2ZYGA

Apo-form of dimeric 6-phosphogluconate dehydrogenase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
466
structure length
466
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 177
structure length 466
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zygA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zygA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zygA01
3Q2KA 3V1TC 4KMSA 1B8VA 4A03A 4B7CA 3BMOB 3VPSA 2NVWA 1UXGA 1CQIA 3PHIA 1R4MB 4Q9NA 1E5QA 1C1DB 3BMNB 5L3ZA 1UR5A 1Z45A 1MXFA 2WSBA 2Q2WA 2AQIA 2PH5A 1E7MA 3RQSA 3ROMA 2X5KO 3TFQA 3NKLA 4WNIA 4E13A 1E7YA 1QYVA 2A94A 2BKAA 3GN2A 1EVZA 2P9GA 1E7RA 4Q3EA 1PL8A 1NYTA 4CV3A 1HYEA 1DFGA 1X7GA 2PZJA 4AJIA 5KVCA 3GNQA 1HT0A 4ZQHA 4BNUA 2B37A 4I5GA 2RBEA 4IQ0A 4JNKA 2POQX 4YT8A 3UGKA 3KXDA 4RZHA 3KUXA 1G6KA 1ZJZA 3WIEA 1W4ZA 8LDHA 4TROA 1U9JA 3QVWA 2D3TA 2I76A 4PIVA 4BO5A 5F1OA 4WGGA 2HDHA 4ZD6A 1DJQA 2NLOA 1DC4A 3M2PA 4RV9A 3TSCA 3G1UA 4PFJA 1RJWA 3R3SA 1C0IA 1KEWA 4NIMA 1GYQA 2QQ5A 2Y1FA 4I9UA 1I2ZA 4J4HA 5A5FA 3I9MA 3PLNA 4GX0A 4YWJA 4LRTB 2HRBA 4KZPA 3D3WA 1BG6A 4E5KA 4I9HA 4BMNA 4R9RA 2QRKA 3OICA 4Y9DA 1NHGA 4BNKA 1Q0QA 2YYYA 4CMBA 3DZJA 4XX0A 3JYPA 2H1SA 1IZ0A 3IL2A 3QJ5A 3SLKA 1Y9AA 2WD8A 4OQYA 3IUPA 3O8QA 3D3EA 3PK0A 1HSOA 2NV6A 3OM9A 4JP2A 1Y8QA 1ZSNA 1T2DA 5DULA 1DFIA 5G4KA 4YCAA 1T1SA 4EBFA 4D42A 1ENOA 3OEYA 2EP5A 2JD1A 4R54A 1LC3A 3GVIA 5CG1A 3JQAA 2Y68A 3FPLA 1OC2A 2VYNA 2XPCA 1BMDA 3FF4A 1GAEO 3GGPA 1LDEA 1U4OA 2GGSA 3QY9A 4CM8B 3KETA 1GYPA 1K6XA 2DM6A 4FR5A 2CF5A 3UXYA 1EQUA 3WBFA 3HNPA 2ZIZA 4IGFA 1R66A 4WASA 3RUDA 3AY6A 4MPDA 3WNVA 1Y6JA 1N1EA 1DRWA 4D0RA 2JAPA 3IJPA 2IRWA 4YDRA 4BV8A 3JTMA 3C1TA 3NJ8A 2XXJA 3I6QA 4P4GA 1HEUA 3ICPA 1QR6A 5JPIA 2YFQA 3E18A 1DRUA 3PHJA 4HFJA 5CPBA 2QYSA 1B16A 4MIEA 4ALKA 1ZW1A 4AVYA 3X2EA 1YQGA 5BSEA 4AJNA 1RYDA 1N5DA 5CHEA 3DMYA 3AM5A 4OKIA 4YAIA 1GCOA 3DBVO 1Y8QB 3CIFA 1J6UA 2GZ3A 3R6DA 3OFSA 2G0TA 2B35A 4DUPA 2Z1NA 3VPFA 4YTEA 2V65A 3FWZA 3KO8A 2NWQA 2Q49A 4FFNA 1IYZA 2OP1A 1DLJA 5BSHA 1VSUA 5ENVA 3S2EA 4YRDA 2RHRA 1I2BA 4RF2A 4OKNA 4XQCA 3BA1A 3W8DA 1ZXLA 4A10A 4C7KA 3VZSA 4ONEA 4XRGA 3FHLA 5I9LA 5EL0A 3RI3A 5A3JA 1Y8RB 3L07A 3HZZA 2AE2A 1ZJYA 3VDRA 4TKMA 3RUIA 1YO6A 3DFUA 3S55A 4CQMA 4H3VA 1S6YA 3LT0A 1ISHA 5ES3A 2CD9A 3AK4A 2TMGA 3GZNB 2HAEA 2PGLA 2AQ8A 3H6KA 4L73A 4RVDA 1U1IA 4TVBA 4XKJA 2DC1A 3JQ9C 3LDHA 5KJCA 1FMCA 4AJJA 1A7KA 1AVYA 2DTXA 2O3QA 1LSUA 1BHSA 1R15A 4MVJH 4CR7A 3F4BA 3UUWA 2YDYA 1WMAA 4BKQA 3O4RA 2B0JA 2JFFA 1NBOA 3WGQA 1MP0A 1FDSA 2X5JO 2AQKA 2CFCA 2W2KA 3A4VA 4WE3A 2OORA 5EPOA 3TZCA 4DRYA 3ZW8A 4L4XA 4R69A 1RWBA 5IDQA 4MP6A 2Q3EA 1JVSA 3B20A 3L4BA 3DBLB 4NJMB 5T57A 4M86A 1C1DA 1P0CA 3BMNA 5BNIA 1NWHA 1LRLA 1R4MA 1U7TA 3KLMX 1KEVA 1NVMB 2OO5A 3AFNA 2RHCA 3FPCA 3PP8A 4CL8A 3EVTA 3HSKA 1FK8A 1KETA 1YQXA 3I3OA 1F17A 1WWKA 3BXXA 5JC1A 4NJMA 1Z82A 4YRBA 2WM3A 3ZNPA 2HMTA 4S3MA 5CDTA 1RM4A 1VSVA 4O5OA 2PV7A 4M1QA 4CMIB 3CINA 1DOHA 1NM5A 3ONFA 2IYOA 3E5RA 1LLUA 2AEJA 2W2KB 1RM0A 2LDBA 1M6WA 4K26A 3RUFA 2DFDA 2EW2A 2Q2QA 4E2YA 1ZKMA 4DLAA 3JD0A 3E5MA 3V5NA 4L4RA 5FI5A 5I9NA 1YJQA 3PFWO 1EEHA 3EW7A 4NFSA 3Q9UA 4IM7A 4UEOA 3DDNA 3M1AA 4CV2A 3UVEA 5C7OO 3ZU3A 5TIIA 4QO8A 5KVSA 4JCOA 3D5TA 3H5NA 2DPHA 4GL4A 3QRWA 3ZWVA 5KTKA 3PQEA 3AI2A 1DRVA 5COAA 3ONDA 3PDJA 4RPLA 2BH9A 4CQMB 1U3VA 3T7CA 3LC7O 4BNMA 3UKOA 4H15A 4HFMA 3WYCA 2P5UA 1DAOA 3H5AA 4QXMA 2NM0A 1U3WA 2PD4A 1VKNA 2P68A 1Y8RA 1XA0A 4LSWA 2J6IA 1FXSA 3DO5A 5GZ6A 4PZCA 1P9LA 4E5NA 5C5IA 2QIOA 4RF3A 5TRTA 3SX2A 2VOEA 4B8WA 2Y93A 1GTMA 4UVHA 2X9VA 3TOZA 1A7AA 4ZVVA 3JQ7B 1LXCA 2ZB3A 1P44A 3U4CA 4DIBA 4XGIA 3HDHA 4CM7A 1LUAA 4PLGA 4DREA 3QLJA 4WCFC 3IMFA 3AUTA 5ER9A 2WYVA 1DBVO 3HDYA 3KV3O 2EHDA 2VYVD 4ESOA 4BMVA 5IF3A 1MX3A 4PRLA 4BIIA 2IDZA 4XQ9A 5KJ6A 3GVHA 2VRBA 3WYBA 3TL3A 4EGFA 2DBVO 4BUCA 3MJTA 4CL3A 4GQAA 4O0LA 4OYRA 4Z0HO 1JDJA 1A27A 4Z0TA 1XIVA 3GFGA 5AQ1A 1P1IA 3MWDB 5DCWA 5IG2A 4IDCA 4W4TA 3GHHA 4NQZA 3HWRA 1Q7CA 3RSHA 4PN3A 4UUNA 4G5HA 2ZKLA 4CM8A 5A9TA 1XWFA 5C37A 3KEOA 1ZVMA 2UYYA 1QV6A 2OXIA 4WEQA 4WOKA 3IS3A 3VH1A 4URFA 4XEHA 3WWZA 1CQJA 3I4FA 4R68A 1YQDA 2FZWA 3I9LA 2C82A 2Q50A 3NAQA 4B3IA 3H9UA 4NK4A 3DAFA 2FWMX 2C2XA 4HX5A 3NTRA 3C1OA 3O8QB 3W4IA 2NTNA 4YJGB 4CV0A 2D8AA 4N54A 1LNQA 2HU2A 2VCYA 1N7GA 1C0PA 2JL1A 3D3WB 4JBGA 4FQ8A 3WX0A 4EEXA 1VKOA 2ZJ0A 1U3UA 2X4GA 3MZ0A 1I01A 1N8KA 4MIOA 1A9ZA 4MVJI 4JIGA 5DCUA 2Y66A 3U9LA 5KJ1A 4DBVO 1N9GA 2PGDA 2X0RA 1GQYA 3FCOA 3A14A 3I9NA 3OETA 1P31A 3L4BC 3K30A 1PJQA 3RBZA 1ENPA 5T64A 1U28A 4ZGWA 1BXKA 1PJTA 3NT4A 5JAZA 4GMGA 3ZWOA 3C24A 2OHXA 1V6AA 3RFTA 3OQBA 4J1NA 4RPKA 1KVTA 4CODB 5I8WA 1E1NA 1W73A 4NG5A 5C7LO 3ORFA 1WZIA 4R01A 2V6FA 3QVXA 4ZQEA 4AG3A 4BNHA 2EKLA 1E6WA 2B4TO 1BXZA 1X14A 4RVSA 3ZV4A 4RPJA 3ZWYA 1F8GA 3OQ6A 5AOVA 1ZK0A 4U8GA 1J5PA 2JFHA 2A9FA 1J0XO 1ZCJA 4GKBA 4NBRA 2WE8A 4NFYA 3JQ9A 5I7FA 3I52A 4TZKA 4J9VA 1XG5A 5HRUA 4BO3A 1KVRA 2B5VA 3JV7A 3AJRA 1E7QA 2ZK7A 4ZRMA 1ZO8A 2VNSA 4H7PA 2VHYA 5I8ZA 3WNQA 2JJYA 4CLEA 2BI7A 2P9CA 4DMLA 1NPTO 