2ZYTX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with paps
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
KLDVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 103
structure length 291
sequence length 291
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zytX00
1E0AA 2VP4A 3FHTA 3FVQA 3CONA 5KNBA 3LV8A 1RYFA 3OEHD 3GJ7A 5FBVB 1NSTA 1HV8A 3GLHA 1HQYE 2R65A 4Q02A 1G8HA 5HZHA 2ZS7A 2QAGA 1OKKA 2AL7A 4RD0A 4MRRA 1NLYA 2R62A 1JJVA 3IILA 4TQAA 1T5IA 3BD9A 4UKDA 2OZEA 1ZU5A 1SXJD 2JDIA 2QSZA 3TSZA 2ODNA 2CLSA 4B76A 4DB4A 1TF2A 1EFHA 1UKYA 2ZXUA 3DZDA 4JL6A 1ESMA 2QTVB 1W0JD 2IYUA 5FBRB 4V0KA 4TYNA 2BVNA 3AP3A 3LVRE 3GLHB 2PH1A 2BCJQ 2GHIA 2IS6A 3I8SA 4NL4H 1XD2B 3QKSA 4ACBA 1U8YA 1VG1A 4G5QA 2P6NA 3GCGA 2ZE6A 1Q21A 4ZDKA 5E3HA 5GVSA 4PO8A 2FFHA 2PLFA 3PUVA 1TX4B 5CDFA 3V4RA 2ODBA 4C0LA 5LBIA 2OG2A 3U2QA 2YC4C 4XD7A 1XCMA 2GCOA 2CNWD 2GEVA 3AUYA 1M74A 1DBSA 2ANBA 4G5OA 4YMUA 3B9PA 2O5VA 4MYTA 4R2IA 4L4UA 1G7RA 2MSEB 2XAUA 4H1UA 3U60B 2RGNC 2WHXA 4D80A 1M7GA 4TMKA 1XNJA 1XEXB 4QC2A 3CF6R 4QRHA 2Z83A 2GF0A 2ZI4A 5JI3E 2GXAA 2OFOA 1SKQA 4TWZA 4KLZA 4HLCA 4PAOA 3UMFA 1Z0AA 3NKVA 1GOTA 1J90A 3AVOA 5E95A 2DBYA 3AKYA 1TU4A 4LJAA 3SJZA 2ZI6A 4LHVA 1OXVA 3FKSA 4POAA 4Q7MB 4PAMA 2V55B 3UWOA 3TKLA 1OXTA 1SKYE 4C0QC 1DAFA 4OYHA 2ODWA 1DAMA 2H7VA 4KYIB 4BFUA 3KL4A 4ZV4A 1EESA 5FUYA 3LBIA 1Q3HA 2GK6A 1TQ6A 2W2TA 3BERA 3FGNA 4A6PA 2JJ2A 4TMVA 2LKDA 2QTFA 3KTAB 3Q7QA 4JT4A 5E7IA 4O2LA 1D9ZA 2VHTA 1N6NA 1JB1A 4PHFA 1XCPA 1NIJA 4KBGA 4AI6A 3E1SA 3LAWA 3EZ2A 3QOFA 4DEXA 1HYQA 3W6OA 1OLOA 1L8QA 2IWHA 2WJVA 3NVAA 3QSYA 3I5XA 3FWYA 1F48A 2GVZC 2O8EB 1XZQA 3C4JA 3K0CC 5HE9A 1XXHB 5B2ZA 4AK9A 1N6PA 1YHNA 2GCNA 3PUWA 2YYZA 4ZI2A 1CXZA 1JAHA 2Q6TA 1KK1A 3GQBA 1U9IC 1R5OA 1VCIA 3CR7A 2CL7X 1ZNYA 2QI9C 3QXHA 5G3YA 4M21A 2ZRKA 4TLDA 1VYVA 2VL7A 2OLKA 4LRWA 1AN0A 