECA 4YUXA 3AMVA 4ZT7A 5LLTA 1FUEA 1RRMA 3MCWA 2M98A 3SS8A 1A4UA 4RPHA 3K31A 1QGUB 5E7MA 4XM0A 2GEKA 4FFSA 1T3LA 2VCYA 1NVOA 4E7PA 5JAUA 1QLHA 2X86A 1GL9B 4BB0A 3V33A 4L85A 4MQFA 2BFEB 1Y1PA 4Y6OA 4DYDA 1NQUA 1Y4ZA 3R3ZA 4MNTA 2JFVA 4MVJE 2A57A 4I4TB 1CY0A 1RC0A 1KB9E 3OVMA 2WSLA 1I0ZA 3QBTA 1MAAA 1JS1X 1THTA 4I36A 3BMOB 2E1RA 3C7KA 2B4RO 3AESA 4TL7A 1ES9A 1L4NA 1YJQA 2YY6A 2UUAB 3F6RA 2G7ZA 1FP4A 1G1IA 3L02A 1E1LA 4D4MA 1RHRA 1I5EA 3OICA 1KU6A 5K8JB 1MOPA 3PYMA 1QS0A 3H11A 1P3DA 4WZAA 1KOLA 2R47A 5CA1F 5IF9A 1Q5PA 2H2FA 3JQBA 3S1KA 1XCMA 2EHJA 3ABSB 1EUQA 3EXFA 1D8AA 2PL3A 5HTOA 3CS3A 4P4GA 3FHTA 1MZVA 4BNZA 2PD4A 3CYFA 2V5VA 5FPPA 4BMXA 1DX6A 4HQ6A 2DPGA 1FJKA 4IHKA 4KKXB 4E70A 4DOMA 1LP1A 5CA1A 1IN5A 2AOUB 1A8PA 4MJ3A 5JSZB 3U40A 4X71A 4M37A 1GTL1 2KSEA 3QMPA 2J5XA 3IP3A 2BEQD 1YI0A 1RE3A 3BIOA 3F3SA 2WMMA 4YHHB 3N2IA 2J3QA 3Q1MA 1R6BX 1LSUA 1YSCA 2AZMA 5DHRA 3DYIA 5CA0F 1Y5MA 3MUDA 2FFQA 1P3JA 1VXRA 3FLEA 1IK6A 5CHEA 1SU6A 4TSFA 1J5EB 2IPNA 2BM8A 3T3DA 1XEFA 3JATA 4CKCB 2ZJ4A 1HE3A 5CCXA 4YMUA 3KKKA 3CTPA 5CA0A 1KILB 1KSGA 1NYLA 2ZVOB 1C0KA 3DZKA 4J9UE 2PIAA 4YREA 3GLUA 3MEQA 1V4NA 2RK4A 3I01M 3MNFA 3WAJA 1G2OA 3AP2A 2F2TA 4C06A 1H5QA 3HN7A 1FE6A 1YB1A 2VHYA 3WYNA 2K88A 4G56A 3AE3C 1XZIA 3CPEA 3A25A 1HQDA 1DDGA 2I66A 4X95A 2QRNA 1WETA 2R5BA 1PR6A 3AEYA 4GO1A 5K0ZA 3U9TA 3OTIA 1KYOD 2FEAA 4C0QC 2I03A 3HVRA 1E60A 3FNEA 3D3WA 1FZAA 4FCWA 5JH7B 5AVOA 5JLAA 3DEJA 3U7IA 3F1KA 4IUYA 2G70A 3LTNC 2ZR8A 2HPVA 4QREA 5BN1A 5LU8A 1T3GA 2ZR7A 3PTLA 4F97A 3W79A 3WLIA 1GITA 2J0SA 4NR0A 1W5EA 1TJNA 4ZOCA 2OGSA 2N9UA 2KSJA 2ZBFA 4WY2A 3L8MA 3MHTA 3SHQA 3CPWO 2BCCD 4BLSA 4EJSB 1UWLA 3ZZMA 4U7PB 2QR2A 3ZLUA 2OCPA 2OAEA 1WLSA 1KVRA 2AD1A 4WD3A 1CEYA 3RSZA 4HSEA 2OECA 3D7KA 3R6TA 1O9HA 1DQZA 4ZI3A 