2ZYGA

Apo-form of dimeric 6-phosphogluconate dehydrogenase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
466
structure length
466
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGIFHTEWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 177
structure length 466
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zygA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zygA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zygA01
4PLPA 4B7UA 3DOJA 5KJCA 2B37A 3M1LA 2A92A 2C59A 3I6IA 2NTJA 4B8WA 4Z9FA 5A05A 1JU9A 3CZMA 4CMBA 2WD8A 2X4GA 2GN9A 2ZYAA 1UJMA 1A4UA 2RH8A 3I23A 5TX7A 1AN9A 1UP4A 2YQ5A 3MJCA 4NH4A 1DRWA 1ONPA 2DBRA 4E5PA 2J6IA 1WAMA 3DTYA 5ADHA 3RIHA 1GPDG 2D8AA 4U5QA 3EC7A 4Z9XA 4IMPA 1HRDA 1UAYA 2CNBA 4UULA 2X0RA 1XU7A 3O03A 3LT1A 4NNJA 4Y9DA 3PYXA 1A72A 3GFBA 2VHXA 3H9UA 2QZZA 3L6OO 1KC1A 3TZKA 2PD4A 3F5QA 3FHLA 3ZHXA 2Y05A 5JCJD 3QA9A 4ZU3A 2QG4A 5K9ZA 1VSUA 5U9CA 3KSUA 1QV7A 4IY1A 4N7RA 1E5QA 2J5RA 4I8XA 4RVFA 4D0SA 4DWVA 1BW9A 4LRSB 3VPGA 4OL9A 1NP3A 4J0EA 2G82A 3WLEA 1ADCA 3PLRA 2UUOA 5A5EA 3CIFA 4JXKA 3ZWVA 1HL3A 5C5IA 3V2HA 2OP1A 2E6UX 4HKTA 1B0AA 6LDHA 1NAHA 5BNIA 5KCZA 1QYWA 1GADO 1TVEA 1EFLA 3B1FA 3E5RA 2V6MA 3MWDB 4Z0PA 1HE2A 4YJDA 3KOUA 3KYBA 1DB3A 5I8ZA 1ZJZA 1Z6ZA 3GNQA 1E6WA 1LQTA 3OJFA 5KVSA 4JN6B 4CMEA 4J9VA 1I2ZA 1LTHR 4IJKA 1ENZA 2NV6A 1NVGA 1H9BA 2GZ2A 2VTDA 3VDQA 3AI1A 4NR0A 3QIVA 3PRJA 4BO6A 3JD4A 4W99A 2HCTA 4UVGA 3AJRA 4QO8A 5C7LO 2PLAA 3BMOB 3D3EA 2PKQP 4JJIA 4MPDA 5JO9A 3E48A 4ZGWA 5K0ZA 2AE2A 3AI2A 3JYNA 3ONEA 4AJHA 1CERA 4CUKA 1M6WA 1YDWA 1DRUA 3EDMA 4GVLA 4J0FA 4NMHA 4WKGA 1CEQA 1NWCA 3LZ6A 4GSLA 3Q0EA 3CPSA 1C14A 4FC7A 2O3QA 2WSBA 2AQ8A 3DBRA 3RD5A 3X2FA 4BKOA 3OQBA 2NTNA 4GWKA 3I9KA 5T6BA 1A71A 1DC5A 1EQ2A 1P1IA 3L4BA 4CQMD 1GQ2A 1DIGA 2D3TA 4CM8A 1HTBA 2OBNA 1BWSA 1ISHA 3DBLB 4MVJE 3K2EA 1B8UA 2PTGA 5FI3A 1MXHA 4R1TA 5JFOA 3V2GA 4RVHA 1H6AA 3U09A 1LSJA 2XXJA 3QVTA 1YH3A 2YZ7A 3HDQA 3U5TA 1PZHA 3ZNQA 3E8XA 4RJTA 2QRLA 2IEDA 1YRLA 3RVDA 5C7OO 1SOWA 4KUGA 2HDHA 3HZZA 5DBGA 3TL2A 3W6ZA 4CV0A 2R00C 4YA6A 2VWPA 3D3WB 4I9NA 5G0WA 3CEAA 4WOKA 2VTEA 3BYZA 2ZJ0A 2WDZA 4ZICA 4HV4A 1R0SA 2V6BA 5A02A 1DAOA 3AY7A 4QECA 4DVJA 1ZSVA 2I67A 1LLCA 1U2DA 1J6UA 2O3RA 1ZK4A 4BMVA 4EJ6A 3G17A 4A0SA 5I9MA 5IDWA 1OC4A 4KUHA 4E33A 4YT5A 3DEYX 1E1LA 2B4RO 4BQRA 1XSEA 3BTVA 1ZZEA 1SB9A 4G2NA 3PWZA 3F47A 1UDBA 3TZQA 2CDCA 3RUEA 5AVOA 2EJWA 1NHGA 3ZV6A 5JCXA 4L4XA 4FN4A 2P5UA 5JPIA 5JDIC 1CQIA 2WD7B 2D1YA 2WYVA 1NPDA 5A9SA 4YAKA 1A9YA 4L75A 1FDSA 2NACA 3ORFA 2D0IA 4NI5A 2C07A 3PGJA 2QRKA 4QFDA 2ZB3A 4DIBA 3EY4A 4WCFB 4FS3A 4BO9A 3GK3A 4WEQA 2H63A 2ZJ1A 1RPNA 2J3HA 4LMRA 3OBBA 3ZWXA 4BO0A 3PYMA 5JXWA 1SOVA 2DFDA 5U4QA 2HK8A 2HRBA 4TRNA 4EW6A 1IZ9A 1IY8A 4O1MA 2EV9A 3QSGA 1R0LA 3DC2A 1XWFA 4U7WA 3FSRA 4CQMA 5JDCA 3EZLA 1P74A 2D4AA 3F3SA 3QW2A 1O0SA 2UAGA 3KUXA 4YBZA 1T24A 1DLIA 1YBVA 1MG5A 4G81A 2ZATA 4WCDA 4PFJA 3UHAA 1GYPA 1QV6A 3RBZA 1ZNQO 5AYVA 4E2YA 2UVDA 1JAYA 3W8EA 3UVEA 2NQTA 3IJPA 3WTBA 2VWHA 4E31A 4A2CA 3CTVA 1Z73A 4E32A 5HS6A 1Z75A 4FGWA 3KLMX 4YRBA 3GDOA 3WOHA 1SCUA 1YQGA 3SXPA 3UCXA 2PH3A 2GYYA 1LEHA 1U9JA 1YKFA 1YXMA 3CINA 3NGXA 2P68A 1I2BA 1QKIA 4M86A 5JAIA 3EW7A 4IXWA 4WE3A 5FF9A 2CMDA 2FN7A 5A9RA 4OQYA 3EUWA 3TZCA 4CMEC 3KBOA 3PWSA 1ZKMA 2FOIA 4U6QA 4KQWA 4R01A 2EXXA 3PIDA 4MDHA 1HDRA 1N92A 4HNGA 2BGLA 4IINA 1VJ1A 1H93A 3NTQA 4YJFA 5GY7A 2BH9A 1R4NA 4R1NA 1JWAB 3PPIA 3VKUA 1ENPA 5L4LA 1O5IA 1GUYA 3NX4A 5FFFA 4OKNA 3VH1A 1N7HA 5DZSA 4PLVA 3COSA 2Q1TA 3QJ5A 4QQRA 2W98A 3WQSB 9LDTA 2NU7A 2G1UA 3L9WA 3SVTA 1BDBA 1RKXA 4UUPA 2ZTMA 1DC4A 2Y0CA 1BTOA 4F46A 3RFTA 2IZ1A 2RHCA 4E0BA 1VJ0A 4BHTA 3O4RA 4HY3A 2LDXA 1X1TA 2OO5A 4GX1A 2Q1UA 2VN8A 4FSHA 2YFQA 1JKIA 2BD0A 1MV8A 4QSMA 3RC1A 1PL6A 3ONDA 2PZMA 4Y6RA 1PQWA 4WLNA 5H82A 3HG7A 3WMXA 1HE4A 1M66A 1AVYA 1P0FA 1ULSA 3PP8A 4XJTA 2EP7A 3OJOA 4XJSA 1IE3A 2IYOA 4GKBA 2BFAA 4A03A 2NVUA 1DSSG 3GZNB 4DBZA 5BNTA 1O94A 1P33A 2Y1OA 4W4TA 4OYRA 1RM4A 4H3VA 2OMEA 1B14A 2VWGA 1QYCA 1Y1PA 3INGA 2HMUA 5BSEA 1XLTA 2O7SA 3BHJA 4TZTA 1QYVA 1TT5A 1N9GB 4OGWA 3TFQA 1XGKA 2PZLA 3A14A 3JSAA 4YWJA 2VRCD 5BSHA 1Z74A 1P3DA 1ISJA 1LC0A 5IN4A 1I36A 2VWQA 3P7MA 1C1XA 3I5MA 1LLDA 1PX0A 1T4BA 3B20A 4PZEA 1NBOA 5JO0A 3SC6A 3F9IA 4XB2A 3M2PA 1UDAA 3D5TA 3FTPA 4NBWA 4GI2A 4S3MA 2PZJA 4IZIA 3DZFA 2D5AA 2TMGA 2CVQA 4II3A 3PJEA 1ENOA 1F8FA 3AM3A 5CHEA 4MJLA 5L7YA 1EDOA 4BNTA 4J1SA 5I7FA 4BB5A 1LUAA 3L4BC 4ALJA 5ER6A 1N1GA 2W2LD 2AA3A 1EUCA 4WNIA 2OBYA 1C1DA 3VVBA 3ZWBA 3OEYA 4W7HA 2JFHA 3AUUA 2O4UX 3PWKA 4D42A 1I10A 2GDZA 4OSOA 4UEKA 3DBHA 4YAGA 3FR8A 4D7AA 5AXCA 2VRBA 3UICA 2W8ZA 4PRKA 4RPJA 1B8PA 4IMRA 4MVJP 3DBVO 4DA9A 4WEOA 4NBRA 5EPOA 1E3WB 4AJ4A 5DF1A 4YJGB 1A5ZA 4BNLA 3C7DB 2FR0A 1HSOA 3HB4X 1C3VA 4INAA 4GWGA 3FTNA 2I66A 2PR2A 1R0KA 5A1TA 4ZN6A 1LRKA 3TRIA 4CL3A 1H9AA 4B4OA 1WLYA 4CQLA 1T2CA 2FZEA 4CLDA 3ICCA 5T8KC 2ZKLA 3EHEA 3IAHA 1Q7CA 3RBVA 3UUWA 3WGQA 5G2OA 3WSWA 4K6CA 2YW9A 4FR5A 4OXYA 3WSVA 1N5DA 5GZ1A 3MCVA 1E3WA 4JCOA 2YHIB 2Y1GA 1L7DA 4BNXA 