4US0R 4LYFA 4PZZA 1HURA 2Z4RA 5CB6A 3AV0B 2KI5A 2F1HA 2W00A 3TQFA 2WV9A 1CJMA 3TMKA 4DLYA 1LNZA 4B44A 2PMKA 2AX4A 1KI7A 4AKHA 2OAQ1 5A4JA 1KO7A 5JMTA 3QBTA 3QEOA 4GP6A 2CEAA 1G4AE 4JSYA 3K70C 3FB4A 1T3HA 2JIZD 4RZ3A 1G19A 3RWMB 1J99A 1KJWA 4KYUA 2JCSA 4DLXA 3RYTC 1A7JA 1W0KD 4V0NA 5EJEA 1NVXQ 1A4RA 2CXXA 3MGCA 2WWYA 4LYJA 2XB2A 1TTTA 5AR1A 1QHHA 2WSMA 3WY9A 3DOFA 4FCTA 5L8VA 1ZD8A 1W49A 2IK8A 5SZHB 4KCGA 1DOAA 1NJGA 3PITA 4DXAA 3AM1A 5EE9A 1T4GA 3SN6A 2YOGA 4DLSA 3SJBA 3AF2A 4FMCF 2A5FA 4BUJA 3L0PA 5KTYA 4QXAA 4GBMA 4EPXA 1P7CA 1UBFA 4EQ6B 2HXYA 3GFTA 4LC0A 4C0AC 3ZZ0A 3SE0A 1CR2A 1RKBA 2J0UA 4C2TA 2QRZA 1ZYUA 1T3SA 3TGPA 4M1YA 2W6ID 1WCV1 2VF7A 4MUAA 4Y0AA 2J45A 521PA 5L3QB 1A2KC 1DAGA 2TMKA 3CZPA 3VFDA 1H65A 2YWHA 2BJVA 1GNPA 2KWIA 3CNOA 3U44B 1W5TA 2GBLC 1IAQA 2QAGB 4AYXA 2VP0A 2J0UB 3WNDA 5FTLA 2V54A 1IBRA 3QPWA 2XXAA 1G6HA 1B23P 2WOOA 4QJ3A 2ZR9A 4PFSA 4AIIA 3WBJA 2ZJZA 2AR7A 2ERYA 3KJEA 2WMNB 3T06B 4X8LA 4LK2A 3KJIA 4NCIA 3IQWA 4WAUA 4PO1A 1G3UA 3LLMA 1YZNA 1G8YA 3EZ6A 1CBUA 4DZZA 1TQDA 4OKSA 1W4AA 4GOXA 1G3MA 1WQ1R 2B92A 3E70C 3SDZA 4PR0A 1NVUQ 1N2CE 721PA 3EPLA 2QBYA 1N6RA 4V02A 1LB1B 3CX6A 4M2LA 1U94A 1D5CA 1GNRA 1P62B 2HLDA 4NU0A 4B6EA 1K5GA 1SGWA 1Z6AA 2KB0A 1FZQA 3GLFA 5P21A 4QOSA 4ESHA 1NI3A 1FOEB 3B1ZA 5FL3A 4WVFA 1IJEA 5DYGA 1IY0A 4Y0VA 5LB4A 1UDWA 4US2R 4HSEA 2V6JA 3BB3A 3IPYA 5IF9A 1G18A 2RGBA 2IT1A 2VP5A 4OBEA 4XH9B 4XVQA 3FOZA 3ZLJA 1P4SA 4QBHA 1DS6A 4KITB 3G5UA 3CPEA 1FUKA 2OUKA 3NTUA 4PQFA 4M1WA 2OV2A 4KBFA 5B30A 4BZPA 2BV3A 3QJYA 3FPAA 4Q9KA 4TYQA 1DPFA 2VBCA 1JALA 2OFWA 4YONB 4YXWA 4XSGA 1T8UA 4QM6A 2O8EA 2BEJA 2ZVQX 4C0HA 5G53C 3HPQA 2GNOA 4U00A 4TT3D 3QPVA 4BFWA 4NTZA 3CLVA 3A4LA 4XTCS 1NBMA 1HUQA 2QMEA 4ITRC 4RZXA 4B35A 1FMLA 1G17A 1Q1EA 3MD0A 2QN6A 4CYMA 2OCAA 4PC1A 1W48A 4LWZA 2AXNA 4ZDJA 2XSZA 2ODEA 3DVLA 2IYRA 3DKVA 