2ZYGA

Apo-form of dimeric 6-phosphogluconate dehydrogenase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
466
structure length
466
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 177
structure length 466
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zygA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zygA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zygA01
3GGPA 3FHLA 1E7SA 3OJEA 3PQDA 2C2XA 3AU8A 3NTOA 3DZBA 4Q3NA 1YRLA 4AVYA 3H9EO 3UCFA 3HE3A 4B7XA 4PLFA 2XXBA 1B2LA 4IDEA 3TJRA 1AN9A 3GZ4A 5HWSA 1PX0A 1X14A 2O7QA 4BUCA 4GSKA 2ZB4A 1HE3A 1NASA 1CDOA 1GPDG 4DQXA 5DOZA 4G81A 1XYGA 3FTPA 3SX2A 1XGKA 1SB8A 1XU7A 2Y0DA 3DBLB 3TNLA 3KETA 1YJQA 4J3FA 4Y8VA 5I7EA 3JQ8B 2R6JA 4CM9D 1GZ6A 1CF2O 1JA9A 4E12A 1CQIA 4PZCA 4IDCA 3HSKA 4YBZA 4CMCA 3F9IA 3VHRA 2HAEA 3MJEA 3INRA 1IHYA 1BGVA 1HETA 4BB5A 4D0SA 4WPGA 1YB4A 4ZQFA 3OEYA 5F1PA 3WICA 1X7DA 4P22A 3JQ9C 4YJHB 2EKQA 2GRAA 5BNTA 3B70A 2QG4A 4RVGA 5JCXA 1WDKA 3OA2A 5L7WA 1KEVA 5CHEA 1GV0A 4PZEA 1SMKA 4KUHA 1Q7BA 3QVOA 4UEJA 3NT5A 1YL6A 4DRYA 5AQ1A 1GV1A 1Y1PA 1UXIA 3F1KA 5GZ3A 4Q3BA 1GFSA 2CVQA 3LT1A 3IMFA 3TF5A 4ROSA 2Q2QA 4ESOA 4E30A 3HWRA 1HWYA 5THKA 2BD0A 3M6IA 2EKPA 4ALIA 2RH8A 4JGBA 4RPHA 4J2HA 5IN4A 4UAGA 2HMSA 1YDEA 4BGEA 4WASA 1VJTA 4XYLA 5A05A 1VC2A 3GT0A 4RVFA 4WLVA 1O9BA 2V6FA 2UUOA 3NDJA 5ITWA 3GFBA 5ER6A 3TL3A 3C1OA 4B3HA 3VAZA 2O3RA 3NDIA 3WMWA 4E5PA 1YXMA 1VKOA 4R1UA 2VHXA 2EGHA 4RQUA 3I3OA 3FF4A 4UVGA 3E1KA 5TT1A 1LC3A 2DTEA 4OKIA 5H82A 3V1YA 4C4OA 3VH3A 3MZ0A 3Q2KA 2AQIA 4GH5A 4FR5A 2BI8A 3VTZA 4MDHA 1YJ8A 5EIOA 1F14A 2I67A 3H8VA 3DBRA 5CPBA 4PLGA 4PVDA 4EGFA 3JV7A 1X15A 2X22A 1H94A 1GZ4A 4BNZA 4MPDA 3RU7A 2CF6A 4IMPA 1LDGA 3HDYA 4FFMA 1ZBQA 4DLAA 3WLFA 4MVJG 3FSRA 2NQTA 1WPQA 1C1DB 1ZKMA 3QRWA 3U5TA 3D0OA 4CUKA 1E3IA 3NKLA 1PWXA 3OEWA 4XIJA 5JPIA 2HMUA 3WIEA 4Q39A 1BXZA 2JKVA 3I9KA 4ZQBA 4I5FA 5JC1A 1I01A 1ZJZA 4L8VA 1HZZA 4EZBA 3T4XA 1U1IA 2X6TA 3ORFA 5FWNA 3A06A 3ABIA 3WJAA 3TZQA 5C7IO 2ZB3A 2A92A 4P8RA 1MB4A 3BMQB 3QIVA 2O3SA 4RVHA 5BSHA 1GQ2A 4WE3A 5H83A 3DHNA 5KVCA 4P38A 3RC9A 2CD9A 4IJWA 4RLHA 2I3AA 1TXGA 3AW9A 4XQ9A 1CEQA 1FDUA 1IYZA 3AOGA 1M6HA 3JQ7B 1WXDA 3QP9A 3KBOA 4P4NA 2VWPA 4WEOA 3DAFA 2W8ZA 2GERA 2NSDA 4CR8A 2CVZA 2D5AA 3PWSA 3QHAA 1RYEA 1WMBA 1EUZA 1EVIA 5ILOA 1PS8A 2FPIA 3FNHA 5TC4A 2Y1FA 4LMRA 5B4UA 3W6UA 4TVOA 4WCFA 2O4UX 4PG5A 4FOOA 5AXAA 2BGKA 1T2DA 1M76A 5HTOA 3P2YA 4WUVA 4K1LA 1D1SA 1LSSA 2QZZA 1T25A 1YL5A 1BXGB 1IOLA 2VUTA 1H93A 2YYYA 4GVXA 2DFDA 5AXCA 2QRKA 2VZ9A 1NR7A 5G0TA 3VC7A 3JD1A 1PZFA 2LDBA 1QLHA 4RZHA 1DC5A 2W98A 3FNGA 3NRCA 4YAKA 1PTJA 3RC7A 1QMGA 1LDNA 3AM5A 1Y81A 1CYDA 3L07A 3Q0EA 1PWZA 3RD5A 1EK5A 3GVCA 3V2UA 5LDGA 4DPKA 3RFVA 2OOSA 3JQFA 1GEGA 3GMDA 4O6VA 1P74A 5BT9A 2Y66A 3UHAA 4PLTA 4CLEA 1I3MA 3W4JA 4J0EA 3GNQA 3I4FA 4IDGA 4BKPA 1FK8A 1MG0A 3KHUA 2YJZA 4A7PA 3GGGA 3K2EA 4RL6A 4UUPA 1DLIA 1I0ZA 2PV7A 4Q3CA 4CMAA 1CWUA 4BV9A 1DHTA 4CMBA 1RM0A 2HRZA 1Q0QA 2X8LA 2NVBA 3TZ6A 5AOVA 4CR7A 1NVMB 2WMDA 3M1AA 1HTBA 3QA9A 3KOUA 3ZU2A 1Y9AA 3W1VA 1YO6A 1UR5A 1B3BA 5EJ2A 1DO8A 5TGDA 4CQLB 3K92A 1LU9A 1HYHA 3A1NA 1TA4A 4ZJUA 5FI5A 4XB2A 2OP0A 1LJ8A 4OO3A 4CM9A 1N9GB 4IDAA 1P31A 4W9NA 4YXFA 4DXHA 1Y8QB 4YAJA 3RFTA 3ZWOA 4PLPA 2ZYAA 3AY7A 3NJ4A 4HXYA 1E5QA 3PHLA 1EBUA 1O5IA 5CEFA 2UV8A 3ZWNA 5LCXA 3OJOA 4IY1A 2BKAA 2C59A 4E5MA 2HCTA 5KKAA 1E0DA 4CM6A 2JHGA 3H5NA 5CPFA 4TZKA 2FY8A 1CETA 3HN2A 1I30A 5H81A 3STHA 1NWCA 3OJLA 1P1KA 4BGUA 3HDHA 4YAIA 2YV3A 3SXPA 3GHHA 4MP6A 1TT7A 3WYBA 2B4RO 4YJGB 3KSUA 2GDZA 1I3KA 3QVXA 2YY7A 2X9VA 1LUAA 1PZGA 3H3FA 4AJPA 1YGYA 5F1OA 3HFSA 3GZNA 4ALMA 2FHSA 9LDTA 3S2FA 5F1KA 5F3RA 3PWKA 2PH5A 2VHVA 5A9SB 5A4DA 4I9NA 4YDRA 5C37A 2IXAA 3DFZA 3R6DA 5JDCC 3DZIA 4YB8A 1N1EA 2FZWA 3DZKA 2HO5A 3CIFA 2RHCA 5JAIA 3H7AA 3FWNA 3PLNA 4WECA 2YV1A 3PTZA 2VYVD 4CMHA 1J4AA 1LXCA 4BNFA 1KC1A 3PHGA 4IMRA 4CV0A 2BFOA 5DULA 1O89A 2B4QA 2BHLA 3CE6A 4QFCA 3PHIA 4RVSA 5GZ1A 3LLVA 1IE3A 1BVUA 3PWZA 3ZWYA 3LZ6A 1ML3A 3L77A 3QLJA 4ND5A 4PFJA 3T7EA 3WSVA 5K0ZA 2OZPA 1LLCA 5IDWA 3I83A 5L95A 2HK9A 2RHRA 3E82A 3ZU3A 3GDFA 1DJNA 3T7CA 4BB6A 2EWMA 3E8XA 5F5LA 2CZCA 2BF7A 2Q1SA 1S6YA 5DDIP 3V2HA 1FDTA 1Q2XA 3IDSA 1EVZA 2HMTA 5L3ZA 3G0OA 1A9YA 1NQ5A 1TB4A 4O59O 4DYVA 1C1XB 3BTVA 1LLDA 2C5EA 5ITVA 1WLYA 5DNAA 2VHYA 3MEQA 4CM3A 4A2CA 1EFKA 2WD7A 5ENDA 2YQ4A 1N5DA 4TSKA 3QWFA 4YVFA 2JFFA 1E3WB 3ZHXA 5JW6A 2UYYA 2PKQP 1EE9A 1V9LA 1ZEMA 2V7PA 3EVNA 3GG2A 1W4ZA 4RVDA 5EESA 4D44A 2AG5A 2QIOA 1GYPA 1C0KA 1D4FA 5B12A 3KSDO 4FOSA 4PLCA 1ISJA 3GR6A 3RUAA 3INGA 3QWAA 3OA0A 3UUWA 2X5JO 1DFHA 2C82A 3RUCA 1EBFA 3I5MA 4ZD6A 2FN7A 2UAGA 1NBOA 2PD6A 4DQUA 4ALLA 4PG8A 3D3EA 3DBVO 4JIGA 3NT2A 3H9UA 2D1YA 2PZMA 4N54A 1WDLA 5JAQA 2B5VA 2PY6A 4CL8A 1AGNA 1HXHA 5A03A 3EZYA 5KJ1A 1RM3A 3UW3A 5AXDA 3PGJA 1N2SA 3AI2A 1P1IA 1NQTA 4R5MA 1PS9A 3IOYA 2ZTMA 5JMWA 1D1TA 4NBVA 2CY0A 4JP3A 5EERA 3RSHA 3WMXA 1KERA 3E48A 4L4RA 4TKMA 1K89A 4A0SA 1ENZA 4YRAA 4F6CA 1EZ4A 4HWKA 1H6BA 1MUUA 3UF0A 4CM4B 5JCJA 4FFOA 4DIFA 4OM8A 4MO2A 