2QYSA 1DIRA 4BV9A 2VZ8A 3NJ4A 4XD2A 5LCXA 3IQDB 2RBEA 1H0KA 6ADHA 3F5SA 3WB9A 4GSKA 2Z95A 4D43A 4ND1A 2GZ3A 4BKQA 3U3XA 1CETA 1JTVA 4QXMA 5KJFA 3UAGA 1HLPA 5LDGA 4I5EA 4S1VA 4XX0A 2O4CA 1VL0A 3S2FA 7MDHA 2WYWA 4FB5A 3F1LA 5JY6A 3ANNA 1PS0A 1NX6A 4D46A 2D59A 5KVQA 3OICA 2FSSA 3CZRA 1TA4A 2PWZA 4UVHA 5TSDA 1GV1A 2NVWA 3H5NA 2V6FA 5ILOA 3HFGA 5H81A 5TT0A 4CM4A 4BUCA 3VKVA 5BSGA 1V3VA 1ZBQA 1ZJYA 5F21A 3DOOA 4PG4A 4G5HA 1VL8A 3R3JA 4R5HA 4BO8A 1NYTA 1U4OA 2Y0DA 4KDFA 4QEDA 1IUKA 2PKRA 3L6DA 1JN0A 3VZQA 4BNNA 3PGXA 2ZTVA 1DHRA 4TKLA 2BFMA 3ETEA 5L7WA 4IJWA 4L8VA 2W2KA 1V8BA 1Y5MA 2GD1O 2RIRA 2YV3A 1E77A 1KY4A 5DT9A 3G1UA 5BT9A 3HB5X 5C37A 3R0IA 5DP1A 4JGBA 3ADPA 4GBJA 2EW2A 4E5NA 4UUNA 1EEHA 4YT4A 4CM7A 3WIEA 4HWKA 4E3ZA 4R69A 2AW5A 1B16A 5TC4A 1YQDA 2DUWA 2ZTUA 3U4DA 4L4SA 1MC5A 4OXNA 1CDOA 4ND2A 3JQ7B 3GNTA 4KQXA 4IDFA 4ZRMA 3W8FA 2Z1NA 3PEFA 3DL2A 4FQ8A 1VKNA 4WGGA 3GDGA 3K73O 1PTJA 4HFNA 3WS7A 2YV1A 3GUYA 3HQ4O 2E4AA 3A06A 1K5HA 4HBGA 9LDBA 2EKQA 3ZWCA 4AJJA 1KIFA 2OORA 3JQCA 4H16A 4OOFA 1W73A 1MXFA 4FPXA 3NGLA 4FFNA 3HN2A 3WTCA 3VAZA 1ZK2A 3V1UA 1R4MB 3FWZA 2BFOA 1SZJG 4O63O 1SB8A 1KETA 3PXXA 1RYDA 1Q2XA 4XYLA 3GQVA 5IN5A 3LF2A 1WVGA 3RASA 3VZPA 5JAMA 4DBVO 1EVIA 5HS4A 2E82A 4J1NA 3SLKA 5IF3A 4Z6KA 4OSPA 1KYQA 2X0NA 4YB8A 1BVRA 4B3HA 5ICMA 5DN9A 4A73A 1FF9A 1N2SA 1PJLA 2A94A 4BKRA 4BO2A 4ALIA 2JD2A 1NQ5A 3K6JA 5H83A 5TLSA 3BAZA 1U1IA 3A28A 1ZEMA 2HMVA 4J1QA 3BHMA 4DXHA 3D0OA 2HMTA 2PGJA 4IDDA 1V9LA 4OH1A 4CM3A 2BRUA 5KJEA 5KVCA 2GLXA 2O7QA 4J90A 3JQDA 4EJMA 1B2LA 4DRYA 1YWGO 3ASUA 1OOEA 5KKCA 1NQTA 3LQFA 3M6IA 1RM0A 4XEHA 3RUAA 2GCGA 1H6BA 2ZCVA 4MVJG 1IYZA 1Y5RA 2EJVA 4J2OA 4YJFB 4NJMB 3TOXA 4K6FA 2AQHA 3MJSA 3PJGA 4Q3EA 1P1HA 4ONEA 2X6TA 4ROSA 5ICSA 1PGQA 1VLLA 4R68A 4TQGA 2VYVA 1MUUA 5BR7A 3NDRA 2Q1SA 1V6AA 4IDCA 3E9MA 2AG8A 1R66A 1M75A 2A35A 2YV2A 3GFGA 4UEOA 1GCUA 3KEQA 4YYZA 3DBLA 1I3NA 3H9EO 4J16A 5CFZA 5IZCC 4C7JA 1R6DA 1I2CA 7ADHA 2R00A 3DB2A 3ENKA 5LDHA 4R9RA 2PY6A 5B12A 4J91A 2PA3A 4A26A 3W8DA 4KZPA 3TL3A 3GDFA 3U9LA 2VZ0A 1SO8A 5EIOA 3RUIA 3PJFA 3DMYA 2ZTLA 2NQ8A 4WLFA 2BLLA 5TRTA 5B1YA 3HJAA 4M49A 2QX7A 2VHYA 1ZK1A 3L07A 3VZRA 3NV9A 4L4RA 3ZWPA 5GMOA 1TEHA 1KVUA 1ZW1A 2GRAA 1K89A 2FR1A 4D0RA 2HSDA 1PGOA 1D8AA 4FFOA 5TS3A 3R1IA 4TROA 3DAGA 1OAAA 3QWIA 2CF5A 1UXIA 3VC7A 4M55A 3RUDA 2C7GA 4BQPA 5JDIA 1O95A 2PH5A 1U3WA 3DZKA 5JMWA 4NFYA 4TZKA 4CLHA 5KIAA 5KVVA 4IDEA 2NVBA 1N9GA 3BMOA 3VPSA 1IHYA 3ZHYA 1YONA 2Y1DA 2FPGA 1C0IA 1ORRA 3VZSA 3TNLA 4PVDA 2SCUA 1T26A 5I7VA 2DPHA 4YQYA 2DTXA 3WGGA 3ZI0A 1J5PA 4CV2A 1NR7A 2QHXA 4O6VA 4GH5A 2GGSA 2HAEA 1R15A 4WPGA 1ZEJA 1WDMA 3EGOA 2I76A 3GOHA 2GR9A 2I3GA 2WE8A 5IDYA 3INRA 3RC7A 4E2XA 1U7TA 4RQUA 3DXFA 2OP0A 4FFMA 4AJ1A 4M89A 1IZ0A 1TXGA 1E5LA 2X5OA 1AHIA 5TJHA 4DLAA 2NADA 4XYEA 3WLFA 3WYBA 2CFCA 1LQUA 2J5KA 4K26A 3H6KA 1IB6A 4RPLA 4TRJA 2D2IA 4B3IA 4YEDA 4R54A 2X86A 3GEGA 4II2A 4J1TA 4CM5A 4CQMB 2AG5A 4PZCA 4N18A 4RCVA 3S1LA 3HDJA 4DGSA 5CAEA 3L9XA 3WGOA 1SBYA 4GAEA 3S55A 2C54A 4DYDA 3FI9A 4FIZA 3OJLA 4IQ8A 4RO0A 2CZCA 3DFZA 3ST7A 1NM5A 1AUPA 2Y93A 1UXHA 3R6DA 1UXGA 3I9NA 1XQ6A 2BF7A 1E7RA 1PWXA 1Q1NA 3GVIA 4KDEA 1FK8A 2O50A 1GL3A 2V7PA 4MVJF 4PVCA 4TSKA 3INTA 1E1KA 2PZKA 2VHWA 3DZIA 3ZW8A 3P2YA 4IQGA 2B83A 4J43A 1XHLA 4L9RA 4AICA 1YBMA 3PTZA 2J3KA 2GF2A 5KOIA 3PFWO 5CPFA 1EVZA 3OA2A 3JV7A 2NUAA 3JD1A 2G76A 2WWRA 3LT0A 1FXSA 4Z3KA 1PR3A 3I83A 5K6AC 1ZVMA 1XDWA 3WNQA 1AXEA 1FMCA 2HK7A 4EUFA 3ZU5A 4E5YA 1JQBA 3GVHA 1J4AA 1W8DA 3LT4A 4IBOA 4QTZA 1T2DA 4ZQHA 4E2ZA 3C85A 4WCFA 1P1FA 2E48A 2PGLA 1OFGA 2ZQYA 3EYWA 3KHUA 3QRWA 3OHSX 5KTKA 3P2OA 3Q2IA 3E82A 1ZCJA 1QYXA 4YRDA 2VZ9A 3DONA 4MP6A 2EP5A 3DZHA 4Z9YA 1KY5A 2A9FA 4FJ0A 3GG2A 5JYDA 1YQXA 3AY3A 4RDIA 5F1OA 1Q0LA 5JCJA 3WBFA 4RL6A 5IJZA 4PLGA 4BNFA 1HDYA 4PLTA 4Y6PA 1F12A 4O59O 4XYGA 2P2SA 4B3JA 1Z7EA 2ZIZA 1LDEA 1EK6A 1U7HA 1E3LA 2LDBA 2X5KO 3BIOA 5A3VA 1HEUA 2Z5LA 4W6ZA 5DDIP 4LGVA 3TDKA 4E5MA 3AUTA 3RQSA 3FCOA 1S6YA 3D64A 3MJVA 5B4VA 5KNLA 2QW8A 4WASA 5KKAA 4Y6SA 5CDGA 1PZEA 1KVQA 4E21A 3GVCA 2J8ZA 1H6CA 3U4HA 3GGPA 2YFHA 3N74A 4EUEA 2DC1A 1NR1A 3WR5A 4Q39A 4CMJA 2ET6A 1YB4A 3H5AA 4R5MA 3ZH2A 3JYPA 1NFFA 1PWZA 4J49A 2HJRA 4BOYA 1OI7A 3OIDA 3IOYA 3C3XA 2I6TA 4CMIA 3H2SA 4D3DA 4YAEA 4Z0TA 2GZ1A 2J5QA 4GVXA 4A5OA 4IJUA 1HDOA 2VYVD 3NDJA 2P4QA 4BNVA 4PLCA 5L7TA 3H9GA 3VHRA 4NBUA 4MOWA 5HA5A 5TNXA 3K96A 4Q3DA 4CM1A 4OJNA 4BS9A 3Q2KA 4R9SA 4CLXA 5B4UA 2O3TA 4ID9A 2F1KA 3HNPA 3BTOA 3KLPX 1GR0A 4YQZA 1E3EA 3AI3A 4HX5A 5AXAA 3H9JA 3RC9A 3C24A 3K9QO 2WTBA 1ZUD1 3GGOA 3KZVA 1NQOA 4WK6A 3VH4A 4IS2A 1J0XO 2EG9A 1I8TA 3HWRA 3PQFA 1HETA 2YYYA 1KEVA 2PKQO 3W1VA 3W6UA 1YB1A 1GYRA 1H6DA 5IG2A 2IXBA 5ER9A 1LBEA 5B37A 2HLPA 3VTFA 2BI7A 3UCFA 5GZ3A 1KEPA 3IP1A 4CR6A 3UN1A 5ILGA 4LMPA 4YT8A 4EJ0A 4L74A 1U2GA 4FJ1A 3IP3A 4BNZA 2X9NA 1ZK0A 5A04A 2Q2VA 4WLUA 1LSUA 1X0VA 4TRMA 4BNHA 8ADHA 1PSDA 4RLSA 4UVDA 1JKJA 1VRWA 3CSDA 4BO3A 5L40A 3WICA 3MZ0A 4OM8A 4DREA 5K6AA 3LU1A 5T67A 1YVEI 1FDTA 3OJ0A 4LSWA 4KUEA 3NT2A 2HQ1A 4GGOA 3DO5A 