4CGZA 1Q44A 5CIQA 3QF4A 1E3MA 4Q4JB 2QY9A 4JLPA 4W7SA 3N70A 4NCJA 1BIFA 1QHGA 2WWHA 1Q20A 1S0UA 1ZCBA 3SEAA 4M1SA 2IW3A 5L3QA 3Q85A 2BM0A 2IYQA 4I1OA 5EP2A 4AYWA 2HF8A 2BKEA 1CTQA 1YZLA 2R44A 1OH7A 3AVUA 3LXRA 3ZD7A 2JASA 1SXJA 2GZDA 3L0IB 3KB2A 3R9WA 5GVRA 2EFDB 3LVQE 5GJWC 1KAOA 1EG7A 2ZRFA 1WXQA 1JPNA 1D2EA 4JYBA 3BRWD 4HAVA 3TRFA 1X1RA 1KY2A 1ZNXA 3R7WA 4BZXA 1QVAA 4I81A 3KKMA 3B82A 3H84A 3WXMA 4AURA 3M6AA 4EPRA 3BFKA 3CRVA 4Q47A 1S96A 4B2PA 1G8FA 2B8WA 1XZPA 1Z28A 2BIFA 2NGRA 5K8LA 5SZKB 2QP9X 3EAQA 3PCRB 2Q9BA 3IEUA 3RS4A 1E0JA 2AHOA 3VKHA 5CIWA 2H17A 1YQTA 1XX6A 1FPMA 1U99A 2Z4SA 5EZ6B 3UK6A 3BGWA 1E4VA 4M4SA 1UFQA 4OQNA 2VP9A 3EX7C 1S8FA 3W90A 1AA9A 3KKQA 3QXCA 1JR3E 2JJ1A 2PEZA 1U0JA 2J0SA 1E9SA 1AQYA 1GL6A 1KMHB 1XEWY 3NDPA 1J8MF 2XZOA 5AUOB 3WNBA 3RRNA 1QG4A 3IBGA 4DLRA 1FP7A 3TH5A 2H8KA 3MSXA 3R8CA 2QM8A 4BLQA 1RVDA 5DYIA 1LV7A 2CL0X 3ND9A 3U3RA 3DHWC 1P9WA 2QMOA 3MLEA 4PANA 1QVRA 2ZETA 1NN5A 4ZO4A 3RVBA 4XWKA 5JEEA 5M04A 5G40A 2A3RA 4W5JA 1OXXK 2GJKA 1OIXA 1IQPA 2IC5A 2ZYUX 5DISB 5J5CA 3KQUA 1N25A 4CEJB 4DB2A 1G16A 3OE7A 4IOLA 3EZ9A 3LD9A 4DHEA 1U0HC 1E2MA 2MSDB 3MJRA 1CU1A 2EFCB 2NZ8A 5HCIA 5CM9C 2J7PD 4JKYA 1WBDA 2XJ9A 3B1VA 2IUSA 5KO2A 4F38A 4P33A 4WZ6A 2A7QA 1XMSA 4D26A 1ZD1A 1KKMA 3QG5A 4G5GA 1D2NA 2G3YA 1CP2A 2OCPA 4X8HA 2YWGA 2RKOA 1Z63A 2JIZA 3IHLA 1X3SA 4BZQA 2BMDA 621PA 1RRCA 4TTRA 3LFUA 3ZIAA 4K81B 4A92A 4ASUA 3PXGA 2YINC 3RS0A 4AWXA 2BBOA 2A30A 3UG7A 5JECA 3AF1A 3OEHA 2VHQA 3QXSA 4G01B 2NTYC 3L0SA 1E9DA 1GKIA 3B1XA 2ZS8A 4RSGA 1FL9A 2PL3A 1NF3A 4DCSA 1S2MA 2ZE8A 1UJ2A 3T35A 1QRAA 4S2EA 5FBWB 3GD7A 3GJ8A 1KI3A 4HATA 1S9DA 4RVCA 1GSIA 5FOVA 5LDDC 4W5HA 3ZQ6A 3N2EA 3WYFA 2DCUA 3AVXA 4CT4B 1YZQA 2XTZA 1R10A 2KSQA 2EYQA 4Q1DA 3ECCA 4JBWA 3ZZTA 3GJXC 2IS1A 3SNHA 2FFAA 1E1RA 2F43B 1JI0A 1PJRA 3BH0A 4FN5A 4M9XA 5AK0A 2KJQA 3GLIB 