4MVJE 3SJUA 5JO0A 1BSVA 1VSVA 5A1TA 4G2NA 4LSMA 3BA1A 1B7GO 3LC7O 1UAGA 3JYLA 1GADO 4M49A 2DUUA 1E3WA 5U1PA 1B3RA 1Z82A 4E2XA 1VRWA 2UDPA 3CTVA 2NUAA 2NU6A 2X9NA 3C1TA 1WNTA 3UOGA 1NFFA 4HADA 1ORRA 3DTYA 3PIDA 1TVEA 4NU5A 5JS6A 1OMOA 1DIAA 3JD3A 1WP4A 1RM4A 1UXHA 3ICCA 5CEEA 4CM8B 3HZZA 3SBOA 3PHJA 5U4QA 2YZ7A 3FPCA 1NPYA 1DOHA 3WGZA 4AICA 1LSUA 1SC6A 4YPOA 3JQAD 3WXBA 1ZK3A 2RIRA 4PIVA 3WBFA 3O4RA 2YHUA 3G79A 4AJKA 4EEZA 1YDWA 1O0SA 5DF1A 3CPSA 1V6AA 1OBFO 1C0PA 1ZIDA 3VH2A 4DGSA 3OP4A 1KVSA 1NVTA 4IQ0A 2I6TA 1MFZA 4WLNA 3G17A 3BMOA 3HHPA 2FR8A 3E9NA 4KWIA 4L76A 3DBRB 2CDAA 2GYYA 2BI7A 3M2PA 3ROPA 4OXKA 3F1LA 1U2GA 1GUFA 2EW2A 3S2IA 3IS3A 1I3NA 5JAZA 3ZU5A 4Z3DA 4ND4A 3ZHYA 1I24A 2C20A 3MTJA 1V3VA 1Z45A 1U5CA 3RBXA 4YJFA 1FDWA 2VZ0A 2AMFA 2G17A 4MP3A 4OIMA 4OMUA 5COBA 3ENNA 3ZGYA 5BSGA 4N5NA 1CQJA 1WZIA 3OETA 3RKUA 3KVOA 4II3A 4NK5A 4INAA 3ETDA 5A5EA 2HRBA 5JXWA 2DBQA 3IC5A 1QSGA 4J7CA 4RV9A 4GSLA 2FSVA 1DC6A 4IJKA 2GUGA 4MJLA 1JLLA 4K6CA 1P1FA 4GI2A 4LW8A 2DBVO 3DAPA 3OQ1A 4GAEA 5DCYA 3AI1A 2J5QA 3H4VA 1H6AA 3RFXA 1U3UA 5KTKA 4CLOA 5JAMA 3OJFA 3AY3A 3PK0A 2PWZA 1AXGA 3RBZA 4U0KA 2HKIA 2X0RA 1NQAO 3D3WA 4MKRA 3OMLA 2IODA 1UDCA 1HDZA 2H1SA 5KVSA 4D7AA 1OOEA 2IRWA 4PZDA 1U2DA 3ZDFA 4B3JA 5JDCA 3WWZA 3OFSA 3GAZA 2AQKA 4DBVO 4BKQA 3GDOA 3RJ5A 4MVJH 1Z73A 3DEYX 1BG6A 4KTTE 3X2FA 3NDRA 3OIGA 4Z0PA 5FYDA 3U3XA 3PEFA 5ILGA 3OSUA 1R12A 1UDBA 5G0VA 1BTOA 5T6BA 3H65A 4IS3A 2HQ1A 4QEDA 1UZMA 4OYRA 3KZVA 1N9GA 3ZWWA 4B3IA 5I8ZA 3ETGA 4CMGA 3I9MA 2JD0A 4ONEA 3RROA 4YT2A 1DIGA 3GN2A 3C85A 2NVUB 1W6UA 3WFJA 3MJCA 1CERA 4YT4A 3WOHA 3EUWA 2HLPA 4WOKA 4RCVA 2D5CA 3AUUA 2J5RA 3PRJA 4YRDA 3PJGA 1R37A 2V6GA 5LC1A 1A71A 3CH6A 3PLRA 5IAAA 4BO8A 5G4KB 4D41A 2VN8A 3NEPX 4D79A 5IDXA 3NGLA 4XDZA 1GUYA 3B1JA 5F21A 5TT0A 1QG6A 3IP1A 3BMCB 4N7RA 2OXIA 1HLDA 3JYNA 2AQ8A 1VKNA 3EYWA 5A9SA 4J1NA 4LISA 3ZNQA 1IZ9A 3WFIA 5JYDA 3VOSA 1C0LA 1GPJA 2PKQO 2DU8A 2OBNA 3E5MA 3TZKA 2HJRA 4IZHA 4KQXA 4U0JA 1Q0LA 3WBBA 2I66A 3BHJA 2ZTUA 1PZHA 3DMYA 3MJSA 5JFOA 1Q7GA 2NTVA 3RASA 3RKRA 1QLJA 4FFPA 4XQCA 1Y9EA 3QW2A 2DTDA 4DVJA 4E33A 4MVJM 5JY6A 1MLDA 1U8XX 1PL6A 4Y6PA 1HDGO 1JW9B 4OGWA 4EITA 1HE2A 2GNAA 4ZQGA 4CM1A 1LRLA 2Z1NA 3UVEA 2EG9A 3GH3A 1OC4A 3TRIA 4W6ZA 4AG3A 3NT4A 3NGXA 3VZSA 5KOIA 1KEUA 1X7HA 3W8DA 1B16A 2B0JA 1VI2A 2RH4A 2DBRA 1LEHA 4YAGA 5L53A 3T4EA 1R4NB 4NMHA 4TMFA 3W6ZA 4HFJA 1EDOA 3W4IA 1GYQA 3L6EA 2O50A 1SBYA 3I4CA 1XR3A 4R9SA 3I9LA 3ZWCA 3ICPA 1A4IA 2CVOA 3O03A 5TQVA 1TT5A 1U7TA 2DUWA 3E9QA 3LF2A 1V8BA 3ZV3A 2JCXA 4EUEA 2O4CA 2X1HA 5HS6A 4EUHA 3Q3CA 1H9BA 3AUAA 1S7CA 4F3YA 3I23A 4RQTA 1Y5MA 4R1SA 2HJSA 1GR0A 3NTRA 1SPXA 5TJ9A 4IZIA 1O94A 4O5OA 3K30A 1AVYA 4IBOA 1P44A 2OO5A 5JCJD 5HRUA 4Q9NA 3HJAA 4JNKA 1JKJA 3ZV4A 2EV9A 2BFMA 3QVTA 3RIHA 4E2WA 3DBLA 3ZWBA 3L6OO 1HKUA 2P4HX 3KYCB 4BNVA 3CMCO 2PD4A 3FCOA 4M89A 1YH3A 3ST7A 5EMHA 1PU2A 3C24A 3VVBA 1ZK2A 1J5PA 2P4QA 5BSFA 1A9ZA 1LRKA 3ZNOA 1HE4A 2E6UX 3ZW9A 4H15A 4XYBA 5KVVA 2W2KB 2IYOA 3D4OA 3JQGB 3AM4A 2BFAA 3UAGA 1EMDA 1E7WA 1R0SA 1AE1A 2Q2VA 1HSZA 3QQPA 2VWGA 5GY7A 4CLHA 5DT9A 3JQFC 2NNLD 2IDZA 4K26A 2PGLA 4CLXA 4L74A 2OP1A 4UUMA 3AU9A 4KZPA 3S1LA 1IY8A 2EHDA 5COAA 5B4TA 2YHIB 3JD0A 3UICA 1NVGA 3PDJA 2P9GA 3KTDA 4GPD1 1AHIA 2WD8A 1A7KA 2GO1A 3IKTA 1QYWA 2JD2A 5T67A 3E03A 1DC3A 3E6AA 2ZTVA 4OOFA 4GGPA 3AK4A 4GMGA 4JK3A 5AVOA 3C7DB 3K73O 3O38A 3G1UA 3DOOA 2XPCA 5A5FA 1O6ZA 5L7TA 3OQ6A 3WX0A 4B4WA 2BMAA 2BFPA 1FDVA 1GY8A 1H9AA 3L9XA 4OL9A 2Y0CA 3LDHA 1VLLA 2AQHA 3O8QB 3JQ8A 1KEWA 4L0QA 2VHZA 4DIBA 3PZBA 2X0IA 3OF2A 4EUFA 3R0IA 4GGOA 4QXMA 1D7OA 4XZ3A 4CMKA 2RCYA 4MINA 2PLAA 3INTA 4WLUA 4YJDA 1MGOA 1P0FA 2VRCD 4WCFB 1JN0A 4LSWA 1E6EA 4ZU3A 2RBEA 5A02A 1XU9A 4DMMA 3SC4A 2CMDA 3VZRA 4B7UA 4JLWA 2O48X 4YQYA 2SCUA 2Y1EA 3DBHB 4I8XA 4I5EA 3VH4A 2JL1A 2A4KA 4TQGA 1SAYA 4CLDA 4E4YA 1PSDA 3BTOA 5DZSA 4WLOA 1XIVA 2ZQYA 2FR0A 2GN6A 2CF5A 2IZ0A 4J6FA 3Q9NA 3W8FA 2VNSA 4M87A 4J43A 3WYCA 1ZXLA 4ZRMA 1ZMTA 4HFMA 2QW8A 1L7EA 2JCVA 2GF2A 2I3GA 2D3TA 2VOJA 4CODB 2VWHA 4I08A 1PGQA 4W82A 4FBGA 3PGXA 1E1LA 2AEMA 3AFNA 1MX3A 1PGNA 4NBUA 5CG2A 4WGGA 3OBBA 2DVMA 4BNYA 4S3MA 3QVWA 4Z0HO 3ZZNA 1E7RA 1DAOA 4AJ1A 1B14A 3DAGA 1KVRA 3HNPA 3RCBA 4Q3DA 4RDHA 1K5HA 1E92A 4YR9A 2P5UA 1FXSA 1HRDA 1MV8A 3QWIA 4Y98A 3G3EA 4KDEA 5A04A 1E5LA 5EQFA 1EK6A 2WE7A 2OORA 2VQ3A 2XAAA 4CV2A 3SEFA 1NTOA 4TZTA 3WGGA 1U4OA 3TOXA 4M8SA 1UAYA 3TL2A 3JD4A 1RJWA 2VZ8A 2GZ3A 3DBHA 4D43A 1KOLA 1T1SA 4CV1A 2YUTA 4L73A 1PJLA 5L51A 5I9NA 1KC3A 4BO9A 1PJSA 1HYGA 3F4BA 3GVHA 1QV6A 1HL3A 3PJEA 1V3UA 4Q3EA 6LDHA 2Q4BA 3ASUA 1A4UA 3SLKA 4BNGA 3PFWO 2AE1A 4NNJA 4KTVE 4CMIB 3B1KA 3DTTA 2Q3EA 1HSOA 1Q0HA 2D8AA 4NDNE 5IF3A 4NBWA 2Y1OA 1Q1NA 3A28A 3B1FA 4OHUA 5I9LA 3DHEA 2DPHA 2IEDA 3EK2A 4HP8A 3PFFA 3V2GA 4D3FA 2IZZA 1I3LA 4PLZA 1PJCA 3K2BA 5DBIA 4D3SA 1NXQA 2HU2A 2NV6A 4FC7A 4K28A 4OKNA 1P77A 4K6FA 4XWYA 1PJ2A 1ZZEA 2FP4A 3R1IA 2Z95A 3W8EA 4FC6A 1TT5B 2DLDA 4A03A 1RYDA 5JC8A 1T2CA 4OJNA 3BMCA 5JMPA 4URFA 3NAQA 2H63A 4FGSA 3ANMA 1NQOA 3LT2A 4N5LA 