1AE1A 1PQUA 2EEZA 2IXAA 2HK8A 4HFNA 4W99A 1PGQA 3ZH2A 1DFHA 3GDGA 2EV9A 2NQ8A 4ZQBA 3JYLA 3VAZA 3CPSA 5IDYA 4ZJUA 2FN7A 3JQ7A 4M49A 4CLHA 3B6ZA 1O89A 5CP8A 2EGGA 3RJ5A 4H16A 3I1JA 4XDYA 1ADFA 3DHYA 2D5AA 3CZMA 1VLLA 2Q1SA 4B79A 1Q0LA 2YY7A 4L74A 4XIJA 1IUKA 2FHSA 3FSRA 1U5AA 4KDFA 1YB5A 2R00C 2Y67A 3KTDA 3OIFA 1UZMA 2RCYA 3WSWA 5EIOA 5L9AA 3RC7A 3TNLA 4M54A 3DOJA 3JQBC 4E32A 2FRDA 1P1JA 3VVCA 2WE7A 1E7WA 3KHUA 2VT2A 4Q39A 2GNAA 1Y9EA 3WR5A 4A26A 1HZZA 4B4UA 2JD2A 4BNVA 4D0SA 2NVUB 1BTOA 2Y99A 2ZTVA 3LT4A 5KVQA 3ZHXA 3K9QO 5CPFA 3QWIA 4TRJA 5A9RA 4KOAA 2AQHA 3NGXA 4NU5A 4DIOA 5HTOA 1X13A 2BMAA 4Z0PA 1PJ2A 4FPXA 1YOVA 3CUKA 4JK3A 5TF4A 3HB5X 3SC6A 1O5IA 1ZK2A 5DP1A 2QX7A 3PTZA 2GPTA 1KC3A 3DEYX 1E77A 1ZFNA 4GX2A 5JNLA 4Y67A 5CAEA 5KIAA 3NV9A 1XQ6A 1Z6ZA 3H2SA 3MJ4A 1UXIA 3ZN2A 5DBIA 2Y1EA 3E9QA 1T4DA 1B8PA 4CJXA 4YRAA 5HM8A 1LDGA 4PLCA 1DIRA 4CM4B 1M75A 3KYCB 4NNJA 4R3NA 4ALJA 1ULUA 1YS4A 2EGHA 2Q45A 4P38A 3PEFA 4J9UE 4HWKA 1MV8A 3CSDA 4S1VA 1PIWA 1SPXA 3JYQA 3OJFA 4AJOA 1UH5A 4RDIA 2Q1UA 2C20A 4N5MA 3PWSA 1TT5B 1U2DA 3U09A 3HDQA 4HKTA 4R1SA 1W0CA 5G2OA 5LDHA 2OBNA 4FB5A 5L51A 1IL0A 1LQTA 3BAZA 2CDAA 1BDBA 2V6MA 2IZ0A 4E0BA 3L77A 1IZ9A 4FCCA 1FDVA 2PK3A 4UVEA 3ZU2A 5A05A 2AEFA 2E37A 1X1TA 1E92A 4YR9A 3WLEA 3TF5A 2HJSA 4NI5A 3JQAD 4YAEA 3RC2A 3STHA 1QYDA 5DOVA 4CMCA 4E21A 1DB3A 3RUHA 1XLTA 2VQ3A 1PS0A 2DBQA 3S1LA 1O6ZA 1ZK3A 2EP7A 5CDYA 2VHXA 3KSDO 2HQ1A 1XHLA 2Y0EA 2PKRA 4W82A 3UAGA 3AI1A 2X0IA 4XR4A 1JWAB 3G1TA 2C7GA 3OJLA 1O95A 3GEDA 3D4OA 1LDBA 4PG4A 3FI9A 3GR6A 3O26A 3AY7A 1X0XA 4IIVA 3E48A 4EUFA 1XEAA 3K92A 4XYLA 5TJ9A 4B7UA 4CM6A 5L53A 3H5RA 4DQUA 3O03A 3OJEA 5JYEA 2GLXA 1X15A 1MA0A 3I6IA 4DA9A 1NFFA 5DBGA 4B3HA 4YA6A 1E1KA 3NT2A 4CUKA 3L6EA 2O50A 1HF3A 2I3GA 4WCDA 3GAZA 1PZHA 4IJUA 4DMMA 5GMOA 4U5QA 3VTZA 1H6CA 2BFAA 1GUYA 3PJEA 5T8KC 4QTZA 1D4FA 3ZWAA 1GD1O 4EDFA 4E6PA 4WLEA 2DFVA 4B3JA 4PGFA 4CUJA 3PYLA 4BKUA 1HDZA 1P1KA 2FR0A 4ZN6A 1UAGA 1WZEA 4ZQFA 5F5NA 1QP8A 4PRKA 4YJHB 1QKIA 1KOLA 4D45A 2R2GA 2Q1WA 1AXGA 4ALIA 1ARZA 4ILKA 3SEFA 1A5ZA 1TT7A 4MJLA 3IAHA 4ZHSA 2AG8A 1C1XA 5TNXA 4CQLB 4YJGA 1T26A 1EQ2A 1R4NB 2AMFA 3DZFA 1UP7A 1E6EA 1DDOA 3ETGA 7MDHA 3FNGA 4XYMA 4IJKA 3WGZA 4MVJA 4E30A 4EYEA 4CQLA 3WGIA 3MOIA 1BXGB 3NGLA 3OIDA 3BTSA 3BZUA 1CEQA 1JTVA 1YB4A 3S2GA 1NP3A 1I10A 3ABIA 4A0SA 1JN0A 3LT2A 4CLOA 4AJ1A 4F3YA 2DUWA 4CQMD 5A1TA 5K6AA 1C14A 1C3VA 4R1UA 5FEUA 5A4DA 3GAFA 5B12A 4XQEA 3JQGB 1B3RA 3CEAA 4DYDA 4N7RA 1C1XB 2VHVA 3N7UA 4BNXA 1LBEA 3HUDA 1T2EA 3VDQA 3DOCA 2P91A 2Q99A 3PDUA 5EJ2A 3SVTA 3QSGA 3NDRA 4CMHA 2G5CA 2BHLA 2H6EA 3MJVA 4IXTA 4FOOA 2QG4A 5U9CA 1T25A 1SO8A 1Q7BA 2ZQZA 2YJZA 4OH1A 5L7WA 3AU9A 3UCEA 3VVBA 5TGDA 1IULA 3A1NA 3V2HA 1I0ZA 4NHEA 1OBFO 2A92A 3FWNA 4MKXA 2DTDA 4MVJD 3WTBA 1R16A 4E5YA 2BGKA 1BVRA 3ASVA 2W98A 1EZ4A 2XF8A 4IDGA 1SOWA 5AXBA 2AG5A 5KJFA 4AJHA 2J5QA 3DAGA 4XYGA 5U4QA 2EJVA 1JW9B 4CM1A 5L7YA 5THQA 4YACA 4J0EA 3GMDA 3TFOA 3M1LA 4R41A 2X9NA 4DGSA 5L4SA 3WJ7A 3DMTA 3LLSA 4RO0A 4IUYA 3WQRA 2F00A 3C7DB 3NYWA 4P4LA 2IYPA 4N18A 2O7QA 4FBGA 2AEMA 3RASA 3ZI0A 5ADHA 3W8FA 1PGOA 1I8TA 1HDOA 4JJGA 3GGOA 1QXSA 1F0YA 2NQTA 1YBVA 3WS7A 1E1LA 3KOUA 4BVAA 1NTOA 3L6DA 1K6JA 1CDOA 1HDXA 1JAXA 3C7AA 3IOYA 2CVZA 1HZJA 2OUIA 3DMTC 3Q0EA 1JKIA 4OAQA 2G17A 1LLCA 3HG7A 4NJOA 1T24A 4D44A 4XJSA 4ND1A 4FD3A 1ZEMA 2GRAA 4BO9A 4GX5A 1M76A 1P3DA 3DB2A 3G0OA 3VPXA 1SC6A 4BNLA 5FFFA 2UAGA 3W4JA 2PGJA 3GH3A 1F06A 4LVCA 3RFXA 4HBGA 2I67A 4FS3A 3EDMA 1AN9A 1Z74A 4BL5A 4IIUA 2IEDA 4ND5A 3V1YA 3EAGA 1Z75A 2P2SA 4L75A 3G3EA 1OC4A 5A9SA 3VPHA 1EE2A 2NU8A 1YBAA 2VHWA 4KWIA 4MP3A 1PJ4A 5JDIC 1E3WA 3E1KA 2O2SA 4EUEA 1FDWA 4MVJP 2PH3A 1P1RA 4ZU3A 1J49A 3JQEA 3HFGA 1WDLA 4FN4A 3UH1A 1GEGA 1NHWA 4I8XA 3GT0A 3NRCA 3L9WA 4OXKA 4UAGA 1YH3A 1NAYA 5ITWA 1BSVA 2W2LA 3SLGA 3VH2A 1GR0A 3WGTA 5L45A 1NR7A 3ZW9A 1DIGA 2EKPA 4KQXA 4YT2A 1RPNA 5BSGA 4BNTA 3JD4A 2CZCA 1JLLA 5A5EA 1F12A 5JBIA 1O0SA 2JAHA 4YT5A 2HRZA 1EUCA 2GD1O 1MG5A 3FTPA 5AXCA 1LTHR 3QA9A 1U8FO 2QRJA 2B83A 2ZTUA 5EINA 2CF6A 1E3SA 3G79A 3OQ1A 2Y1OA 1LRJA 1CJCA 1G1AA 1NAIA 2CVOA 4OXNA 2JD0A 4KP7A 4EJ6A 2X58A 1TEHA 5A06A 3IQDB 3T7EA 1DAPA 1QV7A 1OX3A 3VKUA 4DLBA 1LA2A 4CMGA 4OXYA 4D79A 2WWRA 3EYWA 1XDWA 2XAAA 5TX7A 4KTTE 3L6OO 1B26A 1XCBA 1BWSA 1Z7BA 2SCUA 2ZATA 1UP6A 3GFBA 2O4UX 3R1IA 3GPDG 1SNYA 2J5KA 3MTGA 3TJRA 4D3DA 2CVQA 2J3JA 4GKVA 5B4UA 2FPGA 3AI3A 1I3LA 3ZWXA 3C8MA 4NBWA 2NU7A 1FDUA 3U5TA 3F46A 3V8BA 4QFDA 1B2LA 3LQFA 4XCVA 4YVFA 2DKNA 2DT5A 4AJ4A 4BNZA 3Q1LA 2YDXA 1UXKA 2GF2A 3MWEB 4OMUA 3G17A 2NNLD 1YRLA 1KVQA 1ENZA 5KKAA 4HFRA 4YT4A 5L95A 5ILGA 3GY0A 4FJ0A 4JP3A 3DL2A 4J2HA 4MVJF 4RLSA 4DPLA 3LSYA 5IDXA 2VRCD 3CTVA 3CMMA 4IDEA 4U6SA 2Q4EA 3EK2A 1WDMA 4AJKA 9LDBA 2PTGA 4EI2A 3GZ4A 4J2OA 4NMHA 4XB1A 4RPHA 1PSDA 2B69A 1B3BA 1XSEA 1TXGA 4N5NA 1QYWA 1WMBA 3QVSA 5JDCA 5K6AC 4QECA 1A72A 1HYHA 2RH4A 3PZBA 1QMGA 1GQ2A 1ZXBA 1I32A 4M87A 4DVJA 1ZNQO 5BR7A 4HUJA 5JDCC 1KY5A 1W8DA 2QZ9A 3ENNA 3F1KA 2FSSA 3LF1A 3VHRA 3V1UA 4J0FA 3W8EA 1OFGA 3E9MA 1Y81A 