1GRNA 5EE1A 4DT1A 2Q3MA 5J40A 4US1R 2KBEA 1OSNA 1OFIA 3GFPA 1UKVY 3RS3A 4A0RA 2DFNA 2D62A 4K8OA 2QGZA 2HJGA 3JVVA 4JLBA 1AS3A 1YKSA 4Q9IA 5FR2A 4A6XA 3RABA 3K0CA 1FNMA 5FOWA 1HH4A 1FW6A 2CHGA 1IXRC 4EJSA 2GXQA 3RS5A 1Z2CA 3ZVMA 4LSGA 2V3CC 2IHYA 3LW8A 4B73A 5JLJA 1GILA 1ZP6A 1A1VA 2FEOA 1ZIOA 1LF5A 5HZKA 1VHLA 2A5YB 2HV8A 2ZAOA 3KFVA 2CHVA 1KSGA 3VQTA 1ZUIA 3THYA 1WE2A 3LQRA 2P0EA 4P0TA 3SS8A 3KQNA 3KTAA 3X2SA 2C04A 3DM5A 5JWOA 2ZI7A 1FMJA 4JS0A 3G0HA 3P4XA 1E2DA 3I1FA 5FPKA 3BFXA 1YR6A 4DDUA 2WZQA 1KDRA 2ZI5A 4FWTA 5F98A 2XTNA 1SVOA 3MCAA 4D2IA 2ZI9A 5C4GB 1E2PA 5FBQB 5JHGB 5C1BA 5GJVC 3WP1B 3L82B 2RMKA 5B64A 1ZMXA 3MFYA 4IDHA 2XZPA 3O8DA 3RRZA 4Q4HA 3I62A 2WWIA 3B8HA 2QSYA 3K9NA 2BHRA 3FHCB 2XX3A 4F4CA 4FMCB 2AFIE 4MRVA 4DLZA 4RD4A 1II8B 4CRWB 2QPTA 3O8RA 4NH0A 3AQ4A 4JYCA 1P5ZB 1OB2A 2K5UA 2EW1A 4UXHA 3ETLA 1ZUNB 2FPMA 1F2TA 2J1LA 1R5NA 4YDSA 3REGA 1Z06A 3T61A 1KTVA 3VKWA 3WHKA 2YNMA 4CDGA 2GF9A 1TQ4A 2IYTA 4DLVA 1E9CA 2I3BA 5C2JB 3B5JA 3LX8A 5FOUA 2P6UA 5DNYB 3H86A 5FTJA 1ODFA 2ZUCA 1N6OA 3DPUA 5EP3A 4O0MA 2P3SA 4Q00A 3HR7A 4NCHA 1E9EA 2OAP1 2B21A 4MA4A 4TYYA 1DVRA 1BS1A 1P3JA 4N1AA 5CM8B 3SQXA 2VP2A 1JNYA 2SHKA 4O25A 1NL3A 4URZR 1KI9A 1KIMA 1Q57A 3RS2A 1E2KA 4TL7A 5CB8A 4WBSA 1XBTA 1W36B 1KK2A 1UKZA 2XOKD 3L8ZA 5GJBA 1VCMA 5FTKA 2YKGA 2C95A 2J41A 2BMFA 4A8JC 4URWR 4OHXA 4QBIA 4DT1B 4JLJA 1FFHA 2ZQ5A 5AJYA 2F43A 1TMKA 4Q7KA 2WJGA 1HQCA 4URVR 4YDHB 5CK4A 3TVTA 4LX0A 1NBME 3RSLA 1N5KA 3CX7A 3X1DA 1CIPA 2JJ8A 5K8UA 3QY0A 1NP6A 1JJ7A 4UJ5A 1KSHA 1C4OA 2QEQA 1MR3F 3VAAA 3NC1C 2OO7A 3WNCA 2ZRJA 4ZCIA 3NEYA 1G5RA 1RPZA 3U3MA 4B3CA 1RW4A 4R71A 2NG1A 2VIIA 4P3YA 1S3SA 3CW2A 4NYMQ 4FCVA 4Z1MA 3KQHA 1SULA 4DSOA 3VNUA 4UXIA 221PA 2A2ZA 1OFUX 4JJKA 4ABYA 2ZE5A 1AZTA 1SXJE 3EA0A 2OM2A 2ZJ8A 3SJAA 2P5SA 4PHTA 4OHWA 1SVLA 1NVVR 4IXMA 1LTQA 1SQ5A 2A5JA 3VX3A 1YE8A 