3ETDA 5AXBA 3TPCA 1KS9A 4XRRA 3O8QB 3RAJA 1ZK3A 1ULUA 1HDZA 4KWHA 1FJHA 4CMGA 1G0NA 2DTEA 4WCFC 2Q4BA 3PFFA 2I9PA 2X0IA 1BXGA 3AW9A 1AE1A 4GLLA 2UUPA 2FMUA 3KEOA 2EGHA 3NTOA 1E3IA 4Q3CA 5JYEA 3G1TA 2R6JA 1C1XB 1E1NA 1K2WA 5COQA 3VPXA 1OMOA 4GMGA 5FWNA 1PJ4A 4DC1A 3ITDA 1ADGA 3GMSA 3OJEA 3WFJA 2RCYA 1RWBA 4HFRA 4DYVA 4MINA 1MGOA 1HWYA 4QUKA 1JVSA 1BW9B 3ABIA 3FBGA 5A03A 1MLDA 3AOGA 1IPEA 1NASA 1QORA 1X14A 4XQCA 3T4XA 4EYEA 1Q7GA 4I5DA 2HKIA 3WG9A 5C3MA 5HM8A 4EEXA 3T4EA 3TFOA 4FOSA 3PK0A 1UP6A 2XOXA 4XWYA 1KOLA 2B5WA 2EERA 2I65A 3EZYA 1B3BA 4B7XA 1R37A 4DPLA 2XXBA 1KVSA 1Y9AA 1H5QA 3SC4A 1DO8A 3UGKA 2GN8A 1HYEA 1EE9A 1Z45A 4D3SA 1HZJA 2CSUA 5EESA 2PGDA 4MKXA 1CJCA 1M67A 4UVEA 5EINA 4W9NA 1WDLA 3QVSA 2GN6A 1DXYA 2BGKA 2PNFA 2AEFA 1DLJA 1GDHA 2IZ0A 3QWHA 4Q3AA 3JQBC 4RF3A 1GZ4A 1QR6A 3NDIA 1ZXLA 2C5AA 1HYHA 5THQA 5JSFA 4XR4A 1YE3A 2CUKA 2ZK7A 4RF5A 4AJKA 3GGGA 5DOZA 2X58A 4GX0A 5DNAA 3SJ7A 4BO1A 2Y67A 3ZWNA 3VVCA 2P9EA 2ZB8A 2AXQA 4UUOA 4Z0HO 4XA8A 1I24A 2FSVA 5U1PA 5ENDA 3ZU3A 1JAXA 3TSCA 3OMLA 4NG5A 4ZQEA 5IXYA 3PLNA 1U5AA 3GPDG 1U3UA 4FC6A 2FHSA 2WMDA 3FPCA 5JS6A 5COAA 2B5VA 3VTZA 3JQGA 4PZDA 1F14A 3IL2A 3S8MA 5J23A 4J4TA 1U8FO 3H65A 1NXQA 3I3OA 1AXGA 4NFHA 4ZA2A 4CPDA 2NU9A 2C7VA 2CD9A 4ZQGA 4BIIA 1YB5A 4JBIA 3FNGA 4RPHA 5TF4A 4BNIA 2O3SA 3V8BA 4MKZA 2JD0A 1LC3A 4IJVA 4FFPA 1XKQA 4F6CA 1VL6A 3H3JA 3JQ7A 5T57A 5ENVA 5G4KA 4DL9A 4NBTA 3ZWWA 1C1DB 1LX6A 5EERA 5KJ1A 1PU2A 3ZCXA 2AQKA 4DPKA 4R3WA 1L7EA 1XU9A 3LC7O 3EAGA 4RZHA 3QLJA 1MP0A 4GMFA 1C0LA 2C29D 1SEPA 5F1KA 4B4UA 5IZ4A 1HXHA 1FDWA 3FD8A 3WGIA 3RU9A 4I1IA 4NBVA 1P0CA 2B0JA 1D3AA 3FNEA 4AJLA 2YDXA 3K31A 4MIEA 4NJOA 3S2GA 4JROA 1PJ2A 1UZLA 3RWBA 4CLRB 1PS9A 2IZZA 1N8KA 3HFSA 5FEUA 3H9QA 3EMKA 1X7HA 4YACA 2VT3A 2XPCA 5HTOA 3QVXA 1OX3A 3HDYA 4BKUA 3Q9UA 1M2WA 3FRJA 4I9HA 2J3IA 3TQHA 3T7EA 1HE5A 2Y66A 3PZRA 4KMSA 2O2YA 1DBVO 3OSUA 1EBFA 5JC8A 4BNUA 2DVMA 1ZSYA 1P45A 3GPIA 1L1FA 2WM3A 2OFPA 2VOJA 3WBBA 3ZNPA 3U62A 4BNKA 1NPTO 4NK5A 1MB4A 3MJ4A 4XDYA 4DTIA 2AHRA 4YAIA 3SLGA 3KM0A 5JE8A 1PEDA 2I99A 1KC3A 1Y8QA 4HADA 1HDXA 3DWFA 3PQDA 3U4CA 2EIHA 1BG6A 8LDHA 4XGKA 4W9NC 1YOVA 4FW8A 4BNGA 4B79A 3SEFA 2YHUA 3DZJA 5TQVA 4C7KA 4O0LA 3V1YA 4E13A 3V2UA 1LSSA 5DCUA 2C0CA 2JHFA 1PJQA 1KEUA 3H8VA 4PN3A 1XEAA 1YBAA 3AU8A 3GA0A 3RU7A 4RLHA 2HJSA 5DCWA 3NUGA 2C2YA 1G1AA 3C1TA 1IULA 2FPPA 4PLWA 3QVWA 1KERA 1P9LA 4XGIA 1YDEA 3DHYA 1NWHA 1DPGA 3OP4A 3VDRA 2JAPA 1YOVB 1GFSA 1HDCA 3D1LA 1NPYA 5L4NA 4QO7A 1P77A 1YGYA 1U4SA 2IEBA 3NEPX 3JTMA 4EGFA 1RM5A 2HUNA 1JVBA 2IRWA 4E12A 4YAJA 2X8LA 3U49A 4N5NA 4B4WA 2EKPA 2PK3A 3OIGA 1R4NB 2P9CA 1WNTA 3UW3A 1GD1O 1VPDA 1H2BA 2XAAA 3QWBA 1CRWG 1O6ZA 3RUHA 5IFLA 2ZB7A 3JQ8A 3D4OA 3KYDA 3RKRA 1O89A 3EK2A 3WIDA 1AHHA 4URFA 1V0JA 4JK3A 4WECA 1GY8A 2H1SA 4JJFA 1P1RA 4DIOA 1JDJA 2OL4A 1E92A 3TZ6A 1F0YA 4GKVA 4I08A 1LRJA 3LC1O 4ZJUA 3UH1A 3TF5A 4G65A 3PQEA 3QY9A 2JCVA 4R4JA 2FZWA 4L73A 3ZHZA 4NJMA 3JYLA 5EL0A 1GQYA 2EGGA 4JBGA 3NKLA 3SBOA 2BMAA 3E9QA 3CUKA 4CLOA 5CG2A 1E3JA 3D4NA 3KRTA 1ZIDA 2NWQA 1ZMOA 3E1KA 3F4BA 5AQ1A 4JX8A 2DU8A 4GLOA 3EVNA 4CV1A 1P31A 1I3LA 3PDJA 1VI2A 1Y6JA 2Y1EA 5DULA 3DHNA 2CDAA 3U4IA 2B36A 2CVOA 4H15A 1UUFA 1NTOA 2FPIA 1SAYA 3MJEA 1DIAA 2DFVA 2Z1MA 1EVJA 4P4GA 5I7EA 2ZYGA 1UZMA 4YPOA 3L4SO 3GAZA 1TB4A 4FOOA 1RYEA 5IDQA 1XG5A 1YL7A 1NAIA 3ZU2A 4LRTB 3E18A 3ICPA 3JQ6A 3WGZA 1T2AA 3QVOA 4BGUA 1Y8RA 4NFSA 3DBRB 4RPGA 5HRUA 1IPFA 1GZ3A 4U0KA 3AY6A 2HO5A 1LXCA 2B4TO 4CODB 3C1OA 4IDGA 2GASA 2RAFA 3QHAA 3JD0A 4D41A 4F45A 4BKPA 3BXXA 2P91A 1AA0A 4JQCA 1YJ8A 1LNQA 1JLLA 3LF1A 1H2HA 2V65A 1B26A 3GLQA 2PV7A 2HRZA 3JD2A 4GQAA 5JBIA 3N7UA 3JQAD 1QMGA 3TWOA 1PL8A 3PDUA 1A9ZA 4A7PA 4PLHA 1GUZA 5G4LA 1YJQA 1VJTA 3ZWAA 2OUIA 1MX3A 3IJRA 3JQBA 2YUTA 3GN2A 3WX0A 2QRJA 1DAPA 3JQGB 1UR5A 1Y81A 1YL5A 1I3MA 3KYCB 1NQAO 2VOEA 4I5FA 3I1JA 5FI5A 3E9NA 4DMMA 3ZZNA 2ZQZA 1QLJA 3HN7A 4PIVA 3DTTA 2VYNA 4M87A 5TIIA 2GPTA 3QWAA 5CP8A 1ISMA 4UREA 3S2EA 2Y1FA 4DC0A 2VUUA 1XCBA 1K6IA 3BMCB 4O5OA 1EBUA 5JNLA 4P4NA 2DBVO 3IKVA 1A4IA 2HMWA 3IC5A 4YJHA 1MG0A 3PHJA 4BMSA 1TLTA 3JQFC 4ND3A 2DAPA 4P8RA 2OGUA 4CL8A 5IZCA 2GO1A 1XQ1A 3Q9NA 3Q3CA 3WDSA 1F17A 2JL1A 2WD7A 3MOIA 5JW6A 4IPTA 3IIEA 3KYCA 2Q46A 3VPHA 4J7XA 1AGNA 1W4ZA 2YHIA 4XRGA 3QE3A 3H3FA 5I7SA 3DZGA 3NT5A 4DPMA 1U3TA 3IUSA 1PQPA 3M1AA 1T1RA 1PR9A 1F8GA 2C20A 4ALNA 4ESOA 4FD3A 3ZNOA 5TT1A 5MDHA 3ANMA 2G0TA 3C7CB 4IIVA 2VT2A 3W4IA 1E6EA 4J3FA 1LA2A 4AJIA 2Q50A 4D44A 4RZIA 4N54A 3PYLA 4RPKA 1HSZA 4L76A 1WP4A 5A3JA 1PZGA 4RVGA 4WOJA 1B8VA 4GPD1 1BVUA 4CMCA 3GAFA 3BZUA 3K30A 1GTMA 1LLUA 3WJ7A 4ND5A 2YDYA 3DDNA 3ZV5A 3P19A 3ROKA 4MP3A 5F1PA 2WYUA 5BQFA 1ARZA 3ZNNA 3WQQA 5MGBA 1YS4A 1QP8A 4IS3A 1R12A 4U6SA 4B4VA 4ZVVA 2VQ3A 3D4PA 3KXDA 4H7PA 4FFRA 4LISA 4E2WA 3T7CA 1WXDA 4I9UA 2B4QA 3FNHA 3ADOA 3GHYA 1JW9B 2Q45A 3FF4A 1GV0A 1CQJA 4J7UA 1DEHA 2BFPA 4MVJD 3PIIA 3IS3A 4RVUA 4XQEA 4Z3DA 2OHXA 1PJCA 3LSYA 3ZGYA 1K6XA 4GX5A 3JQ9C 1OBFO 2VRCA 3PHGA 2VHZA 4P38A 4YT2A 1EUDA 4EUHA 1PJTA 1VM6A 1DJQA 4J4HA 1K6JA 3PI7A 