1E7SA 1F8FA 2FR8A 2VWGA 3NJ4A 2EXXA 4FFRA 4TRNA 2HMWA 3ICCA 5JE8A 1MFZA 2Y1GA 4ROSA 2Y1DA 3RCBA 1Q0HA 3DHNA 4FJ2A 4MIYA 1ISGA 1H6BA 5CEFA 1PWXA 5JCJA 1HDYA 3ULKA 1EBUA 4MDHA 1LSJA 4DBZA 1ZSVA 3ZWPA 4MO2A 2FPPA 4OJNA 1PQWA 2EIHA 1ONPA 2EJWA 3DBRA 4CM3A 2HO5A 4LCJA 1N9GB 3DOOA 1I3KA 3EHEA 2P9EA 2EG9A 2EERA 4DLLA 4RVHA 5BNFA 1H6AA 3UICA 4Z9YA 1P1HA 3PGJA 2VUUA 1I3MA 2I3AA 3L9XA 1H0KA 4X54A 4CLXA 5IAAA 1T1RA 2Z5LA 2B4QA 4I5FA 5F3RA 3VZRA 1TVEA 1HE4A 3FTNA 1ONOA 4U6QA 2PLAA 2D1YA 5EN4A 1ADGA 1QRRA 2ZYGA 1ULSA 6ADHA 4PVCA 1JU9A 4HV4A 2B5WA 3AFMA 3ROPA 1PZEA 3PQDA 3PYMA 4L8VA 3FRJA 3GNTA 2J3IA 3MCVA 1XELA 4BO4A 1ISJA 2X1HA 3LT1A 3NTQA 5EMHA 1EMDA 3HE3A 3OSUA 4AL4A 1DEHA 1MG0A 1UUFA 3GNSA 4CPDA 5IZCC 1ENYA 2FSVA 4OHUA 2O3SA 1HE5A 4FFLA 1A4UA 1IPEA 3OIGA 3WSVA 1ZK1A 1M2WA 3JQFC 2P4HX 4NZ9A 5AYVA 1G0OA 3MEQA 1E6UA 4RLHA 4NH4A 5ER6A 5G0VA 5KNLA 3DFZA 4XWYA 3UF0A 5JMPA 3S2IA 2UUOA 2IE0A 5IDWA 3R3JA 3Q9NA 3EGOA 4BQPA 2FZEA 4D7AA 5F1PA 3BTVA 1LSOA 3GC6A 3BHMA 2VWQA 3WFIA 3KRTA 1H6DA 4K28A 3OECA 1SOVA 3RIHA 4JX8A 1DJNA 1JA9A 4JBHA 3TZHA 5JXWA 5HWSA 1FDTA 2JCYA 3BHJA 1VM6A 4BO2A 2WD7B 4FFMA 4J7XA 4M89A 2HSDA 3B1JA 4II2A 3P2OA 4EZBA 2AHRA 4E5MA 2DU8A 1T2CA 2ZB8A 1YE3A 8ADHA 3ADOA 3HJAA 3MOGA 1QLJA 2NU6A 1BVUA 2Q46A 5H82A 3WIDA 1HDGO 2JKVA 4KUHA 3AM4A 4UULA 1EVJA 3QP9A 4CMJA 1L1FA 1WP4A 5KJEA 3RU9A 3DBHB 2TMDA 3P5SA 1IB6A 1ID1A 1UDAA 1Z73A 5DDIP 4NBTA 4Z6KA 5DT9A 1HDCA 3ZHZA 5KCZA 2H63A 2VHZA 4CMEC 2RIRA 2YW9A 3KSUA 1B8UA 2HMUA 3NX4A 3WGGA 1EVYA 3UCFA 4BO1A 2BF7A 2BELA 4Z9FA 4BGUA 1HE3A 2DTEA 5JO0A 4A2CA 1PJBA 5EERA 1EK6A 1CRWG 5ENDA 4IJWA 4YQYA 1AGNA 2E82A 4L4SA 4TRRA 3QWAA 4I5DA 4BO7A 1PS8A 4JJIA 3C85A 2C5EA 5AXDA 5DCYA 1ZMTA 3RC9A 1PGPA 1KERA 1E3WB 2HK9A 4TQGA 5DBFA 3H2ZA 3HADA 4BNJA 2IEBA 4FSHA 4W6ZA 3LC2O 1IE3A 2CMDA 3H3FA 5T67A 3C7CB 4B8ZA 2FPIA 3KYCA 4PVDA 3GVCA 3WQSB 3PIDA 4A27A 1NQTA 1WDKA 5F5LA 1V3UA 4WLVA 3VC7A 1XU9A 1HTBA 2PZKA 4BOYA 3QWHA 3KSZO 4L0QA 4YPOA 4Q3BA 2D4AA 3UHAA 3KB6A 3AM3A 3LZ6A 3AU8A 4D43A 3ZNOA 1JVBA 5CDSA 2ZCVA 3GDFA 4NPCA 1F14A 4ZQGA 1K2WA 3PQFA 1R37A 3PZRA 1T4BA 5CEEA 5AVOA 2D2IA 3RUEA 4WLOA 4PZEA 2NSDA 3FD8A 3VTFA 1DLIA 2I65A 3EY4A 3KLPX 2AE1A 4Z3DA 2ET6A 2HCTA 2VTEA 4B7XA 4DXHA 2X6TA 3N58A 4TMFA 1I3NA 4HADA 2Q1TA 3TZ6A 4ND2A 5IXSA 2VYVA 4GH5A 4LCEA 5CFZA 3D4NA 3D0OA 1XKQA 4D3FA 3OMLA 4GI2A 2GN9A 4YJFB 4TVOA 3RUAA 4PLFA 3GZNA 1PZFA 2ZYAA 1V0JA 3OJ0A 3OH8A 1D3AA 5MDHA 1VI2A 3GG2A 4U0KA 3RD5A 4YAGA 4BV9A 3RC1A 2HMVA 4EITA 4J90A 1P0FA 4P22A 1N7HA 5AXAA 5EESA 4R9SA 3D1LA 3ZZNA 2GN8A 4OL9A 1M67A 1PZGA 1RKXA 5FF9A 2VZ0A 1PJLA 1GUZA 1X0VA 1HRDA 4Q3NA 3NDIA 4DPKA 5COBA 2I9PA 2VN8A 3F47A 3JD1A 4II3A 1YL5A 3G49A 1Q1NA 2HMSA 1I33A 1U3TA 3BTOA 3I4CA 4IMRA 1E3EA 2PKQO 4PLZA 5FWNA 2UVDA 3V2GA 1HSZA 3DONA 2BRUA 1LU9A 3OF2A 4PLTA 3K73O 1ZMOA 4FW8A 5JSFA 3F9IA 1ADBA 2AW5A 3LU1A 1JAYA 3AY3A 1GEEA 2I6TA 3N74A 2F1KA 1A71A 3BHIA 3RKRA 3E9NA 4U7WA 3QW2A 3ZV5A 4RF4A 4BNYA 3U4IA 4FGWA 3H3JA 3D64A 3E82A 4Y6SA 2EF1A 3WTCA 2PKQP 5F21A 3DZGA 2DAPA 2JCXA 3AUAA 4BGVA 2Z1MA 3W1VA 4XJTA 5A03A 3TN7A 5CDUA 3JQAB 3GK3A 4FC7A 3U62A 1GPDG 5FI3A 2C5AA 3EUWA 3GUYA 3I5MA 5F1KA 1NX6A 4NK5A 5HBRA 3TRIA 3C1AA 5JCJD 4R1TA 2A4KA 3JYNA 4WPGA 1PJCA 2OL4A 3P7MA 5T6BA 3WGHA 2Q4BA 1QYXA 3GQVA 1MFPA 2AXQA 4FDAA 1DXYA 4LN1A 1CETA 1BRMA 1HL3A 1LRKA 2X0NA 3FR7A 2WYUA 1Q2XA 1SZJG 2YZ7A 4CLRB 1KVSA 2X0JA 4GLOA 2PA3A 4IBOA 1NVTA 3F4LA 1H2BA 4JN6B 4J4TA 1BXGA 3AOEC 1IHXA 1YGYA 1JQBA 2PZLA 2G82A 4INAA 5LDGA 4EJMA 2DVMA 4XGKA 1ZH8A 2PWZA 4IDFA 4N5LA 1BW9B 4R1NA 4LMPA 3WLFA 1D8AA 4DWVA 1PR3A 4D46A 4Y6PA 2DBRA 5BQFA 1N2SA 2C59A 1LLQA 2GUGA 2VWPA 3EMKA 1OI7A 3EZYA 2XXBA 4JGBA 4E12A 1V9LA 4LVUA 3IDSA 4GGOA 2IZZA 5JO9A 2BFOA 4ZA2A 1GQQA 2UDPA 4J1TA 1K3TA 4Q3AA 3HN2A 3ZGYA 1TB4A 2GN4A 3KBOA 4YJHA 1Y1PA 3ANMA 3NDJA 5TJHA 5LCXA 5JLAA 4M55A 4LRSB 3FBTA 4HNGA 2FR1A 5DF1A 3ITKA 2O4CA 1HWYA 1KY4A 2O3TA 2O3RA 1PJ3A 2E49A 4EUHA 4GMFA 3RWBA 2X7HA 4PG8A 2NTJA 3ZWNA 4E5PA 1H93A 1N1GA 2CUKA 5JC8A 3F5QA 4PG5A 5HS6A 5I9MA 1GL3A 1Q7GA 1OOEA 2YV2A 2YHUA 3VZPA 3WB9A 2VT3A 4IDAA 4UUMA 2JHFA 1O9BA 3DZIA 4ND3A 4B4WA 3H9JA 4IDDA 1P1FA 3ZWWA 4XDZA 5JS6A 3JD3A 1RM3A 4RPGA 1VL8A 1VPDA 4GVLA 1YJ8A 6LDHA 4AFNA 2JHGA 4MKZA 5ITVA 4KUEA 5JAIA 4HNHA 3PVZA 1HKUA 1ZSYA 3ZDFA 1ZZEA 4YXFA 1A9YA 2O23A 1WVGA 3R0IA 1PR9A 1LQUA 4F6CA 2R00A 1PL6A 4BB6A 1SCUA 3HN7A 3QE3A 5JDIA 4BHTA 4XGNA 3CKYA 3IC5A 4P4NA 1Y5MA 2VUSA 4WKGA 2V7PA 4OO3A 1VJ0A 3JYOA 1H2HA 4IZHA 2R6JA 3INRA 1GV0A 3K96A 4PG7A 4QFCA 1O8CA 3VH3A 4O59O 5TC4A 5G4LA 3U49A 1U4SA 4GLLA 4KTVE 1UJMA 3PPIA 3V2UA 5JAMA 3K31A 5FYDA 1SEVA 3B1FA 4J91A 4W9NA 1LLDA 1UDCA 4A5OA 2YFHA 4E3ZA 4RDHA 2V6GA 4C7JA 1GZ3A 1PU2A 5LC1A 2G1UA 4NR0A 4JROA 4R3WA 3LK7A 1K0UA 5DZSA 2OOSA 4MOWA 4RGBA 3WYEA 4UUOA 3E6AA 2C29D 2QRLA 4LW8A 1EE9A 2ZYDA 3ZV6A 2XOXA 4D41A 1V8BA 2YUTA 4K1LA 1G0NA 3F1LA 4WLNA 1GCUA 2GCGA 4YYZA 4ND4A 3T4XA 3SJ7A 4XIYA 4PLWA 3HHPA 2CNBA 3GN1A 4BGIA 2UUPA 4E31A 3K2BA 1MGOA 2NU9A 1K89A 2DPGA 4MVJG 3WDSA 3GA0A 5I7SA 2D59A 4IS3A 2GZ2A 1YOVB 