4WNCA 1H5QA 3RC2A 4TRMA 1EVJA 1NFQA 1Z6ZA 3TWOA 5ADHA 2O23A 3H2SA 1HDXA 3RUFA 2WSBA 5AXBA 2W2LA 4RORA 1DRVA 1BDMA 1BVRA 3QE3A 1DRWA 4BNNA 1R0LA 1ZW1A 2QRJA 3LT0A 3QSGA 2AEJA 4ID9A 2ZB8A 3WWYA 3UKOA 4NFHA 3U62A 2JD1A 2NU7A 1KY5A 1SEPA 4OQYA 1E7YA 3BXXA 4GKVA 5TRTA 1ADBA 1UXJA 2Q50A 2WDZA 4L4XA 2Q49A 5G4LA 3JD2A 4MKXA 3WIDA 4ALKA 1ISGA 2C0CA 4KMSA 4IDFA 5EN4A 2PD3A 4XYEA 4E2YA 1P45A 3I9JA 3WGHA 1UUFA 4EYEA 1DXYA 4D42A 1C1XA 2NWQA 1VE9A 4FFRA 4AJNA 3LYLA 1A27A 2EKLA 4X54A 3FRJA 3UN1A 4CV3A 4FFLA 3TDKA 1PEDA 1ADCA 4LRTB 4GX1A 3ZWAA 3BMNB 3B6ZA 3EHEA 1N7HA 5MDHA 5KKCA 4I5DA 2Y1GA 5JO9A 1YBMA 4EEXA 4R51A 5ICMA 1OI7A 3JQAA 3WGTA 2ZIZA 2Z5LA 4CUZA 3JQ6A 2GN9A 4NBRA 3VPSA 4WCFC 1F17A 4MP8A 2DT5A 4DBZA 2YW9A 3LLSA 4IXWA 1AXEA 2Y1CA 3FTNA 3I6QA 1P3DA 4J1TA 5JY1A 4R1NA 5TJHA 4BMNA 3RQSA 3FR7A 1HYEA 1XWFA 5G0SA 3C1AA 4LGVA 1V0JA 3BTSA 2G1UA 4BHTA 3O8QA 1EFLA 2CDCA 3WDSA 4CQMD 2VTDA 2ZCVA 3I6IA 4PCVA 1B8PA 4RVUA 1V3TA 3AM3A 4A27A 2GZ1A 4MVJD 4BNXA 5FEUA 1Y5RA 4J4HA 1SZJG 4ZN6A 2W2KA 4XA8A 5JBIA 4MVJI 1DIBA 2ZB7A 1A7AA 5KJCA 2NTNA 3ZV6A 2Q99A 3OICA 4Z9YA 2ZJ1A 1P1RA 4WLEA 5ER9A 2O3UA 4IJUA 4JX8A 1PQPA 3I1JA 5HS4A 4C7JA 1YB5A 3OJ0A 2AG8A 3BIOA 4FD3A 3GRPA 1RWBA 4NBTA 1X7GA 3TZHA 4W99A 4YEDA 2HDHA 3CEAA 4H7PA 4UUOA 4RF5A 3V5NA 2YDYA 1R4MA 1DIRA 5ES3A 3H2ZA 5TLSA 3C7AA 4LRSB 3GZNB 4UREA 3D4PA 2GASA 4PG6A 5TNXA 2X4GA 4XJTA 5A06A 4R16A 1LC0A 3ZW8A 2FZEA 8LDHA 1YBVA 1D8AA 4E5KA 3H9GA 2QYTA 3ONDA 4EJ6A 1P1JA 3ZV5A 1GD1O 1PJQA 3VKUA 3KXDA 3ZCXA 4BKRA 1Q7CA 2Q1TA 3HDJA 4BO2A 1A72A 3LT4A 3A9WA 3DZHA 3AOEA 5J23A 4DC1A 1BW9B 2DAPA 4BO1A 1BMDA 2GGSA 3OQBA 3COSA 3GVIA 4U7WA 1ZK1A 2C29D 2CUKA 1J6UA 4J2OA 2Q2WA 3SJ7A 4UEOA 2D59A 1N1GA 1ZCJA 1JDJA 1SOVA 5JNLA 2PA3A 2EP7A 2H6EA 2BLLA 1NHWA 2XXJA 3JQCA 4GQAA 5B1YA 1X0XA 2VRCA 2WEKA 3M2TA 3NV9A 1QXSA 4E32A 3KYBA 4O1MA 3DOJA 1PL8A 1U3VA 3GK3A 5IDQA 1I2ZA 4QECA 1T24A 2NM0A 5G0UA 2NADA 1QP8A 2O2YA 4TRJA 4D45A 4CMJA 4XKJA 1VSUA 2WJPA 4MVJF 3DXFA 3JQEA 3DZFA 5TIIA 1ISMA 4GKBA 1Y6JA 4HBGA 1ADFA 2X7HA 1C0IA 3WYEA 1H2BA 2OMEA 3WG9A 4A10A 3VDRA 5C7OO 3KEQA 1AUPA 3JCZA 1WAMA 3GEMA 1ZSVA 4ILKA 2J3KA 2ZQZA 4OAQA 4JBIA 1UP4A 1WDMA 2C07A 2DTXA 3S8MA 4NU6A 2J8ZA 1NNUA 3GEGA 3OM9A 1FDSA 2FOIA 2E49A 2Q4EA 3ZH2A 5HBRA 3K8ZA 1NX6A 4D3DA 3GEDA 1G0OA 4FIZA 4BGVA 1FJHA 4RPGA 2PGDA 4ZQEA 4XGIA 1ZK0A 3TOZA 1K0UA 3WTCA 1E77A 1GCUA 3A14A 4FPXA 3ZWVA 4Y67A 3C3XA 4BMVA 5DP1A 1Y8RB 2NU9A 2EIHA 1FF9A 1XQ6A 3U9LA 3N7UA 4PRKA 4BNIA 3SLGA 2JHFA 3W4KA 4ND1A 4R3WA 2FPPA 2JJYA 3DDNA 3K31A 3WSWA 4E5YA 1NYTA 3U4CA 1FMCA 1PGOA 4EJ0A 5LDHA 3L6DA 3ONEA 4B8ZA 1M2WA 2JFGA 1OFGA 4K9DA 2G0TA 1KS9A 4WKGA 1DPGA 4OOEA 3SC6A 4BNTA 3HG7A 3ZU4A 1T2FA 2VUSA 4MIOA 3ENKA 4E5NA 5FI3A 3RUDA 1ENOA 2EXXA 4C7KA 1ZO8A 2IXBA 1PQWA 4MIYA 2I65A 2EEZA 1BDBA 5K6AA 1E7QA 4KP7A 4BNJA 4BNWA 1HZJA 3I9NA 2AXQA 3KB6A 2DBZA 1GTMA 2GN8A 4KDFA 3U4HA 4B8WA 1YOVA 1O8CA 4G65A 4RZIA 2NVWA 5IZCA 1E6UA 4DUPA 3JQ7A 4J9VA 3PZRA 1ZMOA 3Q11A 2ZYDA 3WGYA 4DWVA 2F1KA 2R00C 1ENPA 5ICSA 4LK3A 4GLOA 1R66A 1KIFA 4PLHA 4DYDA 1NR1A 2J3HA 5K9ZA 1JVBA 4HX5A 3KUXA 2AW5A 5FF9A 4LN1A 1Y8RA 3AWDA 3H3JA 3KRTA 3BMOB 1U3TA 1LX6A 2O7SA 4CLRB 1D3AA 5L9AA 1PZEA 2O3TA 2HK7A 3H6KA 4R69A 4Y6SA 4ALNA 4R41A 4EI2A 1E6WA 4IDBA 1WWKA 3Q9UA 4ZQHA 3PQEA 1P9LA 4YCAA 2AA3A 2C7VA 3IKVA 1XCBA 1GQQA 2NQ8A 4JBHA 4CQMA 3IP3A 3R3JA 1LI4A 1NM5A 4FCCA 4JCOA 1MFPA 1WMAA 9LDBA 1GUZA 1JVSA 3MCVA 4NK4A 2OL4A 1VL0A 4RO0A 4U5QA 1HE5A 2VT2A 1JQBA 2CNBA 2VWQA 2D2IA 2Y93A 3DWFA 3G49A 3OECA 4MVJA 4WOJA 5DOVA 4HKTA 5C5IA 4MVJP 1PGPA 2G5CA 3GQVA 4PG7A 1E3JA 1RM5A 4EBFA 1J49A 2JAHA 4KQWA 5L4LA 3LU1A 1OC2A 1MXHA 3KSZO 5CFZA 5K6AC 3V1TC 4E3ZA 2VT3A 5KJFA 3HDQA 1T26A 3AI3A 2VTEA 4A26A 2HUNA 2HMVA 1UP7A 5ENVA 3U49A 1DJQA 1I33A 2YV2A 4II2A 3CZMA 3F5QA 5IZCC 1B26A 1JKIA 3WGOA 3GA0A 3NUGA 2Q46A 3K9QO 5KNLA 1LDYA 2QRLA 3WQRA 4ITUA 2EW8A 5CDTA 5I7FA 3D7LA 3NX4A 2Y0EA 3K5PA 3RUIA 3C7CB 2B37A 3P7MA 3UGKA 4L75A 3D3WB 4TROA 4PG4A 4ND3A 2Y99A 3TSCA 3S55A 1E3LA 1NWHA 2P68A 4UVEA 2UVDA 5IZ4A 5TSDA 2VYND 4WK6A 3RAJA 5THQA 1E3SA 2J3IA 1U7HA 4U6SA 4EDFA 4A5OA 1XKQA 1F8FA 2HK8A 1H0KA 2IYPA 5A9TA 3GG9A 4UEKA 1DB3A 4GWGA 2R2GA 3CUKA 5I7VA 4R4JA 3BYZA 4M55A 2P9CA 3FR8A 1B15A 3EAGA 1QORA 1GYRA 2FSSA 3JQBA 2JCYA 4I9HA 4U8GA 4UVHA 4IIUA 2LDXA 4HFNA 1NAHA 3ADPA 5DBGA 3BHMA 4BO3A 1UP6A 1PGJA 4FQ8A 4XQGA 4QO8A 3LF1A 4JJFA 4U6QA 4N18A 4BQPA 3U09A 4NJOA 3HUDA 2E48A 1K3TA 3ULKA 3RWBA 2PR2A 1E7MA 5CDGA 3CTMA 1KY4A 2YQ5A 3VZPA 4NFYA 2VHWA 1R4NA 4CUJA 2GD1O 3BAZA 1YQGA 5KCZA 5JDIC 2E37A 1YL7A 3DFUA 4BNHA 3PI7A 2X0JA 1ID1A 1NP3A 7ADHA 4CMEA 2VOEA 3P19A 3MJTA 4EW6A 2W2LD 4I5GA 4AJJA 2J3JA 4W4TA 1H6CA 3EMKA 3EW7A 2PKRA 1XELA 1EUDA 4NG5A 2NACA 3ASVA 4XYMA 3WJ7A 2OFPA 2ZK7A 5A3JA 1NPDA 3S2GA 1KVQA 3ANLA 3GOHA 2YDXA 3VPHA 5T64A 1EEHA 4JXKA 4KWHA 3VTFA 1LSJA 3WTBA 1UXGA 4YA6A 5IXSA 1QRRA 4W7IA 1LRJA 1XDWA 2Q1WA 3LK7A 5IXYA 2AEFA 1YB1A 3MWEB 3DOCA 4GLLA 1I36A 1U3WA 2OGUA 2YFQA 4JN6B 4PLWA 1DBVO 2JAPA 5FFFA 2C7GA 4J4BA 4F6LA 5TX7A 1DDOA 1L7DA 3H5AA 1GAEO 2B35A 