2I5PO 2E37A 4BO5A 1T4DA 3AM4A 1UDCA 3W4KA 5CDTA 3FR7A 4RVSA 2X9VA 4BO4A 3BMNB 4YRAA 1S7CA 4OO3A 2WEKA 1IHXA 1C0PA 4E30A 4F6LA 2WJPA 3WWYA 1X13A 3JD3A 1E0DA 4RORA 4GGPA 2DPGA 2C2XA 3QWFA 3R3SA 1BRMA 1E7YA 5JDCC 4B7CA 5B4TA 1I30A 3MOGA 2D5CA 3V5NA 1V35A 4CUZA 3IUPA 2G5CA 2QQ5A 3GT0A 3WJAA 1ONOA 2CF6A 3H5RA 2NVUB 4DLBA 4EDFA 3RFVA 4MIYA 2VNAA 3WFIA 2XF8A 4N5MA 4FFLA 4OMUA 1D1TA 3DZBA 1NFRA 3GMDA 1LRLA 3ITKA 4EBFA 2DM6A 3GHHA 3KSDO 5HBRA 1EUZA 2DT5A 2QYTA 3WGHA 1UH5A 4MVJI 4XR9A 3ROPA 2PD3A 3AWDA 1GUFA 4NU5A 4DIFA 1NAYA 2Q1WA 4NHEA 3UKOA 5G0SA 2DQ4A 3K92A 4XIYA 1K0UA 5F3RA 1E7SA 3VOSA 4WNCA 4DQVA 1DFGA 1U5CA 1T2EA 3VH2A 1WMBA 1E7WA 3KO8A 2DBQA 3RSHA 1G0OA 4BMNA 1R16A 1SPXA 1IL0A 4TRRA 3TN7A 3HUDA 2EF1A 4J7CA 3H7AA 4OOEA 3U0BA 1WZEA 1BSVA 2EW8A 4NU6A 5KJ6A 2VCYA 1E6UA 3RROA 5EN4A 2X9GA 3E5MA 4EZBA 1ISGA 1VKOA 3I9LA 3K2BA 4FCCA 4YCAA 2O23A 4ALMA 1YO6A 3GN1A 1FDVA 4TMFA 3STHA 1PQUA 2Q3EA 3PHIA 4PLZA 3JYQA 1JKFA 2CVZA 3I9OA 4PCVA 3UF0A 1Y7TA 2W90A 4ZHSA 3F4LA 5KWEA 1UAGA 3N58A 1XYGA 2PD6A 4CM9D 3CH6A 4ZD6A 4KOAA 4D79A 3I4FA 2JAHA 3AFNA 3G49A 3H2ZA 4CLOB 2GSDA 1CF2O 2P5YA 4BNWA 1HT0A 2FR8A 1GYQA 1LDYA 3FWNA 2X5JO 3IKTA 1RJWA 5COBA 5L45A 5THKA 2IODA 1EFKA 3P5SA 5L9AA 4P22A 1T2FA 1ZSNA 3A9WA 4RDHA 4BO7A 3ON5A 4BVAA 1A27A 5LC1A 3IDSA 4R1UA 4WLOA 5A06A 5I9LA 3OM9A 5CG1A 3B6ZA 3OA0A 2BHLA 4CLRA 3C1AA 3WYEA 4A27A 5C7IO 3NRCA 1IOLA 3HADA 5EJ2A 5JAQA 3ZV4A 2DLDA 2GERA 2WE7A 5JMPA 4BNJA 1GPJA 2HMSA 4TWRA 1GCOA 3I4CA 4J2HA 4YJHB 2UV8A 4R16A 1BDMA 1XELA 3WQRA 2YY7A 1LLQA 3AM5A 3SJUA 3UCEA 3CMCO 2JFFA 4MKRA 3NJ8A 4OXKA 4RVDA 3WWZA 4F3YA 4D45A 1QYDA 3L6EA 4GL4A 1M76A 2H9IA 4PG5A 5FYDA 1PGPA 4IM7A 1DFIA 3BMQB 3MWEB 3NTRA 3K8ZA 1LI4A 4YJGA 1PJBA 1N7GA 1EK5A 4Y8VA 3Q11A 3RFXA 1ZO8A 4PRLA 4LW8A 1HKUA 2P9GA 3WNVA 4CUJA 3UFXA 1A7AA 3CXRA 4Q3NA 1K3TA 2AEMA 3LK7A 4U8GA 1P44A 5ES3A 3GY0A 3V1TC 4CQLB 4ALLA 3TJRA 3WXBA 4DUPA 2IYPA 1W0CA 4J4BA 4J6FA 4A10A 4PG8A 1QRRA 1DC6A 1NVMB 1EDZA 2AMFA 1X7GA 1Q7BA 2EKLA 4KTTE 4NK4A 2H5LA 4LK3A 1KVTA 4UVIA 3VH3A 1CWUA 3OH8A 5A9SB 2W2LA 4XKJA 3RBXA 3KTDA 1HLDA 1PJSA 2AE1A 1WMAA 5G0VA 3GVXA 3JQAA 2J3JA 2OXIA 1UP7A 3Q6IA 4AJOA 4CM9A 4EITA 2VUTA 2OOSA 1C0KA 4WJZA 2GNAA 4L0QA 5ITVA 4YR9A 1Q0QA 2RH4A 3GH3A 5AXDA 2JFGA 2ZYDA 1XIVA 4AG3A 2JD1A 1UZNA 4R3NA 1GQQA 3ETGA 1GEEA 3BMCA 2X23A 2G17A 3DR3A 3GEDA 3GUCA 3G0OA 3A4VA 3JQ9A 3FNFA 1JWBB 2OZPA 5L53A 2EHDA 3S2IA 1DC3A 1H94A 4E6PA 4AJEA 3CE6A 4PLYA 3WMWA 3GZ4A 4JLWA 5EMHA 1D7OA 1Z7BA 4ITUA 2VNSA 3PVZA 1LU9A 2JJYA 3E6AA 4I5GA 2NSDA 4RF2A 3RKUA 1LSOA 1E1MA 2VHVA 4EEZA 1I33A 3JQ8B 1SEVA 3KYDB 5CEFA 2GUGA 3I9JA 2B35A 3BTSA 4RGBA 3JQFA 4MO2A 4WLEA 1Y8QB 4OAQA 3OQ6A 4IDAA 4XYBA 4AFNA 1TI7A 4E5KA 3GZNA 1P1KA 2JHGA 4N5LA 1P1JA 1I32A 3L0DA 3MTGA 4R1SA 2W4QA 3ROQA 2NNLD 4XZ3A 1E7MA 1O8CA 1I0ZA 1WZIA 2CY0A 4BB6A 4ALKA 3GRKA 3FPLA 1ISFA 1DIBA 3OFSA 3CKYA 1KVRA 5IXSA 3B70A 1ADBA 2NTVA 2DKNA 3H4VA 3HHPA 4CR8A 4M54A 5AOVA 3ONFA 4BL5A 4KWIA 2A4KA 3DMTA 1OC2A 3B1KA 4OQZA 1XR3A 1ML3A 3KV3O 1HYGA 4BV8A 2Y68A 4BGEA 1HF3A 5DBFA 4OIMA 4DMLA 5DP2A 4PLFA 1T25A 1O9BA 1DOHA 1Z82A 1Q0HA 5BNFA 1MFZA 4QT0A 4CMIB 4DQUA 3NYWA 2CDBA 3WGTA 3O8QA 2O3JA 3QP9A 3AOEC 5CDUA 4W82A 4JNKA 2UDPA 2Q4EA 3KSZO 5L3ZA 3ULKA 4XIJA 3G3EA 1BXGB 4K28A 1X15A 4CMAA 1SC6A 4Q9NA 1BGVA 1BHSA 4ZQFA 2Q2QA 3O38A 3ZWMA 3OIFA 4WUVA 4D3FA 4LVUA 1NNUA 2BI8A 3TOZA 5JC1A 3OETA 5TJ9A 3DAPA 5IDXA 1DHTA 1E3SA 4FGSA 3KETA 3JCZA 4MVJH 5JLAA 1DIHA 4MVJM 2RHRA 4HNHA 3I9MA 1ISIA 1KBZA 4IXTA 1ENYA 3GRPA 2IE0A 3RUFA 4ILKA 5T8KA 1U28A 3B1JA 3LYLA 4XQGA 5I9NA 3E03A 4LSMA 2GN4A 3FBTA 1T1SA 2BKAA 1SMKA 1TT5B 5CPBA 3L77A 3RJ9A 3AFMA 2HK9A 3C8MA 4M8SA 2O3UA 4LVCA 1LDNA 4CV3A 4TVOA 5ITWA 1QXSA 3QV1A 3WGYA 3OECA 2FP4A 3ZW9A 3ZWYA 4HFMA 2VYND 1QSGA 3K5PA 3AU9A 4AL4A 3AOEA 2E49A 3GF4A 2JCYA 4TKMA 1PL7A 5DOVA 4JIGA 4ND4A 3ASVA 1HE3A 4NIMA 4XYMA 5T5QA 3ZN2A 4MIOA 2X1HA 4R51A 4FDAA 1EQUA 1XA0A 3PZBA 5G0TA 1PS8A 2QIOA 3RJ5A 2UYYA 4JP3A 4CJXA 3CMMA 4UEJA 3DFUA 3MJTA 1B7GO 4IIUA 3ANLA 5IAAA 1EVYA 2I3AA 1W6UA 3KB6A 1A7KA 3G79A 4TVBA 3W4JA 3A1NA 3EVTA 2EEZA 1UXKA 5I8WA 2DUUA 4XB1A 4YDRA 4FJ2A 1V3UA 3DBHB 3D3WA 2AEJA 5CDSA 1SNYA 1FDUA 4BNMA 1VE9A 3KVOA 1WDKA 1GEGA 4KTVE 3SX2A 3OF2A 3AK4A 2O2SA 3IMFA 1DFHA 1RM3A 4Q3BA 4BGVA 3NT4A 3F6YA 3PHHA 1X0XA 2DBZA 3ZDFA 5CDYA 4ZRNA 5GZ6A 5CEJA 4YXFA 2NLOA 2AQIA 1PJ3A 4RF4A 1ZMTA 1MFPA 3PHLA 4YVFA 2IXAA 2Q99A 1U8XX 4XCVA 2FWMX 4IZHA 4CMKA 4HP8A 2HU2A 3Q1LA 4CLEA 5A5FA 1DDOA 1HDGO 2FRDA 1JA9A 3F46A 1LDGA 3ZU4A 4JP2A 1M6HA 4ZQBA 3BMQA 2P4HX 2JCXA 1PZFA 1WWKA 4FBGA 4CM8B 1BXZA 1DJNA 3UOGA 3X2EA 5TGDA 4LCJA 1Y9EA 4UAGA 4NPCA 4CR7A 1BXKA 1I3KA 3RUCA 3BA1A 2POQX 4HUJA 5EQFA 5CEEA 1EE2A 2FY8A 1KEWA 4XGNA 1NFQA 3ROMA 4LCEA 2NM0A 1ID1A 4MP8A 3MEQA 5BSFA 2C82A 1F06A 2ILTA 4M1QA 4MVJA 4U0JA 1LJ8A 3F1KA 1TT7A 2YJZA 3LC2O 4IGEA 4XDZA 5L95A 1N1EA 1NVTA 2QZ9A 1D1SA 1Y8RB 4AJNA 3JYOA 1D4FA 4HFJA 2Q2WA 4OHUA 4NDNE 3OQ1A 4B8ZA 4CM4B 3C7AA 3JQAB 1WW8A 3ZHBA 4IDBA 3MTJA 3D7LA 4IQ0A 5HWSA 2F00A 3BHIA 4RV9A 1V3TA 5A9TA 1I5RA 1LDBA 1WPQA 