3ICQB 4N0EA 3VR2A 3DM9B 1S3GA 4L16A 4ZIRB 4F91B 2QAJA 1P61B 4IEEA 4XD7D 3KDSE 2V1XA 3C5CA 2OHFA 4I1SA 5J4VA 1GKYA 1SVMA 1G5TA 4EPVA 4DLTA 1UBGA 4JL5A 1ZC3A 4Z8YA 2O8FB 2C03A 3K09C 5JS7A 1PV4A 4B3XA 2UZIR 3F0TA 5TY0A 5EXSA 3U7EB 3NIBA 2FSGA 2QL6A 3TNFA 1XP8A 4QBGB 4EJSC 1WBBA 4Q4AA 2D4HA 1VG9B 4CW7A 3GJ4A 5JI2E 3OESA 3PENA 2E9SA 3Q72A 3TUIC 4QJ4A 1G4UR 4PPNA 1A82A 1KMQA 3KFXA 4HB3A 2WJIA 4C3ZA 4KFRA 1OE0A 1BOFA 3FDIA 3THXB 4LJYA 1ZNWA 3EZFA 2WJHA 1KI4A 2C8VA 4Z51A 1YZKA 3BBPA 3I73A 1Z6YA 4PQRA 3IO3A 2KBFA 1M6NA 4U7DA 3P26A 2VTKA 1TAGA 3BH7A 1AM4D 2IF0A 1U2RA 4AYTA 3V9PA 4AG6A 1KI6A 1Z6TA 2ONJA 1Z8FA 1XRJA 1G6OA 1S9HA 2QPOA 1V43A 2FOLA 4MKIA 2AKYA 4OI2A 1LS6A 2ZVPX 2HT1A 4X8OA 3CWZA 4A8JA 4GOKA 1XEFA 1XD8A 1F2TB 2PZFA 2D2EA 3QBVA 4GPTA 2FGJA 2JLYA 2G0TA 1YJ5A 2VHUA 1II8A 5DHAA 1M34E 1YR8A 1CLUA 1Z0JA 1DE0A 1IN7A 4HLUA 4LHXA 4C0JA 2H92A 4WXPA 3QUSA 4J0QA 1MO3A 4KODA 5J47A 2O8CB 1FNNA 1KAGA 3QXJA 3VNVA 2IUUA 5B58C 4OQFA 2G1KA 2GJ8A 2XNDD 2IYLD 3K0AA 1AIPA 4KSBA 1TF7A 1VIAA 4MKHA 4BLRA 4HB4A 5FBLB 4BLOA 4A0HA 4TLCA 3A37A 2ZRAA 2DB3A 2B8TA 1CR1A 4RJLA 4F7WA 1FP6A 1GWNA 1EFRD 1F60A 2OEPA 3QKTA 2X2EA 1RE0A 5J4KA 2VRWA 4MDFA 2Y8EA 1WA5A 4Q4JA 2IEZA 4JLVA 1RRPA 4RFVA 1MO6A 2V6IA 2NO0A 2PCLA 2ZRPA 3F8TA 4W9MC 1MO4A 1HT1E 3THYB 2AN9A 4D0GA 2P67A 3ZZUA 4PPFA 4WZAE 1DAIA 1X6VA 2QGNA 1OH8A 3CRQA 3LRPA 1XPOA 1CJKC 1UF9A 4B3GA 1XPRA 1AKYA 5CLQA 2AK2A 3VHXA 4LJ9A 2WJJA 4RKEA 3DO6A 4ERNA 4HLUC 3W6NA 5ANRB 5F9HA 1N6HA 3VR3A 3CBQA 4MKGA 1E96A 4PC2A 5AWFC 4BLTA 3KUCA 3C5HA 5JEDA 4A9AA 3EWSA 2CE2X 1X8JA 4NE2A 1VTKA 3GJ3A 4TMWA 3EXAA 5H68A 2ZR0A 5TARA 4URYR 3BORA 2Q21A 4TSFA 2JLXA 1MABB 5DSZA 3KX2A 3ZJYA 2Z5FA 4HDOB 1KZGB 4CEIB 5FTMA 2W2VA 5HTKA 1YR7A 3B78A 2QQEA 1UKEA 1LVGA 3MJHA 4JMPA 5BYJA 3OIVA 4UQOA 1XTKA 2PEYA 3TW4A 4C7OA 2X1VA 2GETA 3L43A 1E2FA 1SXJC 2GAOA 4OK3A 