4BS9A 5IJZA 2GPTA 4D46A 1KYQA 4TKLA 3JYOA 3HFGA 1DSSG 4RPJA 1R15A 2ZYGA 4Z9XA 1LA2A 4UULA 4Y9DA 3UFXA 1ENYA 5CEJA 1E1KA 4BNKA 4HUJA 1VM6A 4Z0TA 3I9OA 1P33A 3K96A 3DMTC 4KUEA 4B79A 1QYXA 2H5LA 1GU7A 2IEBA 2GN4A 1M66A 4WNIA 3GNTA 1ZSYA 5IG2A 4XR4A 3WGIA 4BGIA 2YHIA 3GFGA 4L9RA 4R1TA 2VYNA 2X5OA 1KEPA 3B20A 3PXXA 2W90A 3MJVA 2P9EA 3OIDA 5IN5A 5T5QA 5IFLA 4NHEA 1HDCA 1RKXA 4BO7A 2C54A 3Q6IA 4D0RA 1JAYA 3AJRA 3WQSB 4XEHA 4GX0A 4I1IA 4NJMA 4BL5A 4RGBA 4E2ZA 4J0FA 2X86A 1UXKA 4YT8A 4R54A 1QYVA 1ISFA 1JWBB 3O26A 4OXNA 4BOYA 4DTIA 4RF3A 3D5TA 5I7SA 5TS3A 4MOWA 4IQGA 1GQYA 1KBZA 2DKNA 3GVXA 3GNSA 5KJEA 4QFDA 3ETEA 4XX0A 1N92A 1XHLA 2E4AA 2IE0A 5BNFA 4AJHA 4XJSA 4GBJA 6ADHA 5MGBA 3GDGA 4FGWA 1HDYA 2C2YA 2G76A 1K6JA 3H9JA 3FN4A 1ZXBA 2AHRA 4QX6A 5EL0A 1CRWG 1MG5A 3GLQA 1Z75A 4IDDA 1UZLA 2PZLA 3JQGA 4PGFA 3MOIA 1VJ0A 2QHXA 3GRKA 3DMTA 3TPCA 1GDHA 2Y68A 3H9QA 5KWEA 3PP8A 4DL9A 3ZNPA 5AYVA 1LQTA 2PH3A 4YAEA 3F6YA 4CM4A 3SVTA 1IB6A 1LNQA 3VVCA 1PJBA 4NZ9A 4CQMB 4L4SA 4RF4A 2W4QA 2RAFA 4OQZA 3EDMA 5EQDA 4ZICA 1UJMA 1PJ4A 1PL7A 4BO6A 3GF4A 1LSOA 5B4VA 4XD2A 2I76A 2H9IA 1EE2A 1P0CA 1X0VA 3IQDB 3IAHA 4J91A 5L4SA 3TFQA 4Z6KA 4O63O 3FD8A 1ULSA 5G0WA 5DP2A 3VZQA 3ZNNA 1ZUD1 2OBYA 4FS3A 4UVIA 4F45A 1DC4A 3RJ9A 1LLUA 1TEHA 1YOVB 4KUGA 4J4TA 1T2AA 5G4KA 4ZA2A 1IUKA 3GPIA 4ZGWA 4BKUA 1YQDA 3KO8A 2Y05A 4YRBA 2TMGA 5B37A 4NH4A 3RUHA 1X1TA 2ILTA 3MJ4A 3ITDA 1LDMA 3VPFA 2BRUA 3FNEA 3P2OA 4BMSA 1F8GA 3GGOA 3VPXA 1XSEA 4J1QA 4ZVVA 2B83A 3V8BA 5CDYA 2BGLA 3L0DA 2QQ5A 2BELA 5KIAA 3NYWA 3E5RA 4FDAA 4XB1A 1IULA 4OSOA 4B4UA 4CLRA 3RC1A 4DPLA 4IXTA 3PPIA 3PDUA 2J5KA 2PFGA 4GX5A 4HY3A 3KYDB 3AUSA 3GUYA 1JU9A 3NTQA 5A3VA 3F5SA 2ET6A 4M86A 4R01A 3A4VA 5TF4A 3ZWXA 3JQBC 5CDSA 4YJFB 3VDQA 5I8WA 3AFMA 5CAEA 3WB9A 1W8DA 1HDOA 1Y8QA 2I99A 4OSPA 4AL4A 1WVGA 1O95A 1RPNA 1F0YA 1ONNA 3IJPA 1IHXA 4DMLA 2A9FA 1JWAB 1C3VA 1DAPA 3KLMX 4NIMA 3LVFO 4TVBA 1BWSA 5BNIA 4IGFA 2D0IA 3AUTA 4TWRA 3RU9A 4WCDA 3F3SA 3PYXA 4DLBA 2X58A 2PZJA 1U8FO 4MIEA 1M67A 2EJVA 3BHIA 2B69A 3VPGA 4XRRA 1HF3A 3FI9A 4KOAA 3HB5X 1BXKA 4FJ1A 3D4NA 3EVTA 3K6JA 3PJFA 1HEUA 1E3EA 2PGJA 4R9RA 5T8KC 4PN3A 3TN7A 4Z3KA 2QYSA 1ZSNA 1T2EA 3NJ8A 1ZJYA 3MTGA 1BHSA 4MKZA 1H6DA 4IJVA 4QQRA 2NTJA 1SOWA 1ONPA 2Z1MA 4EJMA 5C7LO 1UH5A 3TQHA 3JQDA 2O3QA 1F06A 3KYDA 3BZUA 3HQ4O 2VCYA 2Y67A 1VL6A 3WNQA 1MXFA 1PIWA 4M1QA 2DPGA 1T4BA 3L4BC 3ZI0A 2P5YA 3ADOA 1ZK4A 1IZ0A 1X13A 2PZKA 3ZHBA 4RPLA 3ONFA 4GL4A 3S2EA 1PS0A 1XLTA 1I32A 1Z7EA 4NR0A 3RVDA 3VH1A 4AJIA 4CQLA 3HB4X 2NVUA 2P2SA 1XA0A 3HADA 1M6WA 5EPOA 4CMIA 5BSEA 3MOGA 5GMOA 4BO5A 3WS7A 1PJ3A 3FWZA 1IL0A 4XRGA 1G1AA 4BIIA 1G6KA 5GZ6A 2WM3A 4FJ0A 2CDBA 3N74A 2ZJ0A 2CSUA 1LQUA 4PLVA 1WZEA 1UDAA 4XGNA 1NPTO 2WYUA 2J6IA 3EY4A 3GUCA 4J7UA 3LQFA 5I9MA 3DZGA 4DIOA 5DCWA 1EUCA 4IM7A 1U5AA 1PR9A 2WD7B 2DQ4A 3KEOA 2E82A 2JFHA 1W0CA 2B36A 3G1TA 1V35A 3ROKA 1L1FA 1OAAA 3QV1A 3LSYA 4YJGA 5T8KA 1BRMA 3DC2A 3OH8A 3PYLA 1R6DA 3CINA 2FWMX 4BNMA 1I5RA 2X9GA 4FW8A 3V1UA 3QWHA 4JROA 4Y6RA 3WLEA 1ISIA 1DEHA 2AE2A 3LC1O 3DONA 2QX7A 2FR1A 4FFNA 3UH1A 4NQZA 2OUIA 1B8UA 1B0AA 3D64A 4IQ8A 4GX2A 4AJEA 2WE8A 3HN7A 1CIVA 1U4SA 3L4BA 4XR9A 1C14A 2BH9A 1K6XA 2XOXA 3UCEA 3L9WA 1I8TA 2B4TO 3JYPA 3VKVA 1ZH8A 4R5HA 2NU8A 1AA0A 3X2EA 5A9RA 5HM8A 1ARZA 3R3SA 4RJTA 4S1VA 3U4DA 1IPEA 1R16A 4YWJA 1ULUA 3F4LA 1XG5A 3WR5A 4B4OA 4UUNA 1SB9A 2POQX 3QWBA 2NLOA 2EF1A 2G82A 2O2SA 5U9CA 4FN4A 1T1RA 4BQRA 1X1EA 4CM5A 3EC7A 2V6BA 4E21A 5JLAA 4PVCA 3WGQA 1GEEA 4Z9FA 3GPDG 2V65A 1UZNA 1JTVA 1LDEA 1Z7BA 1E1MA 1DIHA 4IGEA 2R00A 2D4AA 4P4LA 3E9MA 3JQAB 1R4MB 4LVCA 4QSMA 4A73A 1DRUA 1Y7TA 1Z74A 3UCXA 4W9NC 3EZLA 1R0KA 4J1SA 4YT5A 3ROQA 4CM8A 3RI3A 5JYEA 4RPKA 3UXYA 2DC1A 3M1LA 1XQ1A 1TLTA 2VUUA 5JE8A 1TI7A 1ADGA 1JAXA 4AJOA 1WW8A 4R68A 4JQCA 5L7YA 3BTUA 1KVTA 2X0NA 4B4VA 2EP5A 1HDRA 3LC2O 3KLPX 4CR6A 4DC0A 3RUEA 3OHSX 4QTZA 3FBGA 1GZ3A 5DN9A 2FRDA 4WEQA 2A35A 2O3JA 2PTGA 3JYQA 4J7XA 4GWKA 4G5HA 5IDYA 3ZWMA 1K2WA 1MC4A 2DFVA 3JTMA 3PVZA 4LVUA 1ZNQO 4AJ2A 4XIYA 3DB2A 3JQ9A 4WLFA 2YFHA 1NAIA 1U9JA 1DLJA 3ZHZA 4ND2A 1CJCA 4Q3AA 3DZJA 1I10A 1EDZA 4QUKA 2DM6A 4AFNA 4XGKA 4AJ4A 4DA9A 3CMMA 1XEAA 2GCGA 1JKFA 4E0BA 1HT0A 4DQVA 4CJXA 2VRBA 3E18A 4J90A 4UVDA 1OZAA 4QT0A 1B8VA 4YTEA 4JJIA 4FB5A 3OIFA 4F46A 1MC5A 5COQA 1U28A 4BNLA 4OH1A 3WQQA 2IZ1A 4JP2A 3GC6A 4ALJA 4WJZA 1QYCA 3TFOA 5F5NA 1EVYA 3QVSA 2FPGA 2ZATA 2Y1DA 1SCUA 1NAYA 2HSDA 3CSDA 3DHYA 2PNFA 4NJMB 3CKYA 2Q45A 3BMQA 5L40A 4I9UA 3TZCA 3MWDB 4CLOB 3H5RA 1HLPA 2VNAA 3IIEA 3I52A 3IUPA 3F47A 4RDIA 4H3VA 2OHXA 1EQUA 1BW9A 1MA0A 3IUSA 1PR3A 1I2BA 4HFRA 4J16A 3DR3A 4QO7A 4RLSA 3PQFA 2XF8A 4XDYA 4BO4A 1QKIA 4IPTA 4DREA 1QV7A 4N5MA 1YWGO 1YE3A 4PLYA 4W7HA 2V6MA 1DFIA 1YVEI 4IS2A 4BNUA 4YACA 4XCVA 2EGGA 5KJ6A 2FMUA 1SEVA 5CG1A 3WNVA 5JDIA 7MDHA 4IUYA 1PJTA 2GR9A 3PYMA 1SNYA 3ZWPA 4CMEC 2F00A 1ISHA 1BXGA 2WWRA 5T57A 1EQ2A 1C1DA 3Q2IA 4BO0A 3KV3O 2B5WA 4XYGA 1QYDA 4H16A 4HNHA 4BV8A 2X5KO 1OX3A 2CFCA 2ZKLA 3DL2A 4PRLA 4XQEA 1T4DA 3U0BA 3D5QA 4FSHA 5BR7A 4LCEA 2C5AA 