4IGFA 3TZHA 3OEWA 2R2GA 1R4MA 3GEMA 2B69A 3VPFA 1EZ4A 1PGNA 1GZ6A 2PFGA 1ZH8A 3HSKA 3HE3A 3PJDA 3ENNA 1MA0A 5G4KB 5JAZA 1BMDA 1OZAA 3RI3A 3ZWOA 2C5EA 4PG6A 3LLSA 4CMHA 4PGFA 2YQ4A 1J49A 1PGJA 4AVYA 2VUSA 4JBHA 2EWMA 4GX2A 3GNSA 4NZ9A 2Y0EA 4Y98A 2ZCUA 2BELA 4AJ2A 4BNYA 3LLVA 1NHWA 3QQPA 3O26A 1EMDA 3AUSA 1B15A 1DRVA 1GU7A 3I52A 4LN1A 4BGIA 1LDMA 4DLLA 4AJPA 2Y99A 3D5QA 2X22A 5DBIA 1VSVA 2JKVA 4QFCA 5EQDA 4DQXA 3DMTC 1I01A 2X7HA 3DAFA 2TMDA 4IUYA 4XQ9A 5L4SA 1UXJA 3BTUA 3RCBA 3ZV3A 4NQZA 4YTEA 1CYDA 4E4YA 1VC2A 2IDZA 2X0JA 3JQEA 4WLVA 4CM6A 2ZB4A 4QX6A 1G6KA 4EI2A 3LDHA 1PIWA 1E7QA 4C4OA 3DOCA 1U3VA 3GVPA 4P4LA 5T64A 4R41A 3AUAA 1QG6A 3O9ZA 2NU8A 5A4DA 2DTDA 4J9UE 4X54A 1ZXBA 3CTMA 1ONNA 1MC4A 1HZZA 5DCYA 2Q49A 4OKIA 1ZFNA 3M2TA 1X1EA 4K1LA 4UUMA 5F5NA 3DQPA 3RC2A 1ADFA 2BGMA 3GR6A 2O48X 1B3RA 3DHEA 3GC6A 4RQTA 2W2KB 4PG7A 3BMNA 5L51A 2H6EA 3LT2A 1QLHA 2Y1CA 1X7DA 3GG9A 3NAQA 4Y67A 3WYCA 4JJGA 4K9DA 4HXYA 5G0UA 1CIVA 4KP7A 5JY1A 2NU6A 4W7IA 2V6GA 3HDHA 3LVFO 3FN4A 5F5LA 1YL6A 3UXYA 1GAEO 3I6QA
chains in the Genus database with same CATH superfamily
4PLPA 2JZCA 1X77A 4WBNF 2AZXA 2YXQB 3UYLA 1JEKA 2W6JD 4X94A 2WIAA 3HR7A 2PUHA 4EENA 1JU9A 3OZ7A 5M04A 2Z4EA 3N7AA 2PKXA 3G02A 1EI9A 1S0UA 5FO0A 4ASWA 1E9EA 1A4UA 1R2QA 2DFTA 5B5SA 2PIDA 2YQ5A 1QFYA 1NUPA 4EJSB 1RRFA 3I5YA 1GPDG 3CJRA 3FUWA 5IXJA 1KPHA 3E1SA 4FS8A 3E53A 1THTA 1UBEA 3C0KA 3LBNA 3ANYB 4P7FA 1RI2A 2LWIA 3I28A 1QVFO 4UULA 1MQSA 5EHNA 2BM1A 1V2HE 4BJ3A 2IGTA 3FPAA 4GYKA 1NVFA 3F2VA 4TTJA 2P69A 1A76A 1L8LA 3QXJA 5F1YA 3RVKA 3WISA 2WSCJ 2HJ9A 2OCYC 3L6OO 1XLTC 5C0OE 2PD4A 3LX6A 3FHLA 3RRBA 2Y05A 4M1EA 5JCJD 1NG1A 2WV9A 4ZU3A 1ISSA 3LVBA 5I9TA 4GPZA 3EIWA 3KSUA 5JD3A 3RVQA 5U9CA 3ZGVA 1F8UA 1KSJA 1R4ZA 2YYAA 4NEHB 1E5QA 4V02A 4FM9A 3VOBA 3V6IA 1DARA 1I6KA 1NN3A 1OI4A 2X3UA 4EELA 4DWVA 2R1UA 2CBGA 4YAOA 4BVEA 2YBEA 1XHFA 4KPGA 3WLEA 4RHUA 1YRWA 4B31A 1SJ9A 4N7MA 5IJ0A 4AY4A 2OPHA 4L8FA 4LXIA 5A5EA 5JD5A 4B0OA 5DXJA 4JXKA 2ZANA 1YQTA 4I14A 1GG8A 2VBCA 1V8ZA 3PH0A 2E6UX 2OP1A 5K3FB 1UJ2A 2O5RA 2QLBA 2VDLB 4LJ4A 5AW4A 5HM6A 4N48A 5C8DA 5IPFA 1JLKA 1NAHA 1ZICA 2W2NA 4YRSA 1K6EA 2INGX 3CH4B 2R96A 3LZDA 4DJ5X 5HE8A 1AU9A 4YJDA 1NTMD 3P52A 1DB3A 1WU7A 3E23A 1L8AA 2HQSA 3GNQA 2G25A 3BE5A 2DUJA 4O2AF 2PTHA 1KYZA 2ZR8A 1ACMA 4JJ7A 3VXKA 1POWA 3DP7A 2ISSD 2PLWA 2A7QA 1MOQA 4J9VA 4CMEA 1U0RA 4RTKA 2RJ3A 2BUBA 5FI1B 2WNSA 4GDOA 2VR1A 1N8RQ 2PGOA 3LUGA 1W5TA 3C3JA 1J99A 2HFKA 2GQ0A 3Q5DA 3GFSA 2G3AA 4RE6A 5CM9C 3AUJB 4IFTA 4J0JA 3CCUP 4PJ0H 1C2TA 1Z07A 4KQGA 4XARA 1E2MA 3JD4A 1QGUB 3VZBA 1ZJ4A 2NT3A 4XAQA 4YRRA 1PFWA 1SVIA 1YR1A 1D7AA 3HLTA 3KOZA 1P9RA 3MMXA 4QDXA 5BWOA 3WK5A 3CLUD 3D3EA 1LTTC 5KSZA 1PJAA 4ZGWA 2NO6A 5K0ZA 1PKXA 1KKLA 1QIEA 1OIVA 5ESXA 5HTKA 5B64A 3BJEA 3W5UA 3W3AD 3CN7A 4A2QA 2E18A 1Q1BA 4WKGA 3NVAA 1OFUA 5KOJB 5F2KA 1NZFA 2V7TA 6NULA 3HSSA 3QLVA 4HOYA 1E32A 2Q3LA 2EQAA 1HQCA 2WFLA 3GFOA 3DBRA 1PFGA 3X2FA 2P67A 2C4MA 4GU5A 3SF0A 4AT1A 4GWKA 4IX1A 3RU3A 1DC5A 1OX6A 4N6JA 1IB0A 3L4BA 4CM8A 1DIGA 3HO8A 3VH4A 2OAGA 3OPYB 3VNVA 1DAFA 3BRWD 5TGZA 1L4HA 1L7QA 5DISB 3DBLB 1ZHOA 3DEKA 2GEDA 3HUTA 1LNZA 3K2EA 4YP6A 4JI4B 1T6ZA 5FI3A 1DMRA 1RACA 2EZ4A 1U3CA 5ADUS 2RJNA 1MT3A 1T4GA 4R1TA 4W5WA 4ARBA 2YRWA 3U2QA 2DR0A 2WTXA 3U09A 4CL0A 3ONNA 4EK9A 5JYBA 3V2IA 3O7WA 2IHTA 2M3BA 2XD4A 2YVKA 4O2BF 2Z09A 4TTRA 4WN9A 5D7BA 2GZDA 2RH9B 2PVCA 3HDQA 3R9XB 1OZFA 1Y3FE 1KK3A 3E22A 3E8XA 4D5GA 4UM7A 5KOJA 4ZOLF 1OU0A 4NARA 1YRLA 3JSXA 1SOWA 2E4VA 2HDHA 2TMKA 2VT6A 4CV0A 3NIWA 3QFRA 2R00C 4MUHA 3OQVA 3D3WB 3PVSA 2WZCA 1YR6A 3DVAB 4EGAA 1ODJA 4WOKA 1Z8NA 2D1FA 2G1JA 5KCMA 3BYZA 2KQUA 2WDZA 4ZICA 3CBGA 4G24A 4HV4A 3UT5A 1IU9A 2IYEA 5FL3A 1SVFA 2IIVA 3N2IA 3PR1A 1BFDA 4HDRA 2C00A 1Q21A 2PNJA 2OTLP 3D1JA 3LRXA 3O2QB 4J1TC 5KC9A 2B34A 2W2QA 2WJHA 3MG9A 4ZCIA 4X66B 3F7OA 3PTAA 4OQMA 1U2DA 1J6UA 2O3RA 3K5WA 3VPDA 2NZWA 2ZI6A 3G17A 3ZDDA 5KYTA 4QQKA 3G9UA 1LH0A 4E33A 4YT5A 5C8XA 3Q2YA 4BQRA 3JVVA 2DY1A 2W5UA 3IV6A 1IM5A 1ZZEA 5B3LA 2I3DA 3PWZA 3F47A 1GZUA 1C9MA 2LR0A 4RYDA 3TZQA 3MLAA 2GD0A 3OT5A 1M0WA 4RLFA 1BFUA 2EJWA 2WUFA 3ZV6A 5CNMA 1CQIA 2MJLA 1PFUA 1UIXA 2WYVA 3P9YA 2CKDA 1GUBA 1NPDA 1WQ4A 2I87A 5A9SA 3AJDA 4YAKA 4WZ6A 1YS6A 2NV2B 5FTJA 3CX6A 3STUA 2Q3DA 3GFQA 5ALTA 4R2LA 3DULA 4W8OA 1Y98A 3EMDA 2JLCA 4DV0B 3GLKA 1ECCA 1ZITA 2DOKA 2ZB3A 4UCQA 5C8VA 1H5UA 1F6DA 4JVSB 2DWPA 2ID8A 3HHEA 1SCUB 5JXWA 4OF4A 2HGSA 4EW6A 2IC5A 3IV9A 4O1MA 3RS3A 2PSEA 2NP7A 1T8WA 3TSAA 1N3LA 2ZIAA 3DC2A 4U7WA 1C7FA 3T5TA 5HFJA 3EZLA 4RFVA 1PHPA 1FPQA 4WV3A 3SEAA 3T1HB 1JP7A 3PU6A 4RCZA 1ORTA 1XRSB 3DE7X 5HUJA 1ND6A 1RI4A 1DUSA 3E3OA 5JVDA 1RD4A 4AYCA 1YKGA 1IHUA 2W70A 1SM4A 4FCTA 3TL6A 5AVXA 4OK5A 4PFJA 3TVDA 3UHAA 1GYPA 5AYVA 3C3DA 5ICCA 1JAYA 3KWFA 3MWFA 3IJPA 3WTBA 1G3UA 4D9KA 3W9UA 4E31A 1N2ZA 1Z73A 1J0DA 1PEKE 1QFXA 3DUWA 4NF2A 1V1MA 1PP9E 5E7QA 3UENA 3B9QA 3ES9A 3DCYA 4I1OA 2OGTA 3M49A 3VGJA 4EPVA 2XX3A 3VHQA 3KLMX 1EG7A 1BZYA 3H25A 1GU5A 1LBSA 1TTHA 2JIDA 1SCUA 2GB4A 1CSBA 2PGNA 3C70A 3H83A 4JUFA 