1PVVA 1HSZA 3CKYA 1IEWA 2N1TD 2APJA 4YWJA 1OAAA 1TL7C 3LLSA 1GCAA 3LT0A 2J9XB 1WE2A 1IRIA 1Z56C 4RKYA 2P2LA 2XGGA 3FA2A 2QQ0A 2XJ4A 5CAEA 2Y3IA 4B0PA 5LP1A 1GSHA 4DWOA 1IQRA 5EJFA 4PZZA 1F6WA 1EXVA 2GQ0A 2P10A 3ABOB 1NVUQ 2ZTVA 4QOGA 1RXIA 1RFGE 3U44B 1HTBA 3KJNA 4Z54A 4BO1A 4MIYA 2N1TC 4DSZA 1S9DA 2A33A 1N2CE 4MRAA 1JCDA 1V2GA 4XDYA 3F67A 2PFXA 5K8LA 3TZQA 1N9GA 2O8NA 3NFYA 2X2FA 1RQNA 4N3CA 4MWSA 5FI0B 2HA6A 1ACLA 4XI9A 4LOJA 1GJRA 5JDIA 2QX6A 5K6TA 2O7NA 2Q29A 5ER6A 4R31A 2O8DA 1SQ5A 5IXYA 2HF8A 3R9IA 3TW8B 3KVVA 4OGWA 5JMPA 1ZUIA 3HCFA 5KLIB 1TQ2A 3ZKAA 1E8NA 5ECDA 3ITEA 1I7QB 1MQ9A 4HDNB 5EKSA 1NKVA 1Q2UA 5G40A 3WAKA 1SCUA 2HEIA 4OI4A 1VG9B 4MWOA 1IBMB 3KYJB 2ZBPA 4AU1A 3G9TA 5IC4A 1AHPA 5J5VA 2HY7A 2H29A 3QHAA 3L0BA 3Q6IA 3HCCA 1D2MA 3G0GA 2XNDH 1RDFA 3UMYA 3ZDEA 2R84A 4WNIA 1FP6A 4OLFA 3JVDA 1F5SA 5CLFA 3S6JA 2R96A 1OAOA 3CWBG 5B3KA 1FYEA 1XVUA 2PSFA 2EKLA 4ZO6A 3A4LA 3I2YX 5IH3A 3E7DA 5H3LA 2BGKA 1W1IA 1SKQA 2QQGA 2GR9A 3AUAA 2FCRA 2HMYB 3GFTA 2OVFA 4G0VA 4PVCA 1C7JA 4IEEA 2E76D 1JEQB 3B5NB 3LF1A 1JEAA 4RD2A 3MMZA 1VP9A 1IHUA 3IPLA 3MLEA 3ZY3A 4TV9F 1Z4LA 1XKQA 4OUDB 3M70A 1X9GA 4YRSA 4JBGA 1CV2A 3CCJP 1PL7A 3MZWB 4EO7A 1ZD3A 2WT8A 3AFNA 3QTTA 4AUNA 3OFSA 3C5WP 2A0KA 2C20A 4R0MA 5HJ5A 4TV9A 1Q6ZA 4GPTA 3JQ7A 4EGFA 2RH5A 3B6MA 5ICGA 2E76C 1F7UA 3EWSA 3T5AA 2ID7A 5DU2A 2AK2A 3ODGA 5LNK6 4W7YA 1SQVJ 3IBFA 3RL0C 5K0FA 1XNRB 2G3YA 2QXYA 5AW4B 4Q3BA 2GAJA 4B4DA 5FBLB 3HD7D 4W1PA 1VJTA 4LQDA 5IT9A 3TMKA 3CLRD 4DCOA 1T1RA 3UUFA 2QMOA 3PFIA 1LK0A 2B9VA 3B2QA 3PPWA 4LY9A 2REXB 5B2EA 2A9VA 4UATA 1XWFA 2QR5A 1WHTA 2PQ6A 3QA3E 4L8WB 3WYGA 1PR5A 5JARA 2PQ0A 2NXCA 4MDYA 4KCGA 4IF6A 4AJOA 1X8XA 4RFSA 5DRYA 1U0GA 1X1EA 4RJKA 1UBRS 4DR1B 1V3VA 4CF6A 3PFFA 1DTWA 1R6UA 2VKQA 2Y1EA 1AKRA