1N7GA 2EJWA 3IL2A 3PJDA 4YQZA 2WYVA 3RBVA 4LMPA 1ZEJA 3IJRA 4M54A 1I2CA 2BGMA 4E6PA 4LCJA 3U4IA 4BVAA 3FNFA 3ITKA 1LLQA 1YKFA 2GLXA 4CM7A 1LBEA 3PHHA 5CP8A 1W73A 1H2HA 4ZHSA 3AOEC 1ZFNA 3PIIA 5G2OA 3GMSA 1YQXA 2P91A 2GSDA 4HNGA 3GY0A 3C8MA 1MP0A 1ZVMA 4GVLA 5JSFA 5HA5A 3BMNA 4E13A 1NFRA 3DQPA 2QZ9A 3Q1LA 4RF2A 5L45A 3CZRA 2WYWA 4CL3A 3GN1A 1A5ZA 2UUPA 3QY9A 5C3MA 3ROMA 1DFGA 1G0NA 3ANNA 5DBFA 3FBTA 2HMWA 1M75A 3L4SO 4TRNA 3N58A 1LTHR 1N8KA 3GHYA 1YBAA 2TMDA 1PQUA 4OXYA 2EERA 4JBGA 2PK3A 1VL8A 4DPMA 4GMFA 1YONA 1AHHA 3F46A 1SO8A 5DCUA 5EINA 3P5SA 1NHGA 3ON5A 4IIVA 3ZN2A 4AJLA 3JSAA 4NFSA 2ZCUA 5CDUA 3DO5A 1IPFA 4J49A 4R3NA 4CPDA 1VPDA 3KYCA 4BKOA 4TRRA 1E1NA 4FJ2A 3D1LA 4B7CA 4E31A 3GVPA 4J9UE 1GCOA 2I9PA 1KETA 4JJGA 4P4GA 3EGOA 4ZRNA 4NI5A 5KVQA 1F12A 1DHRA 3QJ5A 5L4NA 2WTBA 4HV4A 1ONOA 1P1HA 1VJ1A 4O0LA 3O9ZA 3AY6A 2ZTLA 4IINA 3KM0A 1YS4A 5BQFA 2I5PO 4YYZA 4YJHA 1GL3A 1K6IA 2Q1UA 2X23A 1KVUA 1QR6A 2GZ2A 2A94A 4NPCA 1J0XO 3GAFA 3CXRA 8ADHA 3FPLA 4DLLA 1LDBA 2VYVA
chains in the Genus database with same CATH superfamily
4EIJA 2YOHA 2BC9A 5K3OA 1E7SA 2AOTB 1FOSF 2C2XA 4P98A 3AU8A 2XVAA 4XQ0A 2RHTA 2ZIWB 3R0QA 5GJCA 1XZMA 4R1QA 1G5TA 5C31A 1VGRA 2EYQA 2XW6A 3D8TA 4MRAA 2D1QA 2HSJA 4FILA 3S2GA 2D2EA 1JEKA 2VSQA 4IICA 4EQ6B 1RQXA 4JBYA 3S44A 5LP6B 4YJ2A 3NC1C 4C03A 1GL7A 5E3IA 5HWSA 1NBME 1MTOA 2OAEA 3MOSA 2FW8A 2A45G 1CQZA 1N25A 2G67A 4A8HA 2BE9A 1DXHA 2ZP1A 4FK8A 4H6XA 1M34E 4QYSA 2GAJA 1XEWX 5DOZA 3QGMA 2PYDA 3FTPA 1XGKA 4YCMA 1L7OA 5KHOC 3IESA 3K8QA 1JEAA 1YJQA 4J3FA 5DT9A 3R5TA 1UKYA 4NMMA 1NO4A 3W5UA 3JQ8B 1KAQA 2R6JA 4MR7A 4DILA 4C0BA 4M0UA 4I7EA 4LWQA 1JA9A 1CQIA 2BZSA 2HSWA 3PQ4A 3R5HA 4XPIA 1XRQA 1XZLA 5AVRB 3UPUA 1D07A 3F9IA 2W27A 4LRYA 2O59A 5APTA 3K8YA 4F2HA 2HLDD 2HAEA 2SPZA 3MJEA 3OM1A 3SS9X 1A9QA 2O0LA 2XJ4A 3OZWA 3KPVA 1Z4JA 2GAFA 3HDTA 3OCUA 1YB4A 1ZM2A 1K8QA 5F1PA 2HPCB 1X7DA 2MYUA 1TZKA 2AOUA 2DPYA 3FSGA 3JQ9C 4YJHB 1K1EA 3URMA 4DOJA 1JOCA 1QVAA 4H0LD 1WDKA 5IJ0A 1QG4A 1SMKA 4KX3A 4KUHA 3QVOA 4BRUA 2ZSDA 1RKUA 1YL6A 3G2PA 3H97A 2JKZA 4NU0A 4DRYA 1OH7A 4BBJA 1RWNA 2W9XA 3GL9A 1CS0A 3FGPA 4LYHA 5F2OA 5C81A 4D8XA 4NBNA 4B82A 3CPWO 1E2EA 1G21B 1EKXA 3JATA 5CIYA 3OCZA 2Q3FA 2Y1LA 1JY2O 4E30A 3F73A 2JLUA 2Q3DA 4KE9A 3ZGVA 2Y2VA 2RH8A 3THWB 2YQZA 4EG7A 3L72D 1LVGA 4JGBA 4NU8X 4EI9A 5IN4A 3LECA 4MLPA 2CV1A 4C0LA 3N0RA 5E6UA 4EELA 5TGZA 3T34A 2QTLA 3IQXA 1MRZA 1E6CA 4X20A 5FKJA 1R6UA 2O1SA 2X8WA 1XMOB 1VC2A 1MJNA 5TB5A 2F1HA 4PPNA 3G8BA 5FLEX 3WHIA 1JDVA 2XZRA 1VPTA 3V7YA 2J6HA 3TL3A 3C1OA 3GEEA 1EWVA 2QY6A 3ZGLA 2IQIA 2W6AA 1NM5C 3SDZA 2JAWA 3ILXA 2FSUA 4AI6A 4PAMA 5CTJA 1AN0A 1I14A 2SICE 4MUMA 1JKJB 4UVGA 4KODA 2K6GA 3T52A 2JGMA 4UHDA 1LC3A 4OX9Y 1YBHA 5SYNA 3VH3A 1J2JA 4NC9A 4BRYA 2HPAA 3IQZA 2BI8A 3EXEA 2YY6A 1ZJ5A 3E3MA 4Q24A 5L8RJ 3VTZA 4MDHA 1WS6A 5EZQA 1F14A 4QBGB 4RZUA 2M6KA 4XTRA 1FXWF 2XCSB 1G7RA 3OKCA 2IIVA 3MTBA 5CPBA 4MV6A 4PVDA 4KHXA 3AEDC 3JALA 4LS3A 2YIUC 4EGFA 4RWEA 3G0CA 4URUR 2E76C 1ULBA 2QIPA 5ITSA 1ZMXA 3IHKA 1U7UA 5IT5A 4Q47A 4QDZA 3WZLA 4WXHA 1ZWKA 1QU3A 3MCTA 2FMTA 2ZSAA 3CR3C 3HM9A 3QMMA 4IMPA 2HU7A 1LDGA 5JQGF 1KJNA 1XTIA 1YBKA 3K1TA 3O2NA 3V6MA 3D81A 3WLFA 2CHEA 4MVJG 1FLVA 4PV7A 1ZKMA 5SYMA 4KAJA 1O1YA 1YQTA 1WPGA 2IYQA 5LJIA 1USIA 1EA5A 2PMWB 3QLTA 4UUAA 5AJZA 2HCJB 3D0OA 2Z6VA 3ELBA 3QBTA 5BR4A 2ZI4A 4QYXA 5CMLA 1GKUB 1HTLC 1QBGA 2V9PA 3DDWA 4Q39A 1U7JA 2RHHA 1BXZA 1AKTA 2JKVA 3D1VA 3H42B 4ZQBA 2O2GA 5JC1A 1K9MQ 4HLUA 5JOQA 2D0DA 1HZZA 1NJ2A 2RSLA 4EZBA 4HNAA 2CHUA 2Q5HA 4D96A 1KFNA 4DCNA 1GL2A 1KZUB 1GITA 3QEMA 2WWHA 1PUIA 3AUXA 2VJMB 3OX4A 5FUWA 1MVOA 3CEHA 1UT8A 4DY4A 1TU0A 2A92A 4Q7QA 4P8RA 5BSHA 4K8OA 4I4TA 1IK9A 2CVFA 1U3CA 1EJBA 2E1PA 5H83A 4F85A 1SD5A 4CN9A 4EX7A 2CD9A 1KQFB 2I3AA 1TXGA 1Z5WA 4KAXA 1FDUA 1IYZA 4F93B 2B92A 3ESRA 5KOJA 2R1ZA 1AKNA 1KH3A 1HK7A 4P4NA 4KQ9A 5FOQA 4XX0B 1QL1A 3GW6A 5IRCD 1GU5A 1PT7A 2GERA 1SA0B 2PSSA 4OHBA 2D5AA 3HUSA 1KMQA 3NIGB 3R0ZA 4QUIA 5FPYA 4Z7QB 1RYEA 1WMBA 1EUZA 1EVIA 1IHOA 3AF2A 1PS8A 2ZEJA 3CFYA 4IILA 5DXFA 1K97A 1TA9A 5H0IA 5TC4A 4Y2XA 4DCJA 2ADMA 2WHEA 4E7PA 4WCFA 1ZVKA 1GUDA 4PG5A 2QTVA 3BE6A 5HKBA 2OD2A 3MT8A 4BX2A 1T2DA 2G72A 4WUVA 4I1SA 1LW6E 2QZZA 1PWEA 2QMZA 1AMNA 2VUTA 3HJUA 4DSZA 1H93A 1S8NA 1NW9B 2QQGA 3RGWS 2PRSA 5BUCA 4QVIA 4KNYA 4L02A 2ZIFA 4L72A 5AKKA 1JU4A 2DFDA 4M1TA 4EDHA 1WBJB 3DV0A 2QRKA 2YXBA 2BHSA 5AI9A 4CHTA 1VYUA 2WABA 2R1VB 4FIDA 4PQFA 1CZNA 1M7HA 3VC7A 2IDKA 1SUSA 4GLJA 3BEOA 2WQZA 1DCTA 1ABBA 2E87A 4B5KA 4PSKA 2D1TA 1JEQA 1M83A 1XNJA 1A5BB 3BWCA 5B3KA 3D4BA 3IH5A 3M6WA 3QHPA 3LP8A 3Q0EA 1PWZA 2I29A 5IHXA 1RLMA 1VQ6P 4HH4A 4NECA 5A4FS 2KNCA 2CN1A 3A0RB 3IFMA 1PTKA 1C9NA 5BN1A 2RGNC 2PMDA 3L75G 4JB0A 5LDGA 5B64A 1KZ6A 3G9TA 3TTWA 3N6RA 1L7NA 3QF4A 3WB1A 3T1TA 1Y3BE 3H1LG 2H4XA 2ZYSA 3PUIA 3JQFA 2G7MC 5FWYB 5H80A 3VAYA 4AWBA 5AVYB 1XTUA 3O7MA 3NP9A 4O6VA 4ZYWA 3CCEP 3DMGA 1TTQB 4MCAA 2OKGA 1FNMA 4QQ8A 2J30A 1CDZA 5ECDA 2R44A 4N9QA 5B66H 3AHDA 1BGYD 3GV0A 5ANRB 4PONA 3O75A 4OHOA 1I3MA 1SCQA 3TPFA 