1LEHA 1U6KA 4QUBA 4B7AA 2GDJA 3TVTA 5J2UA 3EPHA 3U1TA 3OPQA 4QDZA 4DDKA 3FX2A 4C7XA 1QE3A 1YXMA 3OOYA 2QJYB 1FBTA 3L4JA 3A70A 3Q9LA 2ZT9C 3HWX1 3QUSA 2Y6UA 4WE3A 4IW3B 3D54D 1VG0B 2FN7A 4M21A 3EUWA 3GW8A 3T9FA 1J1IA 3WYNA 4U6NA 4D80A 3MPOA 3TMKA 1E0SA 1N6RA 3PWSA 1ZKMA 4U6QA 4R01A 4AY6A 3IBCA 3V42A 1I6LA 1HDRA 1CR2A 1N92A 4HNGA 4IL6E 3GAMA 1BS2A 4PV7A 2BKUA 2MSKA 3TKLA 3LCCA 3RFFA 3IF4A 3TR0A 3UHPA 4A0GA 3TUJC 4X7MA 1R4NA 4NU8X 4LF6B 2KSQA 1SQ0A 1RQVA 4YJKA 4AZ0A 4Z7JA 4KQHA 1ZM2A 3AYZB 1NY6A 2JZNA 2FBWC 3R74A 1WR8A 4G1FA 4DT1A 4OKNA 4KI0A 1GL2B 2H3EA 3MERA 1LTKA 3MS7A 4PLVA 3K2IA 2W98A 2OXFA 2XWBF 1K0FA 3OTQA 3SVTA 5B1HA 4LPKA 4YFYA 4YWHA 3RWMB 2R6AA 4RVCA 2HLOA 2FE1A 4KXLA 3V6LA 1BTOA 1ODLA 1UXOA 3RFTA 1X2BA 1NATA 2RHCA 3WIVA 1DJPA 2P75A 1A4XA 2FYUD 1JNXX 1K7FB 3EC1A 4JODA 3NCHA 4GPAA 3WU2H 3A6LA 4HAOA 1AMUA 2FZVA 4PWZA 4TV9A 4KPEC 2Q5LA 4RAOA 2VRWA 3SD7A 4JITA 4EHLA 2VN8A 2YFQA 1JKIA 2BD0A 5E1OA 5HOEA 3IPCA 5AESA 3CCEP 3QOWA 4UBIA 1FTGA 1CZUA 3NBQA 3T35A 5F33A 1XVUA 1RQNA 3EVEA 2HSZA 4WLNA 1UJBA 1GL2A 1UFRA 3A6GA 4OB6A 1M66A 1AVYA 5EMLA 1UBHS 1EZVG 1NDQA 2EP7A 1IE3A 2PM8A 2QL9A 3JWHA 4UXHA 1H23A 2Z4SA 3VYTB 2J0SA 3LCMA 4PYNA 1OXXK 2NVUA 3AC0A 1R00A 3G1WA 4FUTA 1P33A 2Y1OA 1P3JA 1RM4A 1DAKA 2QRPA 3Q0IA 3EXIA 4H3VA 1CZHA 3G8BA 4UU1A 1XLTA 1Q0RA 2C84A 3BHJA 3MB8A 3EVCA 5AMXA 5EXXA 5IAEA 1TT5A 1NXWA 3V8VA 5IW8A 4F9EA 1EZVI 4BQSA 4EG3A 4QLBA 2JDIA 4K2HA 1SVOA 4YWJA 1P3DA 4MN4C 4A8JB 1L5LA 2A45I 3KDSE 4IGIA 1TMYA 1N78A 1I36A 3IPLA 1Z4JA 4PHFA 4KSCA 3HK2A 2MSLA 1LLDA 1V5EA 5FHQA 5A4MS 3D6JA 1N4DA 1VB3A 3T1VA 2D13A 2COEA 5G1PA 5JO0A 1BJRE 2CMGA 4A6PA 4URZR 4XVHA 3CT4A 2K9JB 4XB2A 1BCCG 2EIXA 3M2PA 4NBWA 4C88A 1MF7A 1B1AA 4LDRA 1A8QA 1Q81Q 2AUTA 3ZR4B 1Q90D 2CVQA 3CMEP 3F73A 3N2NA 3PB3A 4JC5A 1ENOA 2RHBA 3AM3A 3F6PA 2DXIA 4TZ6A 2IDJA 1ZNWA 4HZGA 4MQMA 5AKJA 5EHIA 2B25A 2W6ZA 4C7NB 5D1NA 4BNTA 2PZAA 5HK9A 1ODIA 4L5BA 3L8ZA 5I7FA 1KJZA 1LUAA 2FG7C 2JCSA 3AF1A 2IUSA 2IOFK 2OXTA 3ZVLA 5CBPA 4RTRA 4J3NA 2AA3A 4J8PA 3IR7A 3G8AA 3T7KA 4WNIA 4RZ2A 4UUQA 2C04A 2FSPA 1C1DA 1M2OB 2OBYA 2WWHA 2Z1DA 3DR5A 4N4AA 4QU5A 3OEYA 1U0JA 1ZJWA 1DD3A 2O4UX 1RHZB 5KAFE 3FW1A 1I10A 1NW6A 2O2JA 4JEIA 2HXGA 2SICE 4OSOA 4UEKA 4JI7B 5ARDA 1BGYJ 2PX3A 5D3QA 3DBHA 4S12A 2RI1A 3FR8A 1XK7A 3I6BA 3E9RA 4IDPA 1UIIA 3EVFA 1U31A 4Y2TA 5TR9A 1CLEA 1B8PA 1KQ3A 4ZIRA 2Q5FA 3OU6A 5FH9A 4DA9A 1HO3A 5HR5A 2XUZA 3IOEA 1DXOA 4GKJB 1E3WB 2HBRA 3O95A 4HWRA 5KQPA 3ABZA 4UJ3A 5B6JA 3C7DB 3RE1A 2X8JA 2ECFA 1NC1A 1BN6A 1VMIA 2C9OA 2PR2A 3AVPA 3FDZA 3KEGA 3ZU6A 1NI5A 4EHBA 3VKGA 1LRKA 3TRIA 2C9BA 4B4OA 2B98A 4D9NA 3G0DA 2GRJA 4M7OA 1NTRA 2FZEA 1RPAA 1WB6A 1EYZA 3ICCA 4A5SA 2XMCA 3COJA 3U1VA 1JY2P 3UUWA 1Q7CA 3RBVA 3WGQA 4NCBA 5K51A 2WAAA 5KREA 5G2OA 2YWCA 1AG9A 1S9KD 3ENZA 2NOGA 2BMEA 4N49A 1KAGA 2RGBA 4FR5A 1USGA 2NUTB 3WV5A 1PNTA 4V0MA 5KPJA 1OB5A 4MWOA 1E3WA 1I4TD 1SUAA 1PNVA 4XSHA 1L7DA 4PN7A 1C30A 3L7DA 1PLJA 4KW7A 1CY0A 4XD2A 5LCXA 1UWKA 2XJ9A 1S2OA 1T4MA 3QVMA 5TQJA 6ADHA 1RZRA 3TEFA 3GFTA 3X44A 4GSKA 3IXMA 3OLCX 2A5LA 1CUGA 1JLLB 1CY6A 2CJWB 4H7FA 1B42A 1H4VB 2HR3A 1BWQA 2PLFA 4JA0A 4ND1A 4UAJA 2PWBA 3TK1A 1JDTA 1X9HA 1YQQA 2QNRA 5BN3B 1I7PA 2BEUA 5FOQA 3CLUC 4URHA 1AX9A 1P7YA 2BJWA 4PYKA 3AO0B 2WYWA 3N75A 3U60B 1L8QA 2G5GX 2PH7A 4LQDA 3P9KA 2NYVA 1NX6A 4D46A 3PE3A 4KE8A 1U7ZA 3H97A 3VR5D 3V4SA 2ZT8A 1VYUA 3WYGA 3EOAI 1U1CA 2ZE6A 3CZRA 1WOYA 3OICA 3KFLA 1CT9A 5F4BA 3OCUA 4AP9A 5LVAA 4FN5A 5JPCA 3M3PA 5TPZA 2ZPAA 4BJ1A 1O8BA 4I6GA 4D6XA 4PFSA 4H7DA 2ZLBA 2BTQA 3OE7D 4OVNF 3FTCA 2ZBPA 5F21A 3CGWA 3VI3B 5DNWA 1FYDA 3ORHA 2PDAA 4FYYA 2Z9DA 1U4OA 4KDFA 4I9FA 1KDYA 5BUQA 2IOYA 2VHCA 1W581 4BNNA 4G37A 4RBNA 1W1IA 2BLNA 2H2WA 3TAXA 3PGXA 3BWBA 3V2RA 2WF6A 4PNPA 5HYVA 3LWZA 2ZUSA 1BCCJ 4ZVLA 5CB6A 2RDMA 1YZUA 4A4DA 2SPZA 3R0QA 3KXLA 1S5LH 3LWNA 4H17A 4L8VA 1C7QA 4CIVA 3X2SA 1V8BA 3QFHA 4BAGA 3AHEA 1A9QA 2GD1O 4C0BA 4ENVA 5LN1A 4C7OA 1E77A 1AKNA 1J23A 1KY4A 1A8UA 1IXZA 5IWCA 3KOMA 3NU1A 4BRZA 1T29A 3ZDRA 4TS9A 3RAGA 1NYHA 2XZOA 1X1QA 2W8BB 6GPBA 4DIUA 5DJTB 2VP4A 2VP0A 2EX4A 2EW2A 4E5NA 1T8ZA 5I4BA 4LECA 2GJ4A 2JFYA 1Y9BA 2NO0A 5TVGA 3CI9A 3U48A 4E6EA 1JI3A 4O2BA 4CM7A 1AQ5A 1DDIA 3D6VA 4W80A 4HWKA 1CTQA 2VAMA 4TQAA 3H6GA 1B16A 3BB3A 4OGQD 4GIBA 1Q5PA 1L7RA 1I1OA 4HAWA 2KK7A 3EF0A 1NE7A 2ZU6A 3MCAA 3N0VA 1MC5A 4OXNA 4BEBA 1E64A 4ND2A 1UODA 3GNTA 4W5NA 1V39A 1PI3A 5C3UA 3CWBG 3FETA 4IDFA 1F6BA 4ZRMA 4A6XA 2CVHA 1Q1EA 2EOAA 1C3EA 2Q5UA 1I7LA 3AB7A 3DL2A 2JKYA 1A69A 3UH0A 1M34A 4D6TG 2YV1A 2QT0A 3GUYA 2C5HA 2E4AA 2KBEA 1YVRA 3KJEA 2EKQA 3AJAA 4S2EA 4HQ0A 2C9YA 4WXEA 3QMWA 1II8B 1XTVA 3X1WA 4OOFA 1RQXA 1K9SA 2K2QB 3KQMA 3U26A 1CJBA 1G2OA 1T9DA 2IYAA 4LG1A 1IDOA 2FN4A 2WK1A 5LYYA 1BOFA 4IFIA 3Q15C 4BASA 3DO8A 4OHMA 4ARIA 3PXBA 2IWRA 5FOUA 1FCJA 1ZK2A 4QYXA 2W2VA 1Y89A 3ZVMA 3EPPA 1BE3E 1G8JA 1Q0TA 5I9SA 1IJBA 4M38A 4ER5A 1GLNA 3KG2A 4UTNA 4KEAA 3AEXA 1T3GA 4E4RA 1PIXA 3H1BA 3I45A 1LNSA 1EDJA 3RASA 4MR8B 1E18A 2F62A 3W04A 1M3SA 5AW1A 5JAMA 3M1IA 1PJ8A 3TGLA 1XWWA 1S8AA 