1ZBQA 2CDCA 3DHEA 1WPQA 2VNAA 1DSSG 1NVGA 5L40A 1V3VA 3UN1A 3RUCA 5JMWA 2OBYA 4IQ8A 1M66A 5A9SB 4TRMA 3B70A 1D1TA 4FIZA 4ZICA 4ALLA 3F6YA 2UV8A 3CMCO 3JQBA 4LMRA 1GY8A 1IPFA 1AUPA 2VOJA 3BYZA 4ZRNA 1X7HA 4UUPA 3L0DA 2BGMA 3QHAA 1CWUA 1U2GA 3S8MA 1NXQA 3PLRA 1O94A 4IDBA 3KYDB 4J43A 3LF2A 4W9NC 4DC1A 1CIVA 3S2FA 4KWHA 3HQ4O 3DXFA 3BIOA 4O6VA 4PLHA 5KKCA 4OSOA 3VZQA 5JW6A 2W8ZA 1U7HA 3INGA 3M2TA 1WLYA 1M6HA 3ADPA 1KVUA 1AHHA 4J7UA 4PCVA 4A7PA 2RH8A 3B1KA 3KZVA 3TZQA 2VRCA 4FC6A 3D5QA 2W90A 5K0ZA 3FBGA 3H9GA 4GGPA 3RAJA 1GZ4A 3JD2A 3E8XA 5IN4A 4XYEA 3VH4A 2BD0A 2E48A 2H9IA 1CERA 2O7SA 2VYND 3OHSX 3Q11A 4YBZA 1WW8A 4UVIA 4PLYA 1H9AA 1EVIA 1YL6A 3H9QA 4ALNA 3PWKA 1SBYA 4PG6A 3WMXA 3FR8A 1DC3A 1NNUA 4UEJA 2ILTA 2HK7A 1FJHA 5JY1A 3JCZA 1ZK4A 2BFPA 1H94A 2BFMA 2DBZA 4W7HA 1NQAO 1TLTA 3DTTA 5JY6A 1B15A 4Z3KA 5KOIA 3DWFA 1GUFA 4GX1A 1E0DA 1H5QA 1SMKA 3GHYA 1KIFA 3DAPA 3ZCXA 5B4VA 4CLRA 5ICSA 2WEKA 3ZWBA 4AJPA 4YB8A 3CE6A 5IZ4A 1YKFA 3MJCA 4Q3DA 2P4QA 4O1MA 1YL7A 3ITDA 3WOHA 2PY6A 2C54A 4B4VA 3GEMA 5I7EA 2HUNA 4U0JA 1QORA 4RORA 4NDNE 2GZ1A 1L7EA 5IN5A 4CMEA 2YHIB 3GG9A 1XGKA 1U5CA 2J3HA 2G76A 3ETEA 3O9ZA 3ROQA 4DYVA 3ZU5A 5L7TA 3D4PA 2ZB4A 4WNCA 3PXXA 3GRPA 3WQQA 3A06A 1UP4A 3H9EO 2ZB7A 1P77A 4OGWA 5EQFA 3ST7A 2DQ4A 1GDHA 2WDZA 1PX0A 1P45A 5L4NA 1HXHA 1DO8A 4R5HA 2PD6A 2WJPA 5A04A 1GV1A 5U1PA 4DQVA 4GSKA 1WNTA 1GU7A 4NBUA 1ISFA 1IOLA 1B7GO 4CLOB 1AXEA 2YQ4A 1JKFA 2FP4A 2NVBA 1SB8A 3ZV3A 1NFQA 2X9GA 2WMDA 5THKA 3W4KA 2P5YA 2VWHA 4F46A 5B4TA 5G4KB 4EJ0A 2PZMA 3DTYA 3RKUA 2D5CA 3UOGA 3BMQB 2OGUA 3OEWA 2D0IA 4JLWA 3ZNNA 2VUTA 1WAMA 3KM0A 1I30A 3DR3A 1GPJA 4UREA 1CF2O 4DIFA 3WICA 4GVXA 4OOEA 3H7AA 3KYDA 3X2FA 3AW9A 2C2YA 3AOGA 1K5HA 3JQFA 1PGNA 1I24A 1S7CA 3IP3A 2O2YA 5DN9A 5TT1A 1ISIA 5TS3A 3GUCA 3L4SO 3WMWA 4RQTA 3K5PA 4CUZA 5C3MA 1C0LA 1DHRA 5CG2A 4WUVA 3JQ6A 2X23A 2PD3A 1BGVA 2GDZA 3BMCB 1SB9A 3Q6IA 2GN6A 3INTA 3NUGA 3DZKA 3VKVA 3P2YA 4PLVA 3WWYA 3DC2A 4A73A 1DIAA 1B14A 1B0AA 1NPDA 3IJRA 2VZ9A 3PFFA 4BB5A 4CR8A 1XYGA 1NQ5A 1V35A 4L76A 3CTMA 1PEDA 4QX6A 3H65A 1E3IA 3LLVA 4K6FA 4M8SA 2QZZA 4WLUA 4UEKA 1GFSA 1PJSA 4IXWA 4YQZA 1MXHA 4YEDA 3F5SA 2X22A 1LC0A 1PTJA 2C07A 3QVOA 4BMSA 4E2XA 4XYBA 3PWZA 1VL0A 2C0CA 4IQGA 3O38A 1EUZA 1I2CA 4FFOA 2V6BA 4XZ3A 2BGLA 4QSMA 4OQZA 2I66A 3EC7A 4UVGA 4WK6A 5K9ZA 1GYRA 2PNFA 3IIEA 3HFSA 4Q3CA 2I99A 3A28A 4BKPA 2GSDA 2W2LD 4NFHA 3MJEA 5DOZA 5CDGA 4KUGA 3BMOA 1CYDA 4OIMA 2Q2VA 1MUUA 5MGBA 3I9JA 4WOJA 3DQPA 4DQXA 1ZEJA 3SXPA 5TQVA 3AOEA 3ANLA 5HA5A 3SJUA 4CMKA 4LK3A 3W6UA 5JAQA 2EW8A 2GYYA 2C7VA 2IODA 3PHLA 3EVNA 4J1QA 2NUAA 3PGXA 5GZ3A 3TOXA 1Y5RA 4PZDA 1KEUA 4WLFA 2J5RA 2QW8A 3QWFA 4L9RA 2HLPA 1PGJA 3GPIA 3IP1A 1XQ1A 1HLDA 4RZIA 2PFGA 3DBHA 4J7CA 1IY8A 3RROA 4DTIA 2YV1A 3F3SA 4G65A 1D1SA 5A3VA 4J3FA 3OJOA 4GWGA 3TPCA 4JJFA 3GGGA 1TT5A 1DIHA 3GF4A 4G81A 3I9KA 5KVVA 3QIVA 4B4OA 1MC5A 1NAHA 3Q2IA 4CMIA 2H5LA 1LEHA 3RVDA 4RVUA 1VL6A 3PJFA 1R12A 5DNAA 2YQ5A 5BSFA 4CLDA 4GSLA 1UXJA 3I23A 1MB4A 3NTOA 4I08A 2ZTLA 4CM4A 1T2AA 4BO0A 1HLPA 7ADHA 3QV1A 1AHIA 1VRWA 4Y98A 2IZ1A 1UZNA 2GR9A 1EDOA 3DBLA 2CY0A 3WGOA 3EZLA 4J49A 3ZHBA 1PWZA 2VZ8A 1T2FA 3I83A 1ORRA 9LDTA 1GZ6A 3GRKA 3U0BA 1E3JA 3GDOA 1QSGA 4K9DA 1EBFA 4E2WA 3CZRA 1VJTA 4RJTA 1LI4A 4BGEA 5B1YA 3IKTA 1ZUD1 1TI7A 2Y1CA 4CMAA 4W7IA 3SBOA 4DC0A 3C3XA 4FFPA 4TWRA 2JCVA 1D7OA 1NPYA 2X5OA 1V3TA 2CDBA 1QG6A 3BMCA 3GOHA 2OP0A 3H4VA 3ON5A 4HY3A 4C4OA 4G2NA 1LSSA 4DL9A 3PHHA 4RCVA 4FOSA 4RL6A 4J4BA 5G0WA 4I9NA 4O63O 5BNTA 1VJ1A 4OM8A 4WEOA 2ZJ1A 1Z7EA 4XB2A 1XU7A 3GMSA 1UDBA 3ASUA 3PJGA 3WGYA 5TLSA 1DPGA 3RFVA 2CSUA 4KQWA 1MLDA 3JQGA 1PQPA 3KEQA 4BQRA 5IJZA 1MC4A 4QQRA 3PI7A 1EUDA 2QHXA 1BW9A 1AA0A 1SEPA 4Y8VA 4IGEA 4TKLA 1SAYA 3U4DA 2OZPA 1DHTA 1TA4A 1HYGA 4QUKA 3NT5A 3RBXA 1E5LA 3PYXA 2ZTMA 4WCFA 3DZHA 3SC4A 3TDKA 2I5PO 1OMOA 1UAYA 4MVJE 1BDMA 2OMEA 3ZWCA 3A9WA 4MP8A 2E4AA 3K2EA 1K6IA 4DPMA 1EDZA 4RF5A 5J23A 3JQ8B 4HXYA 3BMQA 3M6IA 1YDWA 1YXMA 4HP8A 4R51A 3AWDA 1ONNA 3DBRB 1DC6A 2EWMA 2WYWA 1R4NA 1YONA 1PL7A 4MINA 1A4IA 5T5QA 1LDNA 5G0TA 1JKJA 1VC2A 1ZIDA 2FMUA 4Z9XA 4IMPA 1UZLA 2FOIA 4RVFA 1KC1A 4GBJA 4LSMA 2A35A 5BT9A 4IS2A 3VPGA 4E33A 3I9OA 3JQDA 4J1SA 1YB1A 2YHIA 2HKIA 3ONEA 3IKVA 1IHYA 4AJLA 5IZCA 4I5EA 1HE2A 3LYLA 1YBMA 2FY8A 3FN4A 4IINA 1GADO 2WTBA 1ML3A 4FGSA 3WJAA 1DC5A 1HETA 4E2ZA 4ALMA 3IUSA 4EW6A 3K6JA 1JWBB 1OAAA 4PLPA 4XD2A 3AUSA 4QT0A 4AICA 3ZHYA 3GVXA 1ISMA 4IJVA 1EFLA 4WECA 4CM9A 3H8VA 5A02A 1J4AA 3FNFA 3UW3A 1YDEA 3JSAA 2BI8A 1R6DA 4OSPA 4TSKA 1C0KA 1NR1A 3FNEA 4MVJM 4YAJA 3W6ZA 3HB4X 3AUUA 1X7DA 3TWOA 3TL2A 5EQDA 4I1IA 4JQCA 3QWBA 4K6CA 1QYCA 2NADA 3MJSA 3QQPA 5L4LA 3P19A 3QVTA 4WJZA 4BS9A 4BKRA 5TSDA 2Z95A 1P74A 2LDXA 2ZQYA 3WG9A 5JFOA 1EFKA 3T4EA 4YJFA 4BNIA 1PS9A 5COQA 4IY1A 2OFPA 1L7DA 4RQUA 3KVOA 3DZBA 1LDYA 1KS9A 2JFGA 3TZKA 5CEJA 1KEPA 3LC1O 2W4QA 5ILOA 2VTDA 2J3KA 2QYTA 4IZIA 5ICMA 3GLQA 4GWKA 2X86A 3WFJA 3NEPX 1Y7TA 4F45A 5IXYA 3ZWMA 3ENKA 1W6UA 4XA8A 3TQHA 4R5MA 3WBBA 2E6UX 2GO1A 5GZ1A 3JQ8A 5T8KA 5KWEA 2GERA 