4RD2A 2V1UA 3ADBA 2IYZA 3A6PC 1XTQA 3TE6A 2X8AA 3SBDA 2J0VA 1VG0B 1OFTA 3MWKA 3ZVNA 3KKPA 2E87A 5E4FA 1N6LA 3FMOB 2AKAB 4MYHA 2G77B 2H57A 2JAQA 3CH5A 4KFSA 1XJQA 2W6JD 4UNPA 3ZYCA 2C98A 2IXGA 3K09A 3AH8A 4DIDA 5C18A 4G0NA 5F9FA 3FMFA 4WIAA 1G7SA 4H1VA 2ORVA 2JLVA 4HUQA 1G3IA 3DKPA 2GEDA 2ZPTX 3A1TA 3BB1A 1QDEA 2ZJBA 1UBEA 4HI0E 2C96A 4PPGA 2ZJOA 4NBSA 3Q7PA 4QL3A 2O8CA 4BECA 4PSKA 4G5SA 1OHHD 4JJZA 4P4UA 4AG5A 2IYSA 3EIHA 5JSZB 2W2XA 1NLFA 4KSCA 2WTUA 4EPTA 3KUDA 2VA8A 2EYUA 2FH5B 4QGAA 5BN3A 2ZU0C 1U0LA 1GAJA 1Z6XA 2XNDA 3SBEA 3O8CA 3V4FA 3LO5A 1NSFA 4LC1A 3T15A 3SYNA 2VO1A 3CIOA 2W58A 4PZYA 8OHMA 2JA1A 4KHZA 4PHHA 4PPQA 4A0GA 4ASUD 1FTNA 3KKOA 2CLDX 1S4QA 1T91A 4DBLC 1RRFA 2PJRA 2XJ4A 1R0YA 1W0KA 3DL0A 1RC8A 2OESA 2JEOA 5BXQC 3EPJA 2P2LA 4KO8A 5HKKA 1ZM4A 2JLUA 1EX6A 3CRRA 4GP7A 4JVSB 4DSTA 2ATXA 2IA5A 4MYUA 3EASA 3GEIA 1G9XA 2IXEA 1E9RA 4YMWA 4HLDA 1KK0A 1Z07A 5DN6A 5E7MA 4HYYA 4D25A 1ZM2A 3VMFA 2GBLA 2GTPA 3IDQA 2XSZD 4MGIR 3TUJC 3THWA 4FMDB 4Q1CA 4YC7A 4H9GA 2FZ4A 2VHJA 3K9GA 1M7BA 3FFBA 3SFVA 4TQ9A 2J46A 1NN1A 2YHSA 4HAZA 3D6TB 1P2UA 2IS2A 1O3YA 1HE1C 3RAPR 3PV0A 4UNRA 2GJSA 2YV5A 3ZDQA 2D3WA 3UATA 4UNQA 1AZSC 1D2MA 1ZIPA 3A4MA 3LH5A 3TVDA 5JSZA 2HYIC 4YXWD 2NO6A 3PJRA 3T5GA 1ZW6A 1AGPA 2J3EA 1GL9B 4FXPA 1KI2A 3U6KA 4TLEA 1E9AA 1F2UA 2IF2A 3X1ZA 4C0KA 1N6IA 2CLCX 1XXHE 3T1QA 4ON9A 3SFZA 1UBCA 2ZSFA 1W0JA 2FSIA 4WXRA 3VR5A 5J4YA 2IXFA 4V0OA 3CRW1 5BQ5A 4RCZA 1GFIA 1A2BA 3AGQA 4IJMA 1NNEA 2QP3A 4NONA 3IO5A 1V5WA 1YRBA 3CX8A 3X1YA 2F9LA 4RCYA 5GADl 4DCTA 1XU4A 2FFBA 2ZRDA 3W8RA 3IEVA 4QHSA 4IOMA 2GVDC 5HE8A 1L4UA 3OIWA 4RFSA 3ZGXA 1QHXA 1XMJA 3A36A 3WRYC 4JVMA 1GNQA 2C77A 3LA6A 3L2OB 2DWPA 2ZITA 4P4SB 4IOJA 1MV5A 1UEIA 1YZUA 2QQ0A 3U3JA 2CJWB 3K70B 3GLFE 1SVSA 2R6FA 1E2JA 5C4MA 3B2EA 1PVOA 1CS4C 4XWOA 1TL7C 3AEZA 5JCPA 1W7AA 5JJLA 1RYHA 5LPNA 