1DEAA 1NSTA 4J0EA 3GNQA 3GPBA 4IDNA 3W4JA 1FK8A 3KHUA 1MG0A 2CHFA 3LFTA 4YP0A 3WBKA 4DSAA 3RK3E 3GGGA 3TLZA 4IJQA 4QDOA 4AUEA 2I80A 5JATA 2LKDA 1YT5A 1DLIA 2XRZA 2D2VA 2HI0A 4B3DA 4H1WA 4G5RA 1RC0A 1V6CA 1GLVA 1OMIA 1CWUA 4ARAA 1DHTA 4BASA 4BV9A 3G23A 4KRFA 2VT6A 3U7QA 2PRYA 1RWXA 2X8LA 4ZKUA 4GNKA 5DO9A 1KAEA 1E6MA 2FP3A 3E1GA 1T2VA 5J58A 3AF6A 1OAKA 1PG2A 2VBIA 3AEQB 3M1AA 3QA9A 1AURA 1ORVA 3TJZA 1PT8A 2YKGA 3KOUA 4LV5B 3W1VA 1CC1S 5DN6A 5TISE 2OA0A 4C07A 2WKRA 1RE0A 1DO8A 4X6XA 1FS4A 1N6RA 5AKEA 5EJ2A 3OZXA 4ZJUA 4IEFB 3GRZA 3V8EA 5TMPA 4O9BA 3LXUX 4LZWA 4EKDA 4XB2A 4ZO7A 2OP0A 5HRAA 1LJ8A 4OO3A 3O92A 4IDAA 2Z5GA 3ZWOA 1SQVD 2AYXA 5CCGC 1K06A 2M5AA 3KPJA 4YAJA 1RJFA 2PMKA 3AY7A 4HXYA 4PYQA 1E5QA 3PHLA 5ADWA 3MTUE 2JLRA 4EKNB 3GEHA 4F4UA 5C9ZA 5LCXA 2HZ7A 3A1VA 3PC3A 4E5MA 2P7HA 5KKAA 1ZI6A 2RK4A 1E0DA 3GMIA 4NYIR 4RM3A 4KXVA 2QTAA 4XVQA 1E98A 1NMYA 4CM6A 1U1DA 5BWNA 721PA 4H31A 3CB2A 1UANA 2C2OA 1BA2A 3H6GA 3L05A 1W44A 5CPFA 1CUGA 3SFZA 3GW8A 9ABPA 1XNHA 2RONA 3L5OA 1NWCA 1XHFA 4ITRC 1W4AA 4MCJA 1M8JA 1Z2EA 3HDHA 5TS2A 3TLJA 4BGUA 4YAIA 1DWUA 1YR2A 2Q3LA 2YV3A 5AK5A 2A1TR 5JCOA 3U4MA 1Q95A 5AM4A 5BN5B 3WYBA 2A45I 5DI3A 2AI1A 5LMUB 3ZJ5A 3QVXA 1F48A 3A1EA 1AHPA 3U6BA 4UOZA 2VTBB 1OLOA 1PZGA 2V8OA 1Y34E 1NTZD 1N86A 2PL3A 1LCIA 3DCNA 5F1OA 3E0XA 3T12A 3E1SA 3VO8A 4FNGA 5I9SA 3UAZA 3X2SA 3MHPA 9LDTA 1J56A 5F3RA 3PWKA 2PH5A 4ZI3A 3BFPA 4I9NA 2P4UA 1CUDA 1OJ7A 1VB3A 5C37A 3EBLA 1MT0A 5JDCC 2OV4A 3DZIA 3HEBA 4URVR 1AQIA 1VPVA 2Q21A 2J85A 3LCRA 1X77A 2FZWA 3DZKA 4K03A 5IJXA 5K3CA 3G13A 1L0LJ 2HO5A 1DEXA 3CIFA 5KAIH 3HWWA 3LHKA 3QBJA 4JWKA 4Q18A 4WY8A 5HYVA 2V5VA 2GK4A 3F2VA 1JZQA 1Y6RA 3EXHB 3KQGA 2YV1A 1JE1A 2VYVD 1SQBE 3GP5A 4QBTA 3U26A 4C5AA 1UAAA 1M1NA 2VDNB 1PR6A 4MGEA 4CV0A 4DARA 1LVUA 2KS1B 1USGA 3QLVC 3CE6A 2BHLA 4D5GA 1E9VA 2AFHE 1H8HD 2H2HA 4RVSA 3VMZA 5LDDC 1R3DA 4KGXA 1J1ZA 2QUZA 4V0SA 1RYFA 1TZCA 2G9UA 1IE3A 3EVEA 3HO6A 2XYVA 2XCRB 1XMQB 2E4UA 1KIAA 1NDHA 3IUBA 4HI0E 2R6ZA 4PFJA 3D7KA 4OGKA 5E7QA 1CKEA 3WYAA 4D97A 2BDTA 1C9KA 3AP2A 5DHTA 4GR9A 3I83A 3HXTA 4D92A 2O8DA 1FFWA 1W2GA 1ZU5A 3GDFA 1DJNA 2F4NA 2F67A 3CRVA 3R7WB 4BB6A 5K8LA 2IPNA 3FRHA 4JLAA 4K9NA 3ETNA 1CNMA 1FDTA 3OO0A 3CGGA 3IDSA 2R8OA 1A9YA 2W6ID 1TB4A 3L7JA 3MFQA 3B82A 2BKUA 4AECA 3IEUA 5B1DA 4D3YA 1AXRA 1FXWA 2HV8A 2JGIA 1BIFA 4JJ4A 3AVUA 2JDIH 1L5YA 2VHYA 2ZU6A 4RHCA 4A2CA 1RHMA 1L5FA 2YQ4A 3GDWA 3QWFA 4RNCA 2ZJZA 2JFFA 1E5XA 1XZJA 4F71A 5AICA 4NV3A 1E9RA 5FPKA 5APYA 2UYYA 4OQFA 1SKAA 3CCFA 3CE9A 4NLLA 4OAOA 1O3YA 3ZQ6A 1ZR4A 1ZEMA 2V7PA 5HDQA 3EVNA 4AKIA 2BHNA 3OZFA 3QU2A 2AG5A 2R1UA 4GIBA 4ESVA 2OCPA 2RD2A 2QPLA 1D4FA 1G3QA 2GCOB 3EN0A 3KSDO 4R1OA 3QEKA 4HYYA 2EKBA 4AZWA 3RUAA 3WGLA 3QOYA 3NCTA 3Q7RA 4RXMA 1GARA 3REFA 2C82A 5K0SA 4EGSA 3RUCA 9MHTA 3M0DC 2BDUA 1EBFA 2V7VA 1KOGA 3M82A 3DW1X 3JARA 1FVXA 5BSMA 3D3EA 3DBVO 1KXZA 3H7IA 1TMKA 1U8CB 2NXCA 4JIGA 3H9UA 4FFWA 4Z7JA 2D1YA 5B6JA 3PTAA 5JAQA 3JCUH 2ZJ3A 1QPZA 4ZK6A 2J59M 1J23A 3CONA 5LJLA 4EMUA 5CX4A 3ZYZA 3DD5A 3EZYA 5KJ1A 4X64B 5CDFA 2ZJBA 3O1HB 5ALYA 2EGUA 3CX5D 5BMVA 5CM8B 2ZRQA 2HLHA 3H17A 1SWVA 1GTL1 1QNLA 2PQ6A 1WB4A 1GNRA 1PNVA 3NJRA 3FTCA 2C78A 5EY5B 1CJKC 1M1JB 2IIBA 2WF8A 3OLVA 4JLOA 5GM2A 2IPAB 4IGKA 2FDRA 4HEQA 4WK0B 3V9PA 5DHRA 1YKSA 4NCBA 1JSLA 5EIAA 4L5BA 1N2DC 5CHYA 4CKWB 1B93A 4JL8A 4TL9A 2KSQA 2VLIA 3LCUA 2L69A 1MUUA 4FKZA 1JFFA 2YKPA 5FWXA 1QNFA 4DIFA 4OM8A 1Z25A 2ID7A 1FX0B 2Q8PA 1ADJA 1DV1A 5A1TA 3RSOA 5FRDA 1UAGA 3M49A 1NI4A 1NTKE 1E3WA 2DUUA 2CNKA 2V96A 3FVVA 3GJ7A 4PW0A 3NOXA 1KPHA 5GV7A 3DLHA 1C1HA 4YP5A 3QYJA 4F1WA 4MUXA 2R751 2O8EA 1JIUA 2C9NY 3AZQA 3CXHH 3C1TA 3GPCA 4PHFA 1KYYA 3UOGA 3WIUA 2LGJA 4XIGS 1FZFA 3VC2A 4CL2A 4NU5A 1VECA 2ACEA 5JS6A 1DIAA 3BXOA 2HT6A 2IS1A 4JX9A 4U1RA 5APQA 2VG8A 4XGRA 6YASA 1KJ9A 4R05A 1RQ7A 4FN5A 4JLVA 5CYPA 5GONB 2D2CB 5C8DA 2W83C 4AICA 1BD4A 2O8VA 1E5VA 1LSUA 1N3YA 1SC6A 2XE8A 4JOCA 1DEBA 3BCCE 4LYGA 3LK6A 1VTKA 1ZK3A 3V8MA 4KMOA 2C2KA 1C2TA 2VDVE 3O4RA 4I55A 3HN6A 3FYDA 1CFJA 2YHUA 2PXCA 3B3GA 2YVLA 3ICOA 5C80A 2C4VA 3E5NA 2Q5CA 2QU7A 2P9BA 4JLBA 3HBLA 3UAWA 5KYUB 5CT8A 1VZ2A 2Y6UA 1YASA 4PJ0H 4KXQA 5ALOA 1GLGA 2Z2XA 3PXCX 3BKWA 3A9CA 1ZIDA 4JJ7A 4AM8A 3P0FA 1E9SA 3ZD8A 3NBMA 1B6GA 2GPNA 5ISMA 1EX9A 1NVTA 2I6TA 3QLUA 3ZS8A 4WLNA 4WZAE 3HHPA 2FR8A 1X1RA 5IKOA 3QHQA 4L76A 3CX5H 1IZYA 1WV0A 2O06A 3DBRB 3H1BA 4L85A 5TEVA 5I7UA 2GYYA 3M2PA 1HH0A 2NYRA 5EUQB 3K5HA 1P7ZA 1GUFA 2Z8ZA 3KYIB 5LVAA 1N6PA 3NVAA 1O9GA 3WMRA 1L4FA 3I0MA 4FDTA 3TLMA 4ZYTA 5IDXA 2D1SA 3W0LB 5K99A 4HH1A 4WWIA 1T6XA 1TUBB 1G9XA 1U5CA 3EZNA 4P2GA 3RK0A 2QJWA 2G17A 5GM1A 1FNBA 4MQ5A 4N0PA 1T2UA 3UAVA 3ZGYA 3DAYA 5BSGA 1U1EA 1KU0A 4JFRA 3Q2OA 1E1YA 2Q41A 1JALA 2QJKB 2YWXA 3IPRA 4QPJC 1OI3A 3L6UA 3OJAB 1F2TB 3DT8A 5E9WA 3THRA 3ETDA 5H5JA 2DETA 2JNWA 2HRBA 2XCQA 1EXMA 1ZOLA 3CLQA 1BHQ1 2Z04A 4ZP1A 1FFBA 2FSVA 1TJ3A 3UJHA 3WMM0 2X5XA 3DKPA 4IJKA 3PG5A 3WP0A 1ZV8A 2JIZA 2CYAA 1LNSA 2ABWA 2OLJA 1P1FA 4G6ZA 1N7IA 3CC8A 3UXEA 3VNRA 4ZCMA 4GOOD 3UMFA 2YX1A 