3UFXA 3K8ZA 4BNNA 4RVGA 2O48X 1KBZA 4WCFB 1LDMA 3WXBA 4GAEA 4IPTA 3ROKA 1E1MA 3Q3CA 4E4YA 3E03A 3OP4A 2B4RO 3OA0A 2Y0DA 4NU6A 3LVFO 3ZNQA 4QEDA 5HS4A 4KDEA 3CXRA 1FF9A 1H9BA 2DUUA 2EKQA 1EK5A 1R0LA 1YVEI 1OZAA 1U8XX 3OA2A 3RU7A 2DLDA 2AA3A 1RYEA 3PHGA 4ID9A 4GPD1 3BTUA 4BNFA 3JQCA 2IXBA 3KYBA 1RM5A 5JYDA 4OOFA 4JBIA 2O3JA 2Y0CA 3PRJA 4XR9A 4BNWA 2HJRA 5B37A 2Y05A 4BO8A 4Y6RA 3PIIA 4UVDA 3D7LA 1X1EA 4F6LA 5DP2A 4D3SA 3HDJA 2PR2A 4YAKA 1LX6A 1E3LA 4BO6A 2YV3A 1HDRA 4YJDA 5TT0A 3ETDA 2BLLA 1XR3A 3UCXA 2NTVA 1P33A 3CH6A 4CV1A 1KYQA 4AJ2A 1I36A 2X8LA 1LJ8A 4XRRA 3VOSA 4R4JA 4CR6A 1QLHA 3GVPA 5H83A 2NVUA 3RBVA 5IFLA 5H81A 1DIBA 5G0SA 4BKOA 4JXKA 1NFRA 3COSA 2ZCUA 4J16A 2B36A 5I7VA 1VE9A 5G0UA 4LISA 3U4HA 4MKRA 4ITUA 1R0SA 4EEZA 3MTJA 4QO7A 4NBVA 1WXDA 2WD7A 4AJEA 1I5RA 1YWGO 1UXHA 1ADCA 3GEGA 4BNGA 4CM5A 4FJ1A 4P8RA 3FNHA 1NWCA 2O3UA 4TZTA 4LGVA 3RJ9A 4J6FA 5GY7A 2RAFA 1NQOA 1R0KA 3U3XA 2GASA 2NACA 3PJDA 4R16A 2J8ZA 4CM9D 3ANNA 4XQGA 3ZU4A 5JCXA 1NASA 3OBBA 5C7IO 1N92A
chains in the Genus database with same CATH superfamily
4LOAA 3SNHA 1QQ7A 1XF1A 2YIVX 3QF4B 1GNRA 2X9QA 4TUYF 5FR2A 3K5BA 2XEDA 3M4YA 1A76A 2BEUA 2FSFA 2IP2A 3GT7A 3AR8A 3IMEA 4NMWA 3NBQA 3C6MA 1FU7A 2W83C 3VPSA 3EMBA 1L4MA 2R8YA 3PHIA 4A6DA 5IKXA 3D3JA 4HQFA 3HA2A 4Q6BA 4A0RA 1K8AQ 1PNTA 3BMNB 3CI9A 3A70A 3URMA 1CUFA 1E2EA 2R86A 1WQ4A 2PH5A 5AVWB 2XDAA 3L6UA 3VU1A 3ROMA 2DOKA 2X5KO 3TFQA 1A9OA 2A94A 3G85A 1QYVA 1X7XA 2CLHB 2BKAA 3EPRA 1IOVA 5F9HA 2TMYA 2V96A 4Q3EA 3I28A 5AM2A 1NYTA 1HYEA 1S9KE 4C6RA 3U7QA 4AJIA 3F90A 5KVCA 2O8CB 4YX9A 2Z5HA 2EYUA 4O2AA 4LXYA 4O1IA 2ZYRA 2XOEA 1U63A 1XDSA 4RZHA 3CWBJ 2V1XA 3HCCA 3WIEA 4KNYA 2FH5B 4HPJB 3IAUA 1W6RA 4HAWA 1BJKA 2D3TA 2NOGA 2YASA 3USES 1AK9A 2FN4A 2RARA 2I76A 2ZPAA 3CWZA 3H97A 3HZOA 3QX3A 5F1OA 1MDFA 2EZ8A 4WGGA 1FNCA 3WA7A 3L02A 4NV0A 1V7PC 4EF4A 1SD1A 3CF6R 3D3QA 3TSCA 2JLRA 2I1QA 4MWZA 1IFMA 1PZNA 4KBYA 2Z8YM 4BZPA 3I64A 3KD2A 3MIIA 1IHPA 1C0IA 3A4MA 2UVPB 1GYQA 1OXXK 5CXQA 1TUBB 2QQ5A 2Y1FA 4J4HA 4KSYA 2HXYA 1L2PA 4L51A 4HF7A 3NEYA 2MDTA 4HMOA 3LW5J 1W30A 4GX0A 3BXPA 3ZD6A 2NZWA 4G0QA 4C7VA 1AK1A 1DJOA 5JH7B 3KSMA 5H3HA 4EMSA 4WXEA 5ETJA 1BG6A 2KYRA 2J6HA 3B60A 3CRNA 4KIJA 4A4DA 1GL2B 4R9RA 4RXMA 1AB5A 16PKA 1NHGA 1M0SA 3HZRA 5INTA 2C4KA 3PA6A 4O33A 1N86A 1W0JA 2G0NA 4JL8A 3LGAA 3QJ5A 1K6MA 2CVHA 2WD8A 2ZYUX 3Q5PA 2XGOA 3O8QA 3PK0A 3N05A 5DWQA 1HSOA 1JSLA 1WE2A 2XDWA 1RVV1 3OM9A 4DRZA 4TXLA 3FCXA 4ARBA 4MWSA 5IJWA 2ZBRA 3H13A 1FQJA 4CTNA 2OCLA 1XALA 3SXUB 4YCAA 3FYDA 1F0KA 1IBCA 3FPJA 3PX7A 1E2NA 2ZXEB 1ENOA 1EWYA 1J42A 4S0ZA 2HHHB 4L2IA 3G0CA 5BVHB 5KQRA 5CG1A 5CNJA 2CL7X 3KTAA 1Z3CA 4KRYA 5LN1A 4CQJA 1BMDA 1V5GA 3FF4A 3ME5A 3DOFA 5HRAA 2W6JA 4UC0A 2Q1KA 3OE7D 2REQA 4NAVA 4P4UA 4CM8B 1CR2A 3GLVA 4S0XA 4CHGA 1T36B 4FR5A 5ED4A 3WBFA 4IGFA 2ZIZA 1FZCC 1R66A 4WASA 4ESHA 4Q24A 1UWVA 2FLVA 4GM0A 5C4MA 1PKEA 3HI6A 2VAXA 3G0BA 4QARA 1Y6JA 3SIRA 1P29A 5LJLA 2R3SA 4Y2GA 2JAPA 1XNGA 1T3TA 3L75J 2UZ1B 4YDRA 4DOMA 2Z2XA 3PXDA 3C1TA 4KQKA 3NJ8A 1HEUA 3QBJA 2M5AB 1NLMA 3EEFA 5ALNA 4EMBA 4JLOA 3OZDA 3SFEC 2J30A 1VKZA 2YFQA 3AO0B 3VI4B 4RY0A 1Y89A 2E9SA 1SFCD 3ZIUA 1B0UA 1OBOA 2EFCB 2PAAA 2QYSA 4FQ5A 1OFTA 4B48A 5KWJA 1M0EA 3A9SA 1O94D 3KDAA 4AJNA 1RYDA 1GNSA 1O6BA 1R8JA 4K3VA 4MSUA 3SXUA 3R2JA 2AFIA 3UK0A 4RC9A 4YAIA 4D9GA 1B8NA 3CEHA 2GZ3A 4RD3A 2OZKA 3R6DA 1UKZA 2H5EA 1R0XA 2Z1NA 3VPFA 1GMJA 1Z36A 1JS1X 4UBOA 4Z7JA 4JKIA 2V65A 3BWXA 2V54A 3KO8A 1VGQA 3K1JA 4FFNA 4PSCA 4QFBA 1XOIA 2HSJA 3U9SA 4KXYA 1VSUA 3S2EA 4YRDA 1E5VA 4FEEA 4N0MA 3RL0D 1IFPA 4ZHQF 1EXWA 1GL2A 5F4BA 1ZXLA 2C0WA 3LC0A 4ONEA 2N9BA 3VNUA 1YA8A 2C1ZA 1KQGB 5A3JA 3NNSA 1DWQA 1Y8RB 5H68A 2LR2A 2QP3A 4MHOA 1VJ5A 5H9WA 1JY2O 4B6QA 3HZZA 4INZA 2HA4A 2I34A 5GTDA 1KB9E 5DXJA 3DTNA 3UUFA 5DNYB 2ZJ5A 3U59A 1TM7E 3OD1A 4J0CA 4ROTA 4O4LB 4TYNA 1R0ZA 4UTNA 3RT7A 3NQ41 5CGQB 1Z5VA 3Q4GA 1VLQA 4PHTA 5MF6A 3R7FA 3AK4A 1QNFA 3PGMA 2HAEA 2PGLA 4RVDA 1S9DA 2DHDA 5F2EA 2ADOA 2DC1A 3LDHA 4HL6A 3KSBC 2BGIA 2FYUJ 4A0QA 2DTXA 2O3QA 3NALA 2PAFA 3WGJA 1BHSA 3HYSA 1R15A 1MEJA 2C4NA 5FYQA 5SZHB 4M38A 4B6JA 3R3YA 2YXRB 4DM4A 4RM3A 4EY5A 3CRRA 1TAHA 4Q4JB 4TWBA 5NLLA 2H43A 1A9TA 1USWA 4AZ3A 2WV7A 4X0EA 1SKUA 1MP0A 1FDSA 1Z37A 1ZUWA 3OU6A 3T4PA 3V6MA 1EDJA 1U0RA 4RDXA 4KQ1A 3T4UA 2Y2VA 2NPSD 4GQIA 2WUVA 3QJYA 2JLWA 4HQOA 3LUCA 3QTTA 3T12A 1RWBA 4AG6A 5IDQA 2YHAA 3UPUA 4JP5A 3LYAA 5CCHA 2QDKA 3B20A 3DBLB 3L8MA 5AHWA 5T57A 1NWHA 1W96A 3KLMX 3H1KD 2R8BA 4MMZB 4OI4A 3FPCA 3NKVA 4ERNA 3PP8A 5JD6A 3BCCJ 2GXAA 2LXCB 2AOUB 5E9AA 1LJUA 3WP0A 1U7ZA 1H2YA 1IZ8A 2PJZA 1GLNA 2HN9A 3G5LA 3K53A 2NYAA 4X7MA 1EP1B 1Z82A 5CFQA 5AUPB 1CY7A 1EK2A 2HMTA 3D54D 2JIDA 4DB2A 1VYUA 1JAZA 4IDQA 4X90A 5JOQA 1DOHA 4RZ3A 5JEEA 3E5RA 1YE5A 4V1CI 1WUTA 2XOKD 4X91A 3JAMA 2HJVA 5EI5A 4U7JA 1M6WA 1IAQA 4EUSA 1GHTA 4DCSA 2H89C 1J56A 3GRYA 4E2YA 4DLAA 2CE2X 2XWBF 4Q4JA 1QYIA 1QVGO 2RIPA 2PL1A 4XOUA 3PFWO 1EEHA 4JLDA 2BL4A 3D2AA 2VIIA 1L5NA 1LWUB 1TFRA 3LRXA 3F5DA 5KX5B 2XNDH 4FHDA 4C46A 3JVDA 4QO8A 5KVSA 