3FMIA 1E2QA 2VLIA 3WP0A 1KSFX 1CJVC 5DHFA 4KFTA 5FOTA 4FMBB 4D4LA 1E2IA 4EPWA 2QM7A 1YRAA 5FUWA 2WPDD 3E2IA 3OIUA 3QI2A 3N2IA 2W0SA 1Q1QA 3LLUA 4EIWA 1XWIA 2OBLA 1G291 4B75A 4DCVA 4HDQB 1UEJA 2H5EA 3BC1A 4DUGA 1D6JA 5IK2A 2FPLA 4GSYA 3TUZC 1TEXA 4KVGA 5BWMA 3KQLA 4MITA 3OEEA 1KO5A 3IKJA 5IHPA 3EC1A 3CH4B 4LV6A 3IPXA 5JWHA 3Q9LA 4ARZB 3B13B 1II0A 3GP8A 3D31A 2O8DA 3C15C 3TBKA 3GLFB 3EIQA 1PUJA 3OZXA 4KLNA 5DI9A 1SVKA 4E5UA 3J81k 3TW8B 2WAYA 4PXAA 2REOA 1JBKA 3MWYW 5EXXA 3BOSA 1DAHA 4QKQA 1MRSA 2F7SA 4JT2A 3BK7A 2RGEA 2O8DB 1NMYA 1R5BA 3NH9A 2QG6A 4GL2A 1COWD 2A5DA 5DO9A 1RZ3A 1GKUB 4DSUA 1Z5ZA 4BLPA 2X19A 3SQWA 1DO0A 4WW0A 3FKQA 1GP2A 1U8AA 2JGNA 4HB2A 4M1MA 1TEVA 3DMNA 4QHTA 2RAPA 1G7CA 1K6MA 2H18A 4RD3A 2G9NA 3CKLA 1OYWA 3LY5A 4TZ0A 3VU9A 2YJTD 1E6CA 1KJZA 4GI7A 4LYAA 1NLZA 2FSHA 4LZZA 1E2NA 1PUIA 4NHOA 4Q18A 4DJTA 2ZSBA 5IT5A 3U7FB 1J70A 3OEED 2F3RA 2NZJA 2XZLA 1RIFA 1G1MA 1DARA 3I5YA 3UG6A 1R7RA 4F93B 2OE2A 1KI1A 1W2HA 2YVUA 4EPYA 1EFTA 1WP9A 1NKSA 4DLUA 1ZINA 1Z08A 1UDXA 4M53A 4RD1A 3WRXC 4Z1MD 3U61B 3TJZA 2O0KA 3I92A 4XVUA 4Q9HA 5KUTA 4E09A 2ZRNA 4GRAA 2GEUA 4V0MA 2I1QA 2Q3HA 2C99A 2GCPA 3TAUA 4EJSB 2JLRA 3EC2A 1H8HD 2D74A 4Q01A 2IEYA 3HJNA 3LWNA 1E79D 4OI4A 2IWRA 2XTMA 4GNKA 1KK3A 1IJFA 2F1JA 1VKJA 4WOPA 3THXA 4GZMA 4UNNA 1BH2A 3N5CA 1GITA 5KSPA 1EWQA 3MUFA 1CEEA 2WIBA 4IEIA 1CR0A 4HZUA 1BKDR 3DEFA 1ETUA 3IIKA 1JR3D 1TPZA 4M0LA 4Q21A 2XOKA 2NO1A 1JECA 1R6BX 3AF3A 4Q4AB 1UAAA 1NG1A 1ZU4A 2A78A 2J59A 4GFDA 4NYJQ 3M0EA 4UNSA 5CLLA 3B1WA 3TSOA 5B57C 3GFOA 4L9WA 4LV5B 3KXKA 4CEHB 4D0NA 4JL8A 4NZYA 1XF9A 2CVFA 1L7VC 1Z22A 5JCZA 1OJLA 2PLRA 4MDEA 1N5LA 3K8YA 2H1LA 4DDTA 3PEVA 3T1VA 2BMJA 3AF0A 4OJQA 1AJEA 4LBZA 4B74A 4PO9A 3THWB 3GJ0A 2HCBA 5H1YA 2R6DA 4PC3A 3QF7A 1KKLA 1Y3AA 4OI1A 2BEKA 2FX3A 4TTQA 1LS1A 1GZSA 1ZJ6A 1NBMD 1W4BA 3BXZA 3SU8A 1P9NA 2VQSA 