1BE1A 4YJ3F 2VAXA 3L8EA 3A3YB 3RK3C 2LW7A 2GM3A 3HKEB 3ZE7A 1U0HC 1RC8A 3UMCA 4KYIB 5CB4B 1AHNA 4C3VA 3KIPA 3PK0A 1AXGA 3RBZA 3L7NA 4U0KA 1Y4ZA 2EFCB 1C30B 2FJ0A 2HJ9A 3GJ8A 4HC4A 4MKRA 1NZDA 1TJNA 2IODA 5FUVA 2WSIA 3WYFA 3ICQB 1P0PA 2I7TA 5KVSA 2JFUA 4C04A 2IRWA 4JLUA 3LUAA 1MKMA 3V8QA 5JAPA 1ZA1A 3ZDFA 5KKNB 3L7IA 3AV0B 3UB3A 1CUBA 4OCZA 3WWZA 1V1RA 4R4MA 3OFSA 2LKCA 2AQKA 2XUHA 3SR4A 1VQPP 4TSFD 3GDOA 3MGGA 1NT2A 1NVAA 1KFJB 3K0CC 3CSUA 1Q7YQ 1SQQG 5ENZA 1JG2A 3A9RA 3CN7A 3EWIA 4KQCA 5ILGA 5E4FA 3OSUA 4N8SA 5BQOA 1I3CA 4IHKA 1R12A 1WHSA 5ECYA 1BTOA 5FTWA 3TDMA 3HGTA 2E2WA 3RK2C 3H65A 4B83A 1TA0A 2HQ1A 1WZCA 3SZGA 1R6XA 1UZMA 4M7PA 5M34A 2XUOA 2IYFA 2B2XA 1E5DA 4B3IA 4YONB 3ZWWA 4JKYA 3ETGA 4CMGA 1KI9A 2ECPA 4Q03A 4C06A 2NVUB 1IRXA 2POCA 3WFJA 1OX6A 1CERA 3MJCA 4FMBB 1D1PA 3R5XA 4GKAA 3REQB 3V7NA 1SQ5A 4M1ZA 4ZCLA 3WOHA 2HLPA 1QQAA 3CH4B 1M1UA 5D84A 2QRPA 2QRGA 1E18A 1NXWA 2Z08A 1E59A 3L1HA 4LI0A 3WHKA 3JWGA 1MV5A 1FOEB 2WILA 2C84A 1P5JA 2C9BA 2C1ZA 5H70A 3MCUA 3HKDB 2OHGA 5IP5A 4NOLA 3GLRA 3RSSA 4QJBA 1SU4A 4D41A 3Q8WA 3BH0A 4EM6A 3I1IA 1UFKA 4IO1A 2B8NA 1QG6A 1Z4NA 2F62A 2H1VA 3LBNA 5B6IA 2IBSA 5KNDD 2V7XA 5EG5A 4E08A 4D0GA 3H1TA 5KMGA 1SD1A 2A9QA 3KUDA 4L8WB 2O9JA 2Z2JA 3L49A 3UQZA 5AKJA 2AQ8A 5IPFA 4KU4A 3RVQA 3PUWA 4WBAA 3COVA 4PZ9A 4UARA 5AVQA 4J1NA 2QL6A 4LISA 1IZ9A 2ZANA 3WFIA 3CLKA 3VR6H 4CDMA 4HNTA 5JYDA 2FQ1A 2DU8A 2N1TC 3E5MA 3RSCA 5FPPA 2HJVA 3U40A 4L50A 3TTTA 3AZOA 1V25A 3K94A 3JAKA 2FU5C 1H0SA 1K8RA 2VBGA 1KAHA 2I66A 3CF0A 1Y1TA 1MOSA 3MJSA 5JFOA 2NTVA 5BSRA 2JKYA 3AEUA 2XI4A 3NVDA 4PU0A 4XQCA 4HDAA 3P0JA 1IWPB 1TO2E 2DTDA 2O2ZA 5C39A 1T4MA 3OE4A 3UBTA 1RHUA 3DWEX 3LY7A 5KU1A 2O7RA 5IT4A 3WA7A 3HJRA 4ZQGA 1LRLA 1KO5A 2Z1NA 1AF7A 5CCGD 1HZZC 4DDMA 1IQUA 2A9KA 3GH3A 4K3UA 4Q66C 1P29A 2EQAA 3L4KA 1G3RA 2XBMA 4AG3A 5I7WA 1US8A 1VKRA 3NT4A 4H13C 4RD2A 1PP4A 3NGXA 5DTQA 4YIHA 5KOIA 4G0WA 1KEUA 2O8DB 2M5AB 1L0NJ 1JHQA 3T9BA 1B16A 2B0JA 1T9HA 1P72A 1UWVA 1VI2A 2FETA 3IGFA 4PC2A 5TMEA 3UEOA 2VYFA 5DYYA 2GCIA 2VPTA 3F2IA 1MABA 3RUPA 1N32B 1TCCA 4DR2B 4M4SA 1DAIA 4RCYA 1SBYA 3VYVA 2YXQB 1XR3A 4LJRA 1OV4A 4B6GA 1N7SC 4G4SO 4HDKA 3ZWCA 1EB8A 1XQVA 1V43A 4WKBA 4ENWA 1PNRA 3M4ZA 2V3CC 5IKXA 3H5TA 4QDXA 1TT5A 1PPJD 1VP3A 3HV2A 5AP9A 1U7TA 5TQVA 3X1ZA 4D1YA 3KQKA 5FTMA 3KR2A 1YMQA 3CZQA 5AKHA 1FYVA 1GQSA 3ILHA 3MSXA 3SSAA 4EUEA 2ZE5A 1WXEA 4Q21A 1G5QA 1B76A 5HS6A 4DR6B 3KX2A 5REQB 1N7JA 3QYFA 1M5TA 2AX4A 1EUDB 1CRPA 4PS1A 4DJFC 4RQTA 1SXJD 2JEYA 2WV7A 3OTHA 2WINI 1ZCBA 1TDJA 3NEJA 5TJ9A 4KE6A 4IZIA 1ZD8A 3VI4B 5DRTA 2QX9A 5B58T 3ZBTA 4UJ3A 1FMJA 4FOTA 4O5OA 1YFJA 1Z06A 3MIIA 4WK2B 5JI3E 4X97A 3HJAA 2C5HA 3CG4A 1NP7A 1V5FA 1XKTA 3UK0A 4QEZA 3ZV4A 4ZTBA 5CFNA 1O0CA 1BGYG 2QMOA 3DQZA 4H1TA 2WAOA 1GZVA 1VG1A 4TT8A 2P4HX 1QZTA 3TZBA 3HJFA 3RYIA 4ZCRA 4FZ3A 1UFRA 2G63A 3H5OA 1T3HA 3C24A 3ND6A 2VJDA 1ZK2A 2C8KA 2YJ5A 1O6CA 1QB7A 3LYAA 1AK2A 3ORHA 4MUKA 5FOSA 4C7OB 3JALB 2JARA 2PUVA 3GGSA 3ISJA 3ZNOA 4QJ5A 1J39A 3ZW9A 1CQWA 1JNXX 1NOIA 4H15A 2A7XA 4XYBA 4D82A 1KILE 3D4OA 5BOSA 4KWTA 2Q1KA 1O97D 1E7WA 1L2TA 3OD1A 4FP9A 1HSZA 1XVVA 3BF8A 4BN4A 1ZJJA 4KT0J 2HSGA 1AQLA 4JEMA 4KSYA 3ICVA 1UQUA 4KXLA 4XLTA 2OFFA 2KXPB 4CLXA 4UAUA 4L74A 1KQ3A 4ILEA 4Y9TA 4FWTA 1E69A 4LGMA 4UUMA 4DKJA 3KJFA 2VDLB 1MPTA 2RGAA 1YITP 4LDNA 1XPRA 2RHLA 3T06B 4S2UA 2IU4A 1QEXA 1A5SB 3KXIA 3UICA 3CGWA 2WTNA 3KSBC 1EP3B 2BY4A 1GTRA 2PLRA 3H6HA 1OGJA 1NW7A 3PEVA 5ARBA 3O5AA 2GJ4A 2P9GA 1BQ3A 3DTVA 3KTDA 3QX8A 1CQPA 4Q37A 1V7QA 1N0UA 4LJAA 4QGHA 1QYWA 1PP9G 5T67A 2C5BA 3H1LE 3E03A 5LQDA 3KCNA 4BVGA 4QRHA 4F8YA 2ZTVA 2K37A 1T9GS 2BPOA 3MWYW 3PVCA 4OOFA 4Z4EA 1XNGA 5JNUA 4FX5A 4QL3A 2WU4A 2V97A 5AVOA 3LCCA 1J1EC 3WL5A 1X8LA 4ENSA 3FYUC 4HHEA 5J2TF 2WIDA 4XWAA 1AGYA 3HRNA 3IBTA 5C8YA 1O6ZA 4M9CA 3RVKA 4FMDB 1TJ5A 2QUKA 4GC9A 2EFGA 4B4WA 2PUBA 2BMAA 1EIWA 4NYIQ 3SPXA 4OL9A 3WK5A 3LDHA 1LVHA 2D2FA 2AQHA 3PE4A 4RVNA 1FQWA 4D6XA 2Y77A 4WBSA 3VSDA 4F91B 5JG7A 1L4KA 3HD7D 2A1UB 3PZBA 5IUNC 4KNVA 1N6OA 4OB6A 2PXAA 4QXMA 5AI8A 1YHQP 5DW3A 4EUSA 2F8LA 4JY7A 3S2ZA 2PA0A 3G0DA 1KKUA 4D57A 2YXPX 1YC5A 3TCXB 4KLAA 1JF8A 3PX2A 3R3VA 3INTA 4ZDJA 1Q3HA 2QTTA 4LSWA 1J0AA 1SU7A 2H2AA 2XMPA 3GRRA 4ZU3A 1FU1A 1ULTA 4GOKA 5L3QA 4WKOA 5F77A 3BATA 3VZRA 1H05A 1XRSB 2HXGA 4V0NA 3NBAA 4AZ0A 1GU4A 4B7UA 1CY6A 3NOQA 1HNXB 1T2NA 2WUGA 2P67A 4I3GA 4Q3LA 4XFKA 2R85A 3DNMA 2G9NA 3WGJA 4AIIA 4ZJZA 5AW1A 1LPSA 3O8BA 4LBVA 3NHWA 1K5GA 1WY7A 1E8MA 4KWCA 2PLFA 1KFBB 1OH5A 1YMVA 1X1SA 3JAWB 4TYWA 4E4YA 2C7QA 3B6IA 3IO5A 3BTOA 5LP1A 4EO7A 2ZQYA 3T9DA 2OHJA 4MR8A 4EAAA 5JEEA 4KI0A 2X15A 4QGFA 3W8FA 2IDJA 3UH0A 3B4SA 3VHXB 4BJ1A 4Z4IA 4M87A 5KLVJ 4J43A 1P6XA 1QTQA 4ZRMA 5JZOA 2NSHA 5JVDF 4HFMA 2QW8A 3AZPA 4NYMR 5EIFA 1TZMA 2D3TA 4WB4A 3CSSA 2XCIA 3QVUA 3HCDA 2NVOA 1Z47A 2YO2A 3EXAA 3FTDA 4MV5A 1OCEA 4O2AF 4W82A 1OFIA 2D5LA 1X1DA 2YIVX 5KYWA 3ZS9A 1LLFA 4F2GA 2XMCA 1FBNA 3LW8A 4NBUA 1ZY2A 3VJLA 4L6AA 1XVAA 2BUAA 3QVWA 3ZZNA 1ZGHA 1E7RA 3OIUA 4YHBA 1TKCA 5IAOA 4C29A 1B14A 3O3OB 1QB8A 