4W5QA 1CIJA 1MFTA 1TPZA 2DPHA 2NZVG 3D5TA 2EGUA 2MMCA 2O0JA 4X6YA 4BN0A 4I5IA 3AI2A 2FBWC 1PAUA 3ONDA 3V2PA 3TJMA 2XB8A 3PDJA 1P2VA 1C7QA 3PFGA 1J21A 4GGMX 4RPLA 5FXMA 3T7CA 4RTMA 4BNMA 1CCWA 1DAGA 3D02A 1Z06A 4IX1A 3WYCA 3RS3A 1DAOA 1T2KC 3MPOA 2P69A 2PD4A 1VKNA 2VPQA 1F51E 1Y8RA 2CEKA 3CH5A 1X74A 2GBGA 2J6IA 2QPOA 1FXSA 1YBHA 2GF9A 2CLDX 2OD9A 2R25B 3K9HA 3ND9A 2GHTA 2JAUA 4HDMB 4UZFA 1P9LA 4BV2A 7GPBA 4CIYA 5KAFH 1L5GB 2QIOA 2NYUA 4RF3A 3ZOKA 2R1TB 3ECCA 5TRTA 4J76A 8GPBA 4Z4EA 2VOEA 4G97A 3Q5GA 4NENA 1ZJ6A 1GTMA 4MZDA 3MYYA 3VHXB 5AHKA 3NVAA 3ZQUA 4AWAA 4CNQA 4Y28J 2IDMA 3B13B 5CTJA 1HJBA 3EE6A 5FPTA 3H1JJ 3L74E 1KBOA 3L01A 4U3FG 4M9RA 3RSZA 2GAFA 3IVCA 1XZFA 4CM7A 1BEUB 1E1QA 1QCCA 3IMFA 5K0CA 5E3IA 1EPUA 4EZEA 2X14A 3EIHA 3AFGA 2QUJA 2EBWA 2C57A 2B20A 4RM2A 3IXMA 1BDDA 5EKSA 2P2NA 1X6VA 1S8NA 3D2BA 4YO7A 1X1RA 3U48A 1XRRA 4AMVA 2IX3A 2IDZA 3R0XA 5JTUA 3FOEC 1H0HA 3WIBA 5EXSA 1KORA 2FOLA 4IDPA 4KAFA 2QVXX 4D99A 4EATA 1X70A 4BUCA 5BPFA 1CD5A 2ASVA 4O0LA 1YZYA 3FKQA 3GF7A 4Z0TA 3GFGA 1C3LA 3CC7P 3F73A 4W4TA 4YXDC 5K8JB 3MUDC 3O8NA 1NXVA 1Q7CA 1CNMA 1FZBA 3F9CA 3K0HA 1L7QA 2XD4A 3G0DA 1Z22A 2A0KA 4L0CA 4PN3A 4YCSA 4GZ6A 1E6MA 3CXHH 4DYHA 1GWNA 1VG9B 1XLTC 1RPJA 2BHNA 4PYNA 4QUAA 2R44A 4Z7NB 1WHSB 1SKMA 3HKBA 1QMPA 3A1EA 4M1SA 5L3SB 2BEVB 3IS3A 1M8FA 2CL0X 4LOKA 5BOVA 3TX6A 1IQRA 4R84A 3PQ8A 4W9MC 3EXG2 1NXWA 2XODA 4JMPA 4M1KA 3QX8A 2Q50A 4OBBA 5ALFA 5EXTA 5FJJA 3K6SB 3OJWA 4YK7A 4NK4A 4WBNA 3VMMA 3DAFA 2GJKA 1EZ1A 2I4NA 2NO4A 3CX5E 4PM4A 4C7NB 3E58A 3S3TA 3NBXX 3F74A 2F6RA 2ZE8A 2NTNA 3GJ3A 2H06A 1AQJA 4N54A 1F20A 1TTPB 1ZN2A 2BFBB 2EQ5A 1M9NA 3B5EA 3EDCA 1A5BB 1LNQA 1JAHA 1PR0A 4X8LA 2CUTA 3ABOB 4WFJA 2VCYA 2VDUE 2WHPA 5H59A 3MCAA 4K1XA 5ARCA 2UXCB 1NSTA 5M34A 4QDUA 3N2KA 3OLXA 3EA4A 4WVLA 2GA9A 2LPMA 4EEXA 3RADC 4Z9BA 3FOFC 2OBFA 3V32A 3L71J 1U3UA 3E1SA 1N8KA 3HVJA 1KJZA 4MIOA 4ND6A 1M1JC 1CVRA 2WM2A 1NU8A 4G25A 5DCUA 4IRMA 3U9LA 1O7JA 4B2PA 3HP4A 5CCGD 2I29A 3ZXUB 4DBVO 4ETNA 1YVRA 3PITA 2PGDA 4W8HA 1L4EA 3BGSA 1RFGE 3L7BA 4AMBA 5LM3A 1E2LA 3CZ5A 3FCOA 3UT0A 4OQDA 5CNMA 3SC2B 4MRSA 2C3OA 3OETA 3TRDA 1DTSA 2OKCA 3WJ2A 4EGSA 5CCHC 1QWOA 4M9XA 2Q6TA 1LPNA 1U28A 4ZGWA 4YJ3B 3GCDA 1YJWP 1IG3A 2QUIA 3QTBA 2FYUG 4LAFA 4BJ1A 2OHXA 1V6AA 3DF9A 1N6PA 4HAVA 2ID9A 3RFTA 4RPKA 4UD6A 4ZMDA 4N0QA 4CODB 3OG9A 1E1NA 4KO2S 4UOZA 2CMGA 5I8WA 4DMCA 5BW4A 3S27A 4O2AB 1XWIA 4ZYZA 5REQB 3SQWA 4MJXA 4Y2VA 1KHHA 1STOA 5LMCA 1KSGA 2C1EA 5E1OA 2HNBA 2WIAA 3KQMA 4QVKA 4JOQA 4M0CA 4CF7A 3K0AB 1X7XB 2O1KA 2A9FA 1J0XO 1M7HA 2H8GA 3A11A 4P98A 5B5EE 3C6KA 2ZSEA 3SYKA 2GZSA 2FEPA 2OPHA 1RAEA 3JQ9A 3AEBC 4TZKA 4IIJF 2R8XA 3LW7A 1XG5A 2X6RA 4RA9A 5HRUA 4BO3A 2RGRA 1L0LK 1DDIA 1Y37A 2XIJA 3AJRA 2RN0A 2QTVB 1IN6A 3JV7A 4IHJF 2VNSA 4IVPA 2QEQA 4H7PA 4LDAA 2E3JA 3U39A 3WK5A 5CCBA 4OEHA 3WNQA 2JJYA 5E79H 1PT8A 2BI7A 2VLBA 2FV8A 1NPTO 1U2ZA 4UOEA 1P84H 4B43A 2EEZA 2O5RA 2RGWA 4UNPA 1AS2A 1KFBB 1TKRA 2IXAA 1SC4A 1Z9BA 2HK8A 5CW2A 2WHRA 4B6SA 5CYGA 1QFYA 3OZXA 3EEIA 3MFQA 5I9SA 3WU2E 1YIJP 2J09A 3GDGA 3OLZA 2P10A 2PM8A 1SD5A 3OCVA 1MIOA 3SP1A 3VO2A 1V7ZA 4NCJA 3MGGA 3LVRE 3E8SA 1P4GA 1XKXA 2DFNA 1D6NA 3KZXA 4Q21A 3LBYA 1EX9A 2FXOA 3B6ZA 3AR7A 1H23A 1JR3A 2BTOA 3BL5A 3A05A 4RMIA 5DTIA 5IC6A 4E14A 1PK9A 4KH1A 3HY6A 4JYBA 4HDNB 3CZMA 1IRIA 1BN6A 2LXNA 1L9XA 1A5AB 3QENA 3ZDZB 1XZGA 1BVHA 3FFWA 5FQNA 3CEJA 1Q0LA 2RAUA 4H0LD 1KBQA 2QRQA 3V3TA 3G7SA 3BGIA 2PGNA 2WPRA 3OZIA 3FTFA 1YB5A 1XRMA 2R00C 2Y67A 1QDEA 5JBNA 2KUBA 1EUCB 1CC1S 3OIFA 3WSWA 3BQ9A 1Q1EA 4DTCA 5CVVA 4QSHA 4M54A 3A4IA 4MYTA 2LKDA 3X3HA 3G23A 1MGPA 1QL1A 3Q3EA 3AJEA 4J1TC 3UWPA 1ORDA 4RGQA 3QKSB 4Q39A 4GOEA 1Y9EA 1CUDA 3PHCA 4L28A 3E53A 1KE1A 3WR5A 4A26A 1P1CA 4B4UA 2JD2A 4Z53A 1V47A 1JEEA 2P4UA 3DAOA 3EFBA 3ZWDA 1TF7A 3ACCA 3KVRA 5KVQA 2BR5A 4ER3A 1A95A 2IOYA 3IIKA 3LPMA 5CH5A 3UANA 1QK4A 5I7WA 3CEPB 2FWJA 5CPFA 2Y71A 3Q5DA 1DKPA 2HRQA 4MKHA 3LX4A 4E70A 1Z4IA 1U1FA 1E2JA 4KOAA 3NHFA 3ADCA 2JIOA 2ZI9A 1OW6A 1PJ2A 2DY1A 3AFIA 3CUKA 4YP6A 3TTXA 1Z38A 4UAUA 1CY6A 2J5XA 2B8JA 4BJ5A 2O1XA 2XTAA 2HMAA 5ECWA 3GMTA 4CKBB 2BEZF 1E3MA 2WSFJ 2FQQA 2IEYA 3FPKA 4NS1A 4EJ2A 3DW1X 2IPPA 4IV0A 2ITAA 3KT3A 3Q15C 4JC4A 3NV9A 3LLMA 4H27A 1JIXA 1IY2A 1C9EA 3WLKX 2A67A 3H2SA 1BHQ1 3LV8A 4BLRA 5KO2A 2XZRA 2PBLA 1W85B 3X1XA 4ZJPA 4POAA 3A6PC 3FCYA 4YRAA 3HYCA 4RXTA 1JBKA 2QRNA 4CM4B 3KYCB 1J9EA 1EK1A 2GNPA 1G8SA 4NNJA 3ETNA 2EGHA 2YIUC 4R2JA 2Q45A 1KYYA 4MUEA 1RLMA 3KQHA 4FMCF 3A2NA 1FXWF 4HWKA 2AOVA 2PXHA 2VJMB 3KR2A 4HB0A 1SPXA 4P0TA 3JYQA 4X6UA 4GLBA 3U19A 1YTZI 1UH5A 4LV6A 4RDIA 5JD5A 2RB4A 4HDAA 3MF4A 1WB4A 2BAGA 5GGXA 1MOQA 2WYOA 1TT5B 1CZLA 1TX4B 3HDQA 1Z34A 4HKTA 4PTYA 5LDHA 1W2BO 2RK3A 1SVWA 2OBNA 3G8BA 3UJHA 3WLIA 5B7GA 2LRHA 1IL0A 4TM7A 1MMFB 3IPAA 4MPJA 2OAEA 3MWGA 4PC7A 4E0BA 5E7QA 3P7KA 1ZD5A 1IZ9A 2PZAA 4JU8A 1MRSA 4FCCA 1ZGGA 4ARZB 1WNFA 4US0R 4QGFA 1FDVA 1FS0E 1ZL0A 4UVEA 4EGJA 3JARB 2E37A 2JJMA 4QUEA 4B3CA 1M2EA 1B0ZA 1NTZE 1H42A 3WLHA 3TF5A 1YJ5A 1B74A 2HJSA 3KKQA 3FDZB 1HLGA 5A3RA 