2O8DA 1WUIS 1C1HA 2O0JA 3G7SA 3R3HA 1AHNA 3EODA 4OSPA 4X85A 5K4AA 3CVOA 5I7UA 3OCYA 4YB8A 4AKEA 4DNFA 5I9IA 1BVRA 1U8AA 5DN9A 2DPYA 4H13C 1J9GA 1NYQA 1QCDA 5JBQA 1N2SA 4GF5A 2C03A 2WIFA 3M1YA 4EFMA 1NQ5A 4LY9A 4HQRA 1Z7GA 4H1VA 4RJKA 4EF4A 3KPUA 1RQRA 1SUIA 3FF1A 4MICA 3L74G 4PZAA 3JRNA 2QT1A 4AS3A 3V7YA 2VLIA 2V5VA 1ZU4A 3SWFA 1XHEA 3H2IA 1U2RA 4DXHA 4YRZA 4QG3A 3QLEA 2FB9A 1NLYA 2FZ4A 1JG6A 1P18A 2BRUA 2JJLA 4IRUB 4G85A 2D06A 3VC1A 1JLRA 3JQRA 1MQ9A 4I1UA 3BGDA 4AUEA 4B3XA 3MJRA 2P1ZA 2J3DA 1MPXA 4G89A 1KJQA 4ARSA 4DRYA 1YWGO 2JI9A 3G8YA 5BOSB 1NQTA 1T5OA 5CBNA 1YHQP 1I2DA 1RM0A 1MW9X 2CNWA 3K9HA 4XEHA 5EZ6B 1NYLA 1XPOA 4K46A 3IKJA 3AB3A 3KELA 1VF5D 3RSGA 5TISE 2YOFA 221PA 3WGVA 4Q3EA 5MFPA 2P0YA 1P1HA 1CU1A 1R6VA 2D62A 2ODWA 3BXOA 2X6TA 5CNIA 1RIIA 4BTVA 1NKTA 1VP3A 4DC9A 1PGQA 2NPSD 1VLLA 3VNAA 1KMHA 4PS1A 1Z68A 4UDXX 3HKEA 1VQMP 2PRSA 1EIZA 2O52A 3MINA 3TH5A 1QQBA 1MQAA 4KFCA 1RAIA 1W6RA 2HU5A 1QFSA 4FONA 1WHSB 2AKYA 2Q1SA 3LA8A 3T95A 3ZIAD 1Z0KA 3H1FA 4BLSA 4NCIA 1OQAA 1QHGA 1N6HA 1TM4E 4ACAA 3SMVA 3IAS6 1GCUA 1YDHA 4W1SA 5F78A 4D9BA 5J2UF 3BORA 3FYTA 1Z62A 3DEHA 3DUFA 3G0GA 2AEEA 3B36A 4J16A 4MQBA 4HH0A 1QWOA 3FGOA 3RT7A 3TFWA 1MBZA 5J4KA 3S8EA 4C4XA 1I6MA 4WY5A 5M3BA 2PRJA 1WCWA 5LDHA 1GARA 1LPPA 4Q4AB 1HNNA 1AXRA 2ETVA 2VNIA 4MQLA 4PYMA 1WB4A 3KB1A 3TL3A 4FQ5A 3U1CA 2CCKA 4YQEA 2AXTE 3AG6A 3RUIA 5JJKA 3SQMA 3N6RA 4DN6A 1OWAA 1WIWA 3HP1A 2OBMA 5B1YA 5C52B 3EIOA 2FP4B 3BICA 4MQ6A 2IOFA 3U19A 1ZK1A 1T9AA 3PQ8A 3D6ZA 5H5JA 3ZWPA 2ORVA 5JXHA 4JMLA 3T38A 3HKEB 1EZZA 2WB4A 4GDFA 1KVUA 1UMBA 4MV0A 1BCRB 2JK1A 2OWEA 4FFOA 4CKEB 3NHMA 1S8NA 4TROA 3QWIA 4Z9BA 5DJ5A 3LGAA 2C7GA 1QP7A 1SQXJ 5JDIA 4Q7KA 1GGJA 4NFYA 5FORA 2CL7X 5DW0A 2QJFA 5FQNA 2Q8QA 3KKQA 1C7ZA 1Q3KA 2NVBA 1QQAA 4RWEA 3VPSA 3QA3E 4MMZB 3S1SA 3ZK8A 1X8XA 2AUMA 2WZBA 1JTFA 1ECPA 2NPIA 3A2AA 1TMOA 2KLHA 1ORRA 4L6AA 5LMZA 1NRXA 2ENWA 4A8PA 3R77A 2SCUA 1T26A 5I7VA 3W0LB 2FWNA 2Q5CA 3R0VA 1A2KC 1J7KA 2CSXA 1OPXA 2D0DA 4GH5A 2O0KA 2GGSA 3H1LD 2EBUA 1GTL1 3EXFA 4UPDA 2E5TA 3DMFA 4JYMA 1OVUA 4QUGA 5EIAA 3W5JA 2QS9A 4D81A 2HAEA 4MR7A 4NCNA 1OLOA 3B1VA 3DOUA 1AZSC 5K0GA 3ACDA 1VIVA 3RL0B 2AFHB 1J24A 3RC7A 1NXSA 4FOPA 3ZC3A 3FOBA 2IXGA 4X61A 3RV3A 2AFIB 3G59A 1YMQA 4N8EA 4A0QA 4BEJA 2NADA 1FYWA 1VIMA 3KHKA 4GYYA 4QUDA 3HJRA 5DEIA 2J5KA 3H6KA 4MMXB 2GKOA 4B3IA 4Q66C 4WAUA 4XFDA 1L0NG 4R54A 4CM5A 2F3TA 1EP3B 2AG5A 4CQMB 1TNDA 1G21B 1P4JA 3W68A 3B7PA 5FULA 3WGOA 2L17A 2R0QC 5DHQA 1ODTC 3A2KA 1NGSA 2FSUA 3ND7A 2ECPA 2AG1A 1WPGA 1UZAA 3V8QA 4RO0A 4BX2A 3JR7A 1SZCA 5KQSA 3B2EA 2C2KA 1KZHA 3KLOA 2XNDD 2WSSD 1FDOA 3I9NA 3OEEA 1U0LA 4TTQA 5EKTA 1EP9A 1Q2NA 2BF7A 1PWXA 1R74A 4KDEA 1M1KQ 1Z83A 2O50A 4MVJF 3SKVA 4TSKA 3H1IE 3LX8A 1E1KA 3IMEA 4ZEMA 2C2OA 1K1EA 1QJCA 1YU6A 3ZW8A 1NQXA 3P2YA 5C1OA 4Q7JB 1LTJC 3ZLUA 4D2IA 1FRNA 1TLLA 4G25A 5AKIA 1GTVA 2WWYA 1JL3A 3C3EA 3PFWO 1EVZA 2R7NA 2RH5A 3JV7A 2BMWA 2P79A 2Z58A 4GRDA 2GZAA 4M0PA 4Q4HB 4MUKA 1E5DA 1QH1B 1GXSB 4C2BA 2IZ7A 1D7MA 3MUDA 3KQLA 5KUTA 4GP9A 3VU1A 2IY8A 2VUHB 2GA8A 3LT0A 4I55A 5AI9A 2VCHA 1XCGB 2NW6A 3QBTA 4N0QA 1OR8A 4QBGB 4Z3KA 3I5CA 1XDWA 3HJHA 1JBEA 3IQIX 5JAUA 1LTAC 4PIMA 2VRNA 3LG2A 3ZU5A 3TW0A 2QUKA 3IAM6 3ZI4A 5MN6A 4RMHA 4H0LD 2UYGA 1L0NE 3Q9SA 2P2YA 1U9YA 4FOTA 4ZQHA 3EWKA 3RK3B 3C3MA 3LS2A 3C85A 4QJBA 4TTSA 1LGHB 3CZ9A 4P54A 2ZQYA 3KHUA 1NYRA 4B3FX 4U9HS 3P0EA 3P2OA 3PC6A 5KTKA 1SQFA 2BFFA 4YRDA 3CCCA 4OH7A 1FNBA 4ISCA 3VSBA 2VEOA 1SKQA 4YXWD 1KY5A 4NCJA 1JHYA 4V1CA 5T6MA 4Y99B 2CHVA 3SAJA 1XRPA 1N8NA 5JCJA 2H5JA 4RL6A 3PJRA 5LZ5A 3H86A 1KU6A 4BNFA 1KEEA 1JUDA 3MN1A 4PHGA 3T6KA 1GXSA 4US0R 5IABA 1TZ2A 4F9FA 3L8YA 2E1RA 3K16A 5KNBH 1N1MA 2ZIZA 5JCOC 3CXHE 2KZIA 2GK3A 1U7HA 1CUUA 1RMQA 4EPXA 2LDBA 4F3TA 4W5RA 1Z0SA 3KK0A 3DMHA 4UM9B 3QTLA 1HEUA 5DDIP 1Z2PX 5FL7A 4LGVA 2QAGC 1S6YA 1TF5A 3LUCA 5B4VA 4X62B 1H8HA 2VDUE 1NVWQ 1KFNA 2XVXA 2YV4A 1GNPA 3U4HA 3GVCA 2GESA 3OQOA 4CU5A 2YFHA 4JJ4A 3N74A 4CHTA 4Z7OB 2ID7A 2PKWA 5E4FA 2X0EA 3RVSA 1YB4A 1XNRB 3LBFA 5CA0B 2E76D 3IELA 3ZH2A 3BF7A 3MRVA 1IFPA 4BOYA 3OIDA 5ITZA 3MT8A 2X2PA 3C3XA 3IOYA 4EA9A 1P2VA 5MGNA 5KTTA 2QDKA 4D3DA 4YAEA 5T4FA 3KV1A 3U7QA 3USZA 3S2SA 1KIMA 2JAUA 4IJUA 3U6KA 1QO9A 1HDOA 2YZ2A 2Q4TA 5EQTA 2JHPA 5ALZA 3KEFA 2P4QA 5D6NA 4BNVA 2YJ5A 1B0ZA 3TSWA 4NBUA 2XECA 2R87A 3F7TA 4HGYA 4LBVA 3EQ6A 3U13A 1FL9A 1ZGJA 1ZIPA 3C4QA 3LPNA 5AKLA 4NYIR 4LC9A 4OJNA 3IVXA 4BS9A 1TJNA 2PVSA 1FB5A 5B4UA 4ID9A 4MLDA 1TZKA 1E0JA 3ZQUA 3HNPA 3AEGC 3ZWQA 3GELA 2JBAA 1AUQA 3DYIA 4HX5A 4PS0A 5AXAA 3SS9X 4RD2A 1IBCA 2FPPB 1GDDA 2YRXA 5GPBA 1EZ1A 2EBWA 4Z99A 4OPMA 3KQYA 3GGOA 4KLRA 4M7PA 2P8JA 3WL6A 2XRMA 4G0MA 4IS2A 4JSRA 2C5LA 1A1VA 4YP1A 1I8TA 1XZCA 2NZUG 2YYYA 5C5CA 3C87A 1KSFX 1H6DA 5CH8A 3BF8A 2HODA 2AT1A 2HLPA 2F43A 2HQRA 2N3ZA 4E1VA 2F59A 3IP1A 1SK9A 3UN1A 2ZYWX 2GILA 3FCSB 4V0KA 4DANA 4DJAA 4ER3A 4YT8A 4X0EA 2QIPA 4L74A 2WWVD 1U2GA 3EZGA 4BNZA 5AVTA 2DPMA 1RRPA 2J9ZB 4DSOA 2X9NA 1ZINA 5A04A 1O97D 2Q2VA 3M6VA 5AM1A 1IAQA 1ZX1A 4UUAA 6Q21A 1W48A 3MT9A 2RGDA 3R4YA 