4TVSA 2R6GA 4QPCA 4FE7A 4IWNA 1YS6A 4OLJA 3G68A 3Q1MA 1GQOA 3IRVA 4Q01A 1XXLA 1RPAA 1UPUA 2P5UA 3BXGA 1AV6A 1DCFA 4PX5A 1GN9A 3EZXA 3QWIA 4HXGA 4KNWA 2QSJA 3CZAA 1GGEA 1AGXA 3MMZA 3G3EA 3RH0A 1SQVE 3JASA 3GZTB 3X1DA 5CFLA 5HKLA 1QGDA 3KXLA 3QU9A 4CT4B 3H1KJ 3GLKA 2ZIGA 5EP2A 1RF0A 4G8JA 3TYXA 3OMWA 1RAHA 1CZHA 1S2NA 2F3QA 2VQ3A 2YN0A 4OHXA 2G70A 3ODPA 3OEHA 3EEOA 5LA6A 2IHTA 3LUJA 3OMXA 4M8SA 3TOXA 4JXJA 1FUIA 3PC6A 5DH9A 1KQPA 2P6OA 2ZLBA 3LDFA 3VRHA 3HWSA 3ER9A 1RIFA 1T1SA 1W0KA 4FOPA 4MS1A 2XXAB 2YUTA 2QKYA 5CFRA 1N2CB 1XTKA 2JIQA 4BO9A 1PJSA 5J4LA 5CU7A 5F2EA 4LKOA 1HYGA 1QV6A 2QZJA 1JLHA 1RYYA 4Q3EA 2QG6A 2Q4BA 3WHPA 2ZFUA 3P9QA 4BNGA 1QIKA 4KTVE 3DTTA 4QZVA 1O7JA 4DCGA 4DT1B 5JNSA 5LQJA 4S04A 1WEKA 3X0DA 3OAAA 4EZIA 3VX4A 4NBWA 2Y1OA 2EBUA 3SBEA 4DLKA 4OHUA 4AS3A 5I9LA 3DHEA 2IEDA 5F9MA 2PX4A 3V2GA 4CTOA 2IZZA 1OYYA 2PKEA 3QEMB 3LQ2A 1PJCA 4PLZA 3ZLUA 1AZSC 4YV7A 2ZAYA 1YK1A 4F11A 2R3SA 5JVDA 1T13A 2HRDA 1PQ4A 4PGHA 4K28A 3DM9B 1A96A 1KZ7B 2UYGA 4OKNA 4YRCA 1ZZEA 3ZY6A 2Y2UA 4NAVA 5K4HA 3ZHQA 1SQPE 1TT5B 4N6NA 3A0BE 1PK7A 5D3QA 1RYDA 3ZHTA 1T2CA 1AFOA 3BMCA 3MW8A 1EFDN 5JMPA 3KZOA 3UJ3X 2W2QA 3NAQA 4EFMA 3CUSA 1W30A 4FGSA 1GPBA 4ESEA 3EG9B 5LUAA 4GZLA 2DPLA 3LT2A 4N5LA 2CXXA 1H5QA 4WNCA 2PMFA 1H4VB 3PUHA 2C96A 2JRCA 3RC2A 4PSCA 1COWD 3SAJA 1EVJA 3OX3A 3FWHA 3P4XA 1NFQA 3W2EA 4B76A 1U2QA 4KKXB 5KYNA 2CEAA 1HDXA 3UPTA 2CCKA 3O9MA 3FTQA 2WSBA 3CZPA 2P1JA 4MW2A 1EXWA 4HDCA 4ECEA 2V45A 1DRVA 3CLVA 4OLHA 5KTTA 1EXJA 3QE3A 1HX7A 1QE0A 5JH7F 4H7HA 1R0LA 2MTBA 1J2TA 2O1JA 2BZGA 3H8JA 1Z22A 4UJ5A 3L71D 4ZO8A 2JD1A 2HH9A 2OHOA 3KQMA 1ZUNB 5AKXA 3MLBA 1E7YA 1EVLA 3WLPA 4TLLB 2AT1A 5EFWB 2VCHA 3DEIA 1UXJA 2J0QA 3GUUA 4WY4C 3JD2A 4FMPA 1HBJA 2ZETA 2R1VA 1VQ9P 2OYHA 4FEGA 3WIDA 4ALKA 4KMSA 1ORDA 4EA6A 4BEVA 1CR4A 2PD3A 3D2CA 4XYEA 5CYOA 1FE8A 4OJYA 4NCJA 3I9JA 3A9TA 2VPQA 4KDCA 3WGHA 2AZXA 4UTPA 1PI3A 2Y71A 1QC5B 2WHRA 1C1XA 1SG0A 1JHZA 1SUBA 1A27A 3LYLA 4FFRA 4L5CA 3FRJA 2NSYA 4X54A 4FU0A 3UN1A 3W34A 4E51A 4F4FA 1KO8A 5KO2A 3TDKA 1ADCA 2X1MA 3BIFA 3LDGA 3ZWAA 4GX1A 3BMNB 3B6ZA 3EHEA 4LRTB 4Y9SA 5MGNA 3NLLA 1EM8A 4DWOA 3BRTB 5HSGA 3F7MA 2VRNA 4OJQA 3SX0A 5JSQA 2Y1GA 1B0PA 3HKDA 4IJ6A 5CT4A 5BXYA 1JY3O 3DYIA 3QK7A 2FZ4A 4KQHA 2BFCA 4GUAA 2DWPA 1G21A 1NN0A 4LYYA 2Z5LA 3DV9A 1I6KA 3JQ6A 5BRJA 3VPSA 2UKDA 2PGOA 4HQNA 4WCFC 1XALA 2BCCG 4RSGA 3U17A 3NOOA 4DBZA 2DHQA 1OXUA 3ERCA 4ZV9A 3K6SA 3ELYA 2VYCA 4RMNA 3QVLA 4Z5XA 4IHJF 3R77A 3VNUA 1SUWA 4XX1A 1UPBA 3I6QA 4KE7A 3UHOA 5J5CA 2ZWPA 4AK9A 4MWSA 1Y1SA 4WN9B 4BIMA 4R1NA 1Z5NA 2IHJA 5TJHA 1RFLA 2PAAA 2XQGA 3LIPA 4LKRA 4Y2QA 2PS0A 4CNQA 3D7RA 3Q7QA 4HOYA 5J5VA 1V0JA 3VYUB 1NBHA 5JU6A 5EEGA 3V8VA 3C4VA 2XYRA 1XO1A 1YUMA 1V7CA 4FSDA 3N7AA 1VMEA 4ZOAA 1O87A 1XTCC 4XLLA 1FS0E 1SQBK 1Z6YA 3ZWKA 2E85A 4XH9B 1ZINA 4L78A 3JSVC 1MIHA 4RVUA 3RSQA 3V4QA 3VR6A 3R6TA 3ZDZB 2V4UA 2GZ1A 4BNXA 2BUCA 2G40A 1DX9A 4BNDA 4ZN6A 2A06D 2DFTA 2K87A 5KDDA 3VU0A 1N5JA 2W2KA 5IXJA 4XA8A 5FL7A 3MUNA 4ZZ1A 4RTLA 1AVTA 2ZB7A 1RU3A 1V8DA 3ZW7A 2WYOA 2Q3HA 3LYUA 4LYEA 4NCNA 5DTIA 3OICA 4DZRA 4Z9YA 3BZBA 2CCGA 1P1RA 2IZOA 2GWRA 1DKRA 3EA4A 4IJUA 4JX8A 2CBGA 1YZNA 3NAZA 1KFKB 4OQXA 1M9NA 3KOYA 1QFJA 4GXNA 4O2BA 2ZAMA 4KQIA 4OHRA 2UZ4A 1QFYA 2XZDA 3AFHA 4FD3A 3I42A 3B9RA 4FX2A 2KZIA 5GZ6A 3WMGA 1X7GA 5CLLA 3KPWA 1SLQA 3BE5A 4RBNA 3PFHA 1IXKA 4BBZA 4NXNB 4UUOA 1XBTA 2GFQA 1X9IA 3N8DA 2FFDC 4JVMA 3IAS1 3N70A 1I9GA 1P6UA 2XDWA 1WX1A 2AR9A 4MSUA 5AJYA 1HA3A 3AJAA 1N2BA 1F38A 1MB0A 3PIRA 1R9NA 4I1VA 4AAYA 3D4PA 1JDTA 3SMQA 1RRCA 4EHLA 5AW4A 4CYMA 5AW9B 4EQZA 1JLKA 4F9GA 5AUOB 3JU3A 3MWJA 3V2PA 1V47A 4EJ6A 5KNDH 2VJYA 1Z29A 1B0ZA 3G2MA 4IFFA 4OVKA 3LBIA 3RB8A 4EY5A 1MZPA 5JTUA 1Q2NA 2FBWC 4E15A 1RE3A 1SQGA 3OPYI 1G98A 3L41A 4MR7B 1Q7CA 3EIXA 4MA5A 3BCCG 1FBTA 1IK6A 1A72A 5WRFA 1U3DA 3VNBA 2HYDA 3LT4A 1EFTA 1N2XA 3A9WA 3FMOB 3W5JA 1G2OA 4DTCA 3WMFA 4CQJA 1Z6XA 2ZI3A 1SXGA 4I50F 3IEKA 3RSLA 4DC1A 1BW9B 4GKKB 3IAOA 4RW0A 3MP7B 1W8IA 4V0ME 4RFVA 2QP3A 4KMMA 3WYDA 4QU8A 1GA1A 2CJWA 4JC8A 4DJDC 4WOCA 4EY8A 1J6UA 2QR2A 2YC2C 4BX0A 3CXHD 1XX6A 2Q2WA 4EHHA 1M2EA 5KUTA 3BXHA 3OE5A 5EZ5A 3ANXA 2XUQA 2FXIA 1N1GA 8AT1A 1U7MA 1JDJA 2KS6A 3HLTA 2PA3A 4TWIA 5KYXA 1PP9J 2VA9A 3KKPA 5LIRA 3DAHA 3MNFA 5BR1A 5DIZA 3JQCA 2QGNA 3NV9A 1BCCE 1SBNE 2WP0A 4FZ5A 1RRMA 3HXOA 5EHGA 3RF6A 4E32A 4O1MA 3DOJA 1U3VA 1H8HA 1FSFA 4UB6E 3FUUA 5PGMA 1I2ZA 1T24A 2ZSFA 4MVYA 4WUTA 1SGWA 5G0UA 1BVHA 4KJZA 2C5LA 2WV9A 4LECA 4AKSA 5JPCA 2R8YA 1VSUA 1IZ7A 1NIJA 2WJPA 2WIKA 4ZVKA 3DXFA 4UB8H 3VNSA 3V33A 2JA2A 5CLGA 2YV4A 1ADFA 1SHUX 4KPFC 1H2BA 1QJ4A 1GPAA 3DE2X 3WG9A 4B3MB 3EDYA 3DEKA 1R8XA 1AUPA 1WAMA 1NVKA 3GXBA 4MYUA 4ILKA 2J3KA 4OAQA 3PNPA 3T7JA 3S1AA 3SQMA 1UP4A 3ESYA 4BJ5A 3RTAA 4QXQA 5CBPB 4NPEA 4ZVOA 5F52A 1QQ6A 2J8ZA 1IBSA 2NUBA 2V7TA 3GEGA 3W2GA 4DKXA 1LPBB 2IOFK 2TSYB 2N75A 2KLVA 1MAUA 1UPTA 4D9BA 3C8UA 3K8ZA 1EFUA 1NX6A 2CXNA 4D3DA 2R32A 2HNAA 1RAGA 3GEDA 3LWBA 3ZHSA 1FJHA 2W0MA 5EUMA 1J70A 4Y0AA 3V2IA 4S1TA 4DMUB 2HT1A 4LF5B 1YVUA 3D02A