5CLQA 1E6KA 5GV7A 1QYDA 3STHA 4DR2B 1QGUB 3RUHA 2MSEB 1VBNA 4JD5A 1LTKA 4MICA 1PS0A 2QPAA 5IKPA 2DBQA 3H11B 3RNLA 1G7RA 2P7HA 4I1RA 4OA8A 2EP7A 2OQRA 2QRGA 4OV6B 1A8QA 2VHXA 2CLLB 4I2VA 2QN7A 3Q72A 3B1XA 3KU4A 3R0ZA 3B2NA 5I51A 1FLVA 2PKRA 2O1WA 3UIAA 2VNIA 4IOIH 2X0IA 3IBFA 3NH9A 5TT1A 2RH5A 1A2BA 1ND5A 3L7MA 4A8JB 5LP1A 3AKZA 5I3ZA 1JWAB 3FYUA 2VRSA 4EG3A 4XE5B 1NZJA 1V8PA 3WLAA 2RONA 1PSWA 2C7GA 1OROA 1JQEA 1YK0A 3D4OA 1LDBA 2A1IA 4LSZA 3G0HA 3GFVA 3O26A 3LGSA 3K0AA 1H2ZA 3CF4A 1QR2A 4MUMA 5EGNA 3UMVA 1QHYA 3E48A 1XEAA 2OY0A 2P9QA 2Z58A 3DP7A 3K92A 4YCCA 3CBGA 2MMGA 4RTPA 4RXUA 3BEDA 5HIKA 3VP9A 4WXYB 1KFNA 3N3BC 1CB0A 1LBQA 3GI1A 4DMGA 2J9XB 1MORA 1RDFA 3ER6A 5ABPA 1ZR2A 1OT3A 3SSOA 4EOGA 4PYMA 5DSTA 3DDCA 5CA1F 1R0YA 1A82A 2PEZA 3B5IA 3GH1A 3GP3A 1VMIA 2UKDA 4YA6A 4CRWB 5DGXA 3L6EA 2O50A 5DASA 5ALMA 3CE9A 1S3SA 3ET4A 6REQA 5EFZA 2RHOA 4L4UA 5JSUA 1LB1B 2XGJA 3B82A 1H6CA 5KYGA 3NLLA 4QTZA 1D4FA 3P9XA 1GD1O 1XK7A 3HVUA 3FVRA 4BJ6A 4WLEA 1E0SA 1IH8A 4B3JA 4YJ2B 3PUKA 4RKWA 4ZWNA 1K66A 2B3TA 4BKUA 2FWBA 3A8TA 4N9QA 5A62A 2HPCB 2HV8A 1WTCA 1QP8A 1LZLA 5F5NA 1QKIA 4WZ6A 1KOLA 4GEGA 5FX2A 3FYTA 1OFUX 1SXJA 2Q1WA 3C14C 2QVCA 1RAGA 2HPAA 1SQQG 3AT1A 3C0KA 2QAJA 4ILKA 3SEFA 3A1CA 3S44A 1EX7A 4F97A 1TTQB 1DU4A 2YYZA 4A1OA 1C1XA 2K87A 2D7JA 2SICE 1S3JA 2Z6AA 1EQ2A 3PT5A 5GM2A 2FOXA 3OZGA 1UP7A 3QLUA 1IWPB 4IV8A 5TPWB 2IV2X 2ZPUA 1VYVA 2Z98A 1ZRTD 4XYMA 1LVUA 1ISPA 3GPCA 3NBFA 4DCPA 3CJTA 2VSNA 3C3KA 1UPFA 1H5NA 1U80A 1QF7A 4MVJA 3WGZA 3K6SA 3SFDC 3BTSA 2VPIA 2QS9A 1CQJB 1KNQA 2VLIA 3MWJA 1UIRA 1YB4A 1P2SA 1EVKA 1NP3A 4EJFA 2BEVA 5EEGA 2W6PA 5FL7D 3T5AA 4F3YA 3MOSA 3KVNA 2HPCA 1FNBA 4CQMD 5A1TA 3QBVA 3CNBA 1FC0A 3NWEA 4TYMA 3LLVA 2W71A 4XA4A 4H1HA 1FC2C 2OQ2A 4DNXA 4LF7B 3ZXXA 1RIFA 3FAKA 4TWZA 5F12A 2GI4A 1Y4ZA 2I8LA 1NF2A 1J2UA 2ZYSA 4QE3A 1J2TA 4UU0A 5KX5A 1OHHD 2VHVA 3QYFA 4WWIA 4LF4B 4BNXA 3ENZA 3R74A 1LPSA 3H42B 4U02A 1ODFA 1VQ4P 1T2EA 2XF2A 1FZCB 3GJ5A 4L8YA 2Q99A 4Q9KA 5TF0A 2YN0A 4CMHA 5H02A 4XWWA 2BHLA 4K9QA 1LPPA 2OXTA 5U9CA 1T25A 2Z6QA 1SO8A 1Q7BA 2ZQZA 2YJZA 3BIXA 3AYXB 3AL3A 3DR5A 1K7XB 3UCEA 3VVBA 4E5UA 3UJ6A 3X1KA 1XZJA 1IDN1 2GPBA 3HA5A 1NN0A 4Y9RA 4EWLA 1VYTA 3SQNA 3P0FA 3KZIE 4B31A 2B8EA 1FRZA 2D7CA 4KV9A 5CA0B 1K97A 2AOWA 2XDJA 3A1SA 4HSGA 1L7NA 2BZ0A 2BFWA 3B7WA 3NBYC 4EB8A 3CLKA 5CB6A 1YRYE 1VQ8P 2IITA 2BGKA 2G06A 4XGRA 3F2VA 2LR0A 2W98A 2XF8A 1CDDA 1PR6A 2FHPA 2I6UA 5KJFA 4AJHA 2WF7A 4HYTB 1VF5B 4C4SA 1HV8A 1JB0J 1Y7IA 1RXWA 1YASA 5IJXA 2EJVA 1JW9B 1IMJA 2VCEA 4DSZA 1IO4A 5L7YA 1U6KA 4HDMA 3T54A 1URPA 2H8KA 4F3CA 3NHPA 3TFOA 3QE2A 1VE1A 3M1LA 4S24A 1UKAA 1N2DC 1I7NA 2J3DA 1VOTA 2OBBA 3PSAA 3LPNA 5TPZA 1AZTA 3DMTA 4DGSA 5BN3A 2VHCA 2IEGA 4S35A 3WQRA 4TLFA 2F00A 3NYWA 5CX4A 1IXZA 1S2MA 1S1CX 3HP7A 4OP1A 3V8RA 5ADHA 2WQ6A 4DR5B 3W8FA 3CNEA 5APWA 3GGOA 3OM8A 1UBHS 1QXSA 2IVFA 1JM0A 3TSIA 1RJGA 1G9SA 1H8EA 1W5TA 3HUTA 2BC9A 4ETIA 5KOHB 3R5XA 3KOUA 1FZGA 1OKKA 2OM6A 2Q9BA 4AQRD 2UVQA 4ZAVA 1NTOA 3HY3A 5F3DA 3L6DA 1Z68A 4KLAA 4NV3A 4PW0A 4UDNA 3UIEA 1CDOA 2CNNA 2IYZA 5CA0F 3CC8A 3IOYA 3C7AA 4LE2A 3OKFA 3OJAB 4H1UA 1EUQA 1JKIA 1JB1A 1CS0B 2Z2JA 3STWA 1LLCA 2BEJA 3K5HA 5A1JA 4QBGB 1FMFA 1S5PA 4D44A 4ND1A 2WZDA 1CG6A 3CCLP 4FD3A 2BUBA 2P3QA 3RVRA 1ZEMA 2GRAA 3K72B 2X42A 2P75A 3HR7A 4MUIA 4RV4A 3DMDA 3OEHA 3IVAA 4X61A 1P3JA 1EJ2A 1KO5A 3E9EA 3NRBA 3OUUA 1IBSA 4Q9DA 4BNLA 4Y2YA 3SI7A 2PJUA 1JCDA 1EXDA 1J97A 4M0EA 2QTFA 2ZYWX 3H1LD 4EYYQ 1N0UA 3P2MA 5CLIA 2K2WA 3RFXA 3Q7RA 2KW5A 2DPLA 2VP5A 1WETA 4PD4I 3DDWA 5HG0A 4YMTA 4A15A 1JFRA 3B3FA 1L3CA 3BQMB 3CFYA 4U7TB 4DSAA 3DAYA 4MQBA 5ALUA 3DE3X 2G72A 2HTFA 2X1MA 2Y0BA 3UT5B 3V1YA 2Y4NA 3N0RA 2P2SA 4L75A 5HF8A 3DEJA 4JSYA 2V9PA 4Y0VA 2Q0HA 1XA4A 4KWIA 4MP3A 2UZ3A 5FBKA 2EJUA 1AUOA 5EIBD 2E55A 3VR1A 4FGUA 4AZSA 1WUHS 2O2SA 4G85A 2CW5A 1XJ5A 4HBZA 4ZDWA 4HAOA 3NZEA 3U80A 2ZJYA 4MR8A 2EYQA 1XD8A 4H6XA 4NU8X 1FVFA 3G2QA 3JQEA 2YXPX 4FN4A 4KC0A 2DH5A 3JWEA 1XU4A 2DHRA 3B8EA 4G8CA 3S70A 2XZOA 4ABTA 4QA9A 2KLBA 5AW3B 4R40A 3S99A 4ZYVA 4Q12A 2Q5CA 1N3YA 1TUEA 3D31A 5KLVK 3L9WA 4HDSB 1JEYB 2YXNA 2O19A 4JI5B 3UAYA 2TYSB 3ID6C 4HUTA 5ITWA 4TT8A 1BSVA 2IYYA 1XVVA 2R6DA 5L45A 1NR7A 3HYTA 3HXTA 1KNXA 4PC3A 5BSGA 3A7OA 1MJGA 1JLLA 4RNDB 2HSGA 3L8HA 1EUCA 2BSXA 3N2LA 1MG5A 4DCMA 3FTPA 3VJLA 1QIHA 1DMSA 2ZJ7A 3QA9A 2A9VA 5D8DA 5C4IA 4LC0A 2QRJA 3TNYA 4AC9A 2FW8A 1IPHA 1Y47A 3MSCA 2JBHA 5EINA 2K5UA 2ZRPA 4PPNA 4BLTA 5JNRA 1SVUA 4HYYA 4L07A 2Z4TA 2GPJA 4PONA 2GILA 4OGQD 1DX9A 3TIVA 3T7EA 3VA7A 3GLHE 5FA5A 3MNFA 4F1KA 2RD2A 2QA4P 1J0BA 3MQ4A 1SQBD 5B1EA 4DLBA 3BWBA 4OXYA 4D79A 2D54A 4GYJA 3BDAA 4MQFB 4CVNA 2WWRA 4YV2A 1SCNE 2XAAA 2UYGA 5BUQA 4PNEA 1NOKA 3UV6A 3K4QA 3L6OO 3N7TA 1HH4A 2FR8C 1QH8A 2Q62A 2X5XA 3PH0A 3AHDA 4PRZA 1UP6A 3GFBA 4YQEA 1BGYG 3OZWA 1K4MA 2ZBFA 3GPDG 3H8WA 2ZR9A 2IU6A 2J5KA 3TJRA 3LY8A 5E8JA 2GEKA 1QWSA 1MW8X 1DCTA 3HK2A 1L5OA 4L5AA 5A5DA 4M8NE 1W88A 5F23A 4MEJA 3NB0A 4NBWA 3UPTA 5A05A 3QMVA 1O0CA 3EIWA 5E2IA 5FAXA 2AFHE 3CG0A 1KOGA 5JPCA 2PUAA 3WHIA 