2WTNA 3OAAA 3RH0A 1WPXA 1LZKA 3L7CA 1NOHA 4TRMA 5LIPA 2ROQA 4RLSA 1SCAA 3I5UA 4YRMA 1JKJA 1ECGA 2WPQA 4HKZH 3L3BA 4C3VA 3P2IA 5FWXB 1CXZA 3DHWC 4D9EA 2FZLA 3FGZA 3PDHA 1OWPA 4HPXB 1FW6A 4OM8A 1CUIA 1QGED 4JENA 1CZQA 1HH0A 1G5FA 5T67A 3LQQA 4ZK6A 4PD4E 4KVGA 4KUEA 1GJRA 2C3PA 4LSWA 1UBKS 3NT2A 1VE5A 2HQ1A 4ZARA 1PG0A 1D03A 1NUUA 1QCYA 1Y7HA 3EHDA 4RHFA 3TPCA 4EKGA 2AFRA 4TTAA 1ZUNB 5M5BA 1TVKA 4KWHA 1VSTA 1G0NA 4WCFC 4ZANA 5CW1A 4CMGA 4TYMA 3QELA 2X0IA 3ICQB 3TRFA 5KDLA 4Q19A 3IAFA 4Q9LA 4GVPA 1S96A 4QVIA 3Q5RA 1CDZA 4XUCA 2UUPA 3KEOA 2EGHA 1XMVA 4NE7A 1VLHA 3OZGA 5JYEA 1QRDA 1R3UA 1E1NA 1LCIA 4R1QA 2C3OA 1OMOA 2AX4A 3OT1A 2X8WA 4GMGA 3PUJA 5L6LB 4JC8A 3GMSA 5HILA 4BZZA 3WAKA 4YH1A 1XLVA 2EJUA 1MORA 1MGOA 4QUKA 1F2VA 1JVSA 1BW9B 1E2HA 1OLXB 2AFIE 3ZCUA 1J33A 5A03A 1Z5OA 4D3XA 1QORA 3KR9A 3QBJA 4XQCA 1XROA 2I33A 4BEVA 1FP4A 1JQLB 1Q7GA 4MUIA 4I5DA 1HQYE 2YWHA 3BWCA 3WG9A 2JVKA 5A3RA 5C3MA 5HM8A 3PK0A 1UP6A 4AJKA 1JOCA 1KOLA 1YJWP 1KR5A 2YIUC 2HIMA 2I65A 3GT4A 3PNLA 4OHFA 1UM8A 1NONA 1YS2X 4V0QA 3LIIA 3CX5D 1YZ3A 2FCRA 2JGLA 4PF1A 5BRNA 5EJAA 1TK2A 1SUDA 3SC4A 4AY5A 4Y0AA 1RW4A 4Q3OA 4LYEA 4MWTA 1HKHA 2QVCA 3UGKA 3WGMA 3L93A 2ZXFA 3ISJA 3LYUA 3N3BC 3W5HA 2R4TA 4OU4A 5LQAA 1HYEA 2AOTA 3OX3A 2YXNA 2J41A 3L79A 4Z5XA 5EESA 1L4UA 5C4MA 1Y7LA 3RYHA 3O2JA 3PITA 3Q3DA 3PNPA 4G8DA 2AMYA 4Q1AA 3CRZA 2BM0A 1OLXA 2GN6A 3QVSA 1H0RA 2NNWB 1DLJA 3CCQP 1KFMA 1GDHA 1I51A 1U3FA 2ALJA 3S1KA 1AA9A 2RBGA 3ND6A 3UB4A 1KQFA 5FUXA 1P0PA 3RAEC 4HLUC 1IFIA 2I4LA 3R23A 1ZXLA 3NC0C 4EAQA 1R9MA 3CLTC 3BRTB 1XAJA 4R7TA 4XR4A 4X1KB 4MSUA 4DUGD 2CUKA 4KQ9A 3G3ZA 2XB9A 3G2OA 5CR9A 5DOZA 1V45E 3ZBUA 3SJ7A 5EKSA 3FGAD 4GXNA 3VVCA 3AF2A 4CE6A 1FLDA 1L0LD 2KUBA 1SVMA 2FPRA 5B3JA 1Y5LA 2DERA 1GPBA 1QGYA 2Z57A 1N8SA 3LVRE 3TCNA 3TSCA 1T5SA 1LI7A 1TOAA 2WNHA 2WB2A 3NHBA 3PLNA 1VFPA 1U5AA 4DZTA 3JRXA 2WTMA 2C1XA 3ASZA 3RYHB 3FPCA 5JS6A 3FCXA 4M1MA 3ILSA 2B5VA 5COAA 3DVQX 4OKSA 4BGDA 4D6TE 4PZDA 2QQFA 3KSBC 4V39A 3OLZA 4QDJA 4IUBS 5FWDA 3S8MA 5IKMA 2ST1A 1GCIA 1NXQA 3I3OA 2NU9A 2O5EA 3T1NA 4NZMA 4Q6BA 4YDSA 5HPYB 1JFLA 1NJ5A 4BNIA 3FM9A 2HFED 2Z2KA 3JARA 1RRKA 4MKZA 1NXVA 4FFPA 4MNTA 5KQGA 1BMFD 2BR3A 3O8OA 5TEWA 3CCSP 5E2AA 4ZZ1A 4B32A 1M1JC 2PQ6A 1NUHA 3BK1A 5ENVA 5G4KA 4DL9A 4ZEVA 5CM8B 4DV5B 3QEAZ 1IY0A 2JI8A 5EERA 1R9NA 2OO3A 4PZ0A 1EZVD 3CCBA 2NZ8A 1UBMS 1KNQA 2HF7A 4MV9A 2AQKA 5G1NA 4D9HA 5KLVJ 2FUG1 2O06A 2V1XA 3I34X 3N6XA 4LX8A 4RD3A 5ICFA 4K9QA 2R6FA 3Q6NA 5LP6B 4I2LC 1TCCA 3LC7O 3EAGA 4B4UA 5IZ4A 1MV5A 5G1OA 5AVVA 4GGMX 5AJTA 1A8PA 1I4EB 1RF1B 3FD8A 4I99A 3WGIA 3RU9A 2WQ7A 3LMKA 4N47A 4I1IA 1XN1A 4NBVA 5KAIH 1P0CA 2GXUA 5BO5A 4GNRA 2BFWA 3W2EA 4PW0A 1EGHA 4AJLA 3T06B 2ATVA 2JLRA 2XNHA 2ZSFA 5FPYA 2VQDA 2GHRA 5GP1A 4HI0E 2QVZX 4JROA 4YDQA 1IN5A 4RANA 4LDPA 3I2IA 3SFTA 4NCXA 1K8ZB 2QB5A 2H7XA 4YACA 1OWNA 4IO1A 5FNVA 2OBFA 3DLPX 4AN1A 1U7JA 4L15A 4MV4A 1WD5A 4WB4A 1OZ0A 2ZSKA 3S0JA 4PR0A 1U1EA 1GL2D 1E9FA 3TZEA 3GP5A 3O4JA 4BKUA 4C4ZA 4ITRC 3RGWS 3LPLA 3PZRA 1JSRA 3URMA 4KMSA 2O2YA 5T7BA 1DBVO 3OSUA 2DVMA 1V7PC 1ZSYA 1Y8AA 1QBKC 1P45A 2CBXA 1TRHA 4M83A 4NE2A 2V96A 3FPBA 1UM9B 5JJIA 5B2EA 4FEGA 3QU7A 5EC8A 4LRYA 3RYIA 4TS1A 3CC2P 5JYCA 3CLVA 3H1JJ 1XNQB 4IXNA 3CL3D 1JDPA 3F7NA 1ZOLA 3C7TA 2G9QA 1LJLA 3MT0A 2QP9X 2BCGY 2O2EA 5EZQA 1IUNA 1NJ6A 1PEDA 1CZNA 1DEOA 2I1WA 3BILA 4REQA 5HUHA 4OD0A 1CULC 1X0TA 1BG6A 4XGKA 1YOVA 4OB7A 2REQA 1XL1A 2XDQA 4DLPA 2CL0X 1KWGA 2YO3A 3IBFA 3M5WA 4A0HA 1VQ9P 3S4RA 1D9ZA 3MJHA 5GONF 2ZR7A 2I2WA 2RGXA 1FTNA 1HWTC 3RHTA 2XUIA 3LFHA 4YRIA 4IGKA 1L5NA 3NWJA 2XEDA 1NU1K 4F85A 2REBA 5FKJA 1LSSA 2ADFA 2FJ0A 2IEIA 3N5CA 2Z5HA 3PGA1 4IV0A 3P9QA 4ZJYA 2XXAA 2CC2A 4JL6A 4PN3A 2IPOA 5LB4A 3VDMA 3C7KA 3O2NA 1LK5A 1E20A 1UM9A 3AU8A 5AJXA 1XXHB 2XMRA 1GL7A 1RE0A 2B20A 4Y99C 1YGPA 3KOWA 4EOGA 4NV1A 1G1AA 4DQLA 1QIFA 3OBIA 4O8ZA 1TM3E 1LPOA 1VBKA 1KERA 1SUFA 3QVWA 1FVOA 2DULA 1VHWA 1EESA 1RXSA 2I80A 4QTXA 4B4KA 4CDMA 2WFMA 1DPGA 2Y9ZA 3QHQA 2VDVE 4V0OA 4D8VA 2ODPA 4LJYA 1YOVB 2Q3BA 1HDCA 3RLFA 4F4DA 1QM5A 3I0NA 3LJKA 4HB3A 3RAPR 1P62B 4KQ6A 3MAAC 4LRWA 5KOHA 2C9LY 4M8NE 2QDXA 2EJBA 1ONBA 5FUVA 3JTMA 1CC1S 1VFNA 1JVBA 2QKYA 4B86A 3IGFA 2O01J 5AK6A 3T15A 2JGMA 3PCXA 1HVVA 3WLNA 3U49A 4B4DA 4LOAA 2YZKA 5E8JA 4DSZA 3OFJA 2EKPA 2IBZG 3EUEA 3ZH9B 1UBJS 1AO3A 1WNTA 1IK7A 3UW3A 1G4HA 1NG9A 1L0ND 1CB7A 4IHJA 5TXGA 1CRWG 1NMEA 4INZA 3M5CA 2Q6LA 5IFLA 1B6SA 5CCBA 2BHSA 2ODEA 3HYLA 4ON9A 3RKRA 2JIBA 5CFOA 1FUIA 4FT4A 5K3DA 3IPYA 1AHHA 3NVMB 1V71A 2SKDA 2PT5A 3FGPA 4MRPA 4BATA 5LMUB 5LD2C 3PCTA 1GY8A 3MJDA 3NG1A 4H1HA 4K9OA 4MR9B 5WRFA 3R75A 2AJCA 3WLAA 4BWFB 3B48A 5KOYA 1GQOA 1D5WA 1P1RA 1BNCA 1UZUA 2J46A 3GCWA 4DIOA 3I12A 3BEOA 3ESZA 4ASUD 1Z6GA 1U7WA 1LRJA 2R8PA 5DTQA 5IULC 3UH1A 3GCGA 3UW1A 4G65A 1JBQA 3F6BX 2BCCD 3VV2A 4RFLA 5JQGA 4PGGA 5DLPA 5ELLA 5J4YA 5K6TA 3V4LA 3ZD9A 4NJMA 4D98A 5KSOA 4TLFA 3D71A 5JI2E 3WMM0 1XK6A 2EGGA 2Q2OA 4NWIA 4LE0A 3V7FA 1N2BA 2BJVA 4BLTA 2H1OA 2BMAA 3CKKA 3Q7QA 4X90A 3LH5A 4KMMA 3BDAA 3R5HA 2VTBB 5BV7A 4CF4A