4DS3A 4YVFA 4CCAA 2DKNA 4HVLA 2C3UA 2PX8A 4QOSA 1L9KA 3Q1LA 4BNZA 4G09A 1AKUA 5KLVE 1MENA 4EVSA 1XROA 4DCTA 5FPYA 4H18A 3G17A 3A2AA 3OFVA 2EAUA 4RK7A 3MYRA 1SELA 4IP0A 5KKAA 4HFRA 2FMTA 1CEYA 5ILGA 4PHCA 4LTMA 4LBZA 2Q9AA 5KSPA 2W6MA 3IP6A 4AQDA 2ZS7A 3W9YA 4R9VA 4RLSA 5IDXA 4Y1FA 3LSYA 4PWYA 3CTVA 3MMSA 3CMMA 4IDEA 1RXYA 3IT3A 5CJPA 4ZYLA 1QLWA 5BYAA 5KZMB 3FYSA 4WZBE 4R2WA 4PTLA 4RPHA 5BWBA 1E79D 3N8HA 3SDBA 2B69A 1B3BA 4N5NA 1TXGA 1FBNA 3ESYA 1PV3A 3QVSA 4B3XA 3ZVKA 4BBPA 4WBSA 2O0LA 1D4ZA 3DNMA 1OX6A 1ZXBA 3CZAA 1I32A 5CUQA 4RZUA 3TCXB 4AI6A 1JR3D 3V46A 2PYZA 3VN0A 1HFEL 2N1TC 1S1CA 2CCJA 1K3FA 4Z99A 4LHXA 1HUQA 1KY5A 1U0HC 2OHVA 3B1YA 2HSEA 3ENNA 5JDCC 3VHRA 4BFSA 2F7SA 4EFMA 2PFSA 2ZDQA 3TQOA 3V1UA 4RD2A 3I12A 5FPPA 1E7SA 1DG9A 3N6VA 2B1IA 2FFBA 1P5JA 4KHZA 3S68A 7REQB 4FFRA 3NJ4A 3T9EA 1RQPA 4EKGA 3VOBA 5JE8A 1TFUA 3CZ9A 4XVQA 2I91A 4ROSA 4ZAZA 4B2LA 5IVPA 3RREA 2WG0A 1KFKB 4MIYA 4RHUA 1P7WA 5JS7A 3OLYA 1XP8A 5FNVF 5CEFA 3HO6A 2JGAA 4P7JA 4KNVA 1S7GA 5JCJA 1Q5PA 3T06B 3VR2D 4RHCA 1GT6A 2WHPB 1VE6A 3AFHA 3AQIA 3VUFA 4B71A 3TKAA 1RLUA 3R6LA 2QM0A 2DFKB 4MO2A 3L8DA 2EIHA 1V8FA 3GD7A 4FYWA 4NYIQ 3R7WA 1KMQA 3UMBA 5AW2A 2HO5A 4ZOLF 2JGNA 5KDOA 4JQOA 4UHDA 2K4MA 1E69A 4L8GA 4RVHA 3NTNA 5BNFA 4D0NA 1NULA 3ONVA 4LBVA 4CG2A 2VT7A 4ER5A 4HDCA 4C78A 4UTPA 5CK4A 2B1QA 4CETA 3M0AA 3PEWA 3FZQA 4AUEA 3KK0A 2W2NA 5LNK1 5CFLA 4JJKA 3NMDA 4Z3OA 1SUWA 4X54A 1MF7A 3D6ZA 5HK9A 2H3HA 5DW0A 1PEKE 5E7JA 2IHYA 2YJ5A 1TVEA 1ZHFA 4TKZA 2VF4X 3RS5A 4YP5A 2B82A 3AE9C 1VPCA 4ZZ1A 4K6OA 1WO8A 2C4MA 1R9MA 1NNI1 4MITA 4PVCA 1DV1A 4LGYA 5E4JA 1QHSA 3F0TA 4NPEA 5IK2A 3C8DA 3KHTA 4OI0A 3D71A 4D9IA 3MSXA 5JFGA 1SN7A 1ABEA 2H1LA 2BEKA 2QIWA 1P7PA 3NHAA 3GNTA 4L8VA 1UIIA 1E58A 4O8ZA 2Y76A 1XZAA 1JDZA 4QM6A 1EFPB 1XLUA 2Q3HA 2WYHA 4D56A 4AL4A 2ZUBA 1YI0A 4KR0A 3OZUA 2BEUB 1UUFA 2HIAA 3PNOA 4CPDA 5IZCC 1YS2X 3QF4A 3FSEA 2O3SA 5BNZA 2AXPA 2HDNB 2SBTA 1NLZA 4DG5A 1JE0A 3KE9A 3JQFC 1YR2A 1SUAA 3HL4A 2HGZA 4B3RB 1GQFA 4HEHA 1MO3A 4ZTUB 1BDHA 3PI6A 2R6HA 1KZGB 3O6VA 3OZEA 2G07A 3AONB 3BMXA 4L4ZA 1IC6A 4NH4A 3J7TA 4XWYA 2VEOA 1YJCA 5K6RA 2YKQA 3ENVA 5AJYA 5DGDA 4YR7A 3MCWA 3LP6A 5D5HA 5IDWA 4UFNA 3FW1A 3Q9NA 2V5UA 3UH0A 1AGXA 1M5TA 2FZEA 4ZPJA 3O8ZA 1P8AA 1Y5IA 4D7AA 4WBNF 2QD1A 2OWEA 4FZJA 1CR4A 3BTVA 1LSOA 1XQVA 3BHMA 4HAZA 4C5AA 3WFIA 1KPIA 1WBJB 3KRTA 1NTKD 4IGAA 4K28A 2C84A 2ODBA 3OECA 4PZYA 4D9FA 2ORED 4EUKA 2E89A 3RIHA 1IN5A 6YASA 3PEYA 3HR8A 4JBHA 3TZHA 5HWSA 1FDTA 4KBFA 4GMHA 4HLNA 3KQTA 1WD7A 3EWNA 2HSDA 3B1JA 4KN6A 2AVNA 4JBWA 4II2A 3V42A 2JLQA 4C14A 3P2OA 4XASA 1OWOA 4KIWA 4RKQA 4RK5A 3IDOA 1VQLP 1L0LG 1T2CA 2H1RA 5GQSA 5KWVA 3BXZA 3HJRA 1GNPA 4Y2UA 2ANCA 3L72J 3QWOC 5EFWB 1QLJA 4JBXA 1FFAA 1HDGO 1K8QA 1Z12A 2ISCA 3HJFA 4ZPXA 3NWOA 2CYAA 3NFYA 1EVJA 2F90A 1MU0A 2I4OA 1OBVA 4LJYA 3VU9B 1GNVA 1XZMA 3EWSA 1XT6A 2OTKE 1WP4A 3P0EA 3PGVA 3QITA 1C30A 4ZVOA 3P5SA 3M1IA 5KJEA 1IB6A 5B7NA 2VUIB 1BYIA 4CXMA 2F8SA 2AUTA 2VH2A 4NBTA 4KT0J 4P93A 4Z6KA 1CHNA 4LHEA 3PIRA 1CSEE 4KU4A 2H63A 3E3LA 1CZUA 2VHZA 1LT1A 2Q9CA 1J2JB 2RIRA 4KW7A 4Q3OA 3UJCA 3TD6A 4CMEC 3H75A 1R3DA 4E88A 4YMLA 4I6MC 2IK8A 2GEJA 3K4HA 4XSHA 2J9FA 4LZLA 1T3UA 1TEVA 1YR1A 4BGUA 2JB9A 3DVQX 1C4OA 4FYVA 2IPAB 2X2OA 3IOEA 3EG9A 1FL9A 2IHVA 3OCCA 5HDBB 3VXKA 1PJBA 1DS6A 5JD3A 5JO0A 5LZ2A 3JZAA 2VP9A 2AD5A 2Q8QA 1J00A 2VCHA 2FFDC 2JFVA 4KQHA 1AGNA 2E82A 3FCEA 4BFTA 2DPYA 2QL7A 4Y2XA 1PS8A 5MN6A 2G9UA 4TVSA 3C85A 5HQTA 1QCZA 1EVQA 4EIJA 4DIDA 4KGZA 5DCYA 5DISB 5IU6A 1ZMTA 3RC9A 1KERA 2NUBA 3ZXYA 1U57A 3H2ZA 1DBWA 4PGMA 4D4GA 2FDXA 1HOTA 1MVOA 3LC2O 5FB3A 4XSVA 1IE3A 3CUSA 5T3UA 4JI4B 5FNZA 1Q0SA 1ZIPA 3W3AD 4JLUA 4B8ZA 2FPIA 4C22A 3PFHA 1OHHA 3GVCA 3OIVA 3QPWA 3PIDA 3WQSB 4LRXA 2PTHA 1JG6A 3W79A 4WLVA 1ZKDA 2VH1A 1SCAA 1T0UA 2PZKA 5JZOA 3QWHA 1N7LA 4JY7A 1UANA 2AV6A 4W8OA 5ULLA 3WLQA 3H6GA 3L0CA 3AF1A 4IQFA 4MKFA 3AJ8A 4OUKX 2E42A 5E7MA 3UHAA 3O7MA 5M2QA 3HFRA 3MHPA 4NF2A 3UW1A 3SHOA 4Y6LA 3TBHA 1TE2A 3EODA 3GA5A 3UFXB 3ZNOA 4Z4QA 4TTQA 3WLNA 1R8QA 5CVEA 5AW1A 1F14A 5E38A 4ZAYA 1GJRA 3NP7A 4K88A 3LX6A 1XYVA 3M4ZA 3PQFA 4J0KA 3ZBPA 2CLIB 1NNEA 3HDVA 2VKTA 4BFLA 1LPAB 3FZNA 4ER6A 3RUEA 3SEQA 3GUHA 4LWOA 1W94A 2WB2A 2FFHA 1KKUA 3DHVA 1A98A 4N9WA 3I04M 4DXHA 2X6TA 2JFXA 3LXUX 4TMFA 2RK6A 3P27A 4ZGBA 3QU5A 3IYLW 5IVIA 4Z86A 4EG6A 3NC1C 4HKZH 3RFUA 3TZ6A 2XUAA 2HF2A 4HTFA 1FEZA 2VYVA 5BV1A 2LD4A 3L40A 4N7JA 2GWHA 3D4NA 5AESA 4JGIA 1T34A 4D3FA 1QGAA 2CFRA 2GN9A 3GBPA 1H8HD 3OMLA 4TVOA 4DV1B 3RUAA 1VDFA 3REQB 4LWPA 3OJ0A 2IXEA 1SWWA 2M6LA 1D3AA 4WTOA 3VPAA 3GG2A 2ZIXA 1O4VA 1UBJS 3R6WA 3RGUA 3JZDA 2C9OA 4BV9A 2QD5A 2A58A 1YR9A 2ID4A 2DQKA 3CSUA 1BGYE 4PSDA 1Y6QA 2PV0A 4QU8A 1ADJA 1K86A 3V4OA 1PZGA 3M3DA 1PI3A 1BQEA 4MS1A 2KK7A 4MWBA 4BXOB 5AVTB 3L70E 3A3PA 5A0FA 1ICEA 1PJLA 1GUZA 2H2GA 3M5WA 4LXUA 4QOHA 3D6UA 5G1OA 3NDIA 5COBA 3B6KA 1Q19A 3RTAA 4HG2A 4II3A 1O5OA 3K71B 4A8PA 2ONZA 1YL5A 3K32A 4L8LA 1W9HA 2H4FA 4DE5A 5AVYA 4IHKA 2OV4A 4CDRA 2M5AA 3PU6A 4PLZA 5FWNA 2OZLA 2ODEA 2OK7A 3WDLA