4BEBA 3PR1A 4MQBA 4JSTA 2GJAA 4D4KA 2FFQA 1KGDA 2JATA 5G41A 2ZE7A 1E69A 1KI8A 3MRSA 1ZM9A 4OJKA 4N3NA 1R8SA 1IXSB 2EQBA 1X86B 5DH9A 2AXPA 1MKYA 1IN8A 5IRCD 4TSFD 3BFVA 1NMZA 3AGPA 4RFSB 2F1RA 3JZMA 2P5TB 1SVIA 4EDHA 1F5NA 4NPHA 4C4PA 2FV8A 5HKKD 2QROA 1QHIA 2FSFA 3P4YA 1N3BA 1TNDA 3QVVA 5K8IA 1QBKC 1B0UA 3DMDA 3I32A 2CL6X 2W0MA 5JBQA 4IDQA 2IYWA 4DDVA 4CEJA 5FFMA 4C0BA 2Z0MA 3A1WA 1G8GA 4Z8XA 5DLQC 3A1UA 1K5DA 1AS0A 3TR0A 4QNRA 2J7PA 4Q4HB 4V0LA 1IONA 1T8TA 2ZIAA 4ZPXA 5BW8A 2P6RA 4C2UA 4D6PA 1DO2A 1P75A 3HDTA 4Q4LA 2BBWA 1T0JB 2QE7D 6Q21A 2W83A 1Q1BA 4L9SA 1QHHB 3VR6A 4E22A 3NWJA 1H8ED 4W5WA 1OIWA 1N0VC 2QU8A 4AD8A 3ZVLA 1XEXA 4FWIB 5CJPA 3VHLB 4Q9JA 4BFTA 1JR6A 4JLKA 3QPUA 1Q22A 1E4YA 3AVQA 5KSYA 2BWJA 3A1VA 4KFUA 2XNSA 4OI0A 5IDVA 4PQYA 1XMIA 2FE4A 3W5JA 3U7GA 2RGXA 3NEJA 1XTIA 1VHTA 4B43A 2X77A 2FJUA 4LBYA 4ARZA 2FNAA 4IFEA 4QGGA 4B6FA 2C78A 2WBLC 1KNQA 2ZSAA 1HT2E 2QPAA 1EGAA 3A8TA 4XJXA 2J0QA 4MGKR 5LD2C 1GUAA 1JQJC 3GLIE 2NPIA 2HUPA 2GXUA 4Q1EA 1NN0A 4A2PA 5AUPB 4KAXA 1Z83A 1XDBA 3O8BA 1ESNA 2A9KA 3AP1A 3NHBA 4QG7A 3ZD6A 1P60A 2CCKA 2YWFA 3TR5A 1XXHA 3WMGA 4BEJA 2R8RA 4IDOA 5JJKA 4JLDA 4IVQA 1VIYA 1UM8A 3ASZA 1E99A 4OQXA 4LV8B 2FMXA 3QENA 1KYIA 4IOKA 1K8RA 5FI0B 5K8TA 4EFMA 4CT5A 4JBXA 1OPXA 2FG5A 5EQTA 3RWOA 2YC2C 4WZBE 2GKSA 1GRRA 3ZIAD 2GJ9A 3AUXA 3FKSD 4GMDA 4LI0A 4TMXA 3U3OA 2FDCA 1ONBA 1Q3TA 2D2FA 1Z6GA 5FPYA 1DG1G 1G20E 1XTRA 4C7OB 1Z29A 1AKEA 4HUTA 1N5IA 4B32A 1X1SA 1IN6A 1E2EA 1T6NA 2GZHA 4PTLA 4HDCA 1ZAKA 3ZS9A 3K0FA 1COWA 5EP4A 3NBYC 4N0DA 4LPKA 2PT5A 4MYCA 1LW7A 4HZIA 4R2HA 4OL0A 2L0XA 3PVSA 3CNLA 2NOAA 1G64A 3EWAA 3H2YA 2WIAA 3BAFA 3H4MA 3KZ1E 5KNDA 3CPJB 3LW7A 5FPTA 5EE3A 1A5TA 5KSZA 1S1MA 1CJTC 3K0AB 2WVJA 1FQJA 3RC3A 4LHZA 4QGHA 1W46A 2FWRA 2PBRA 4IVRA 3GLHE 1IOZA 2NPFA 3PEYA 4IDPA 2AFHE 5SZJA 3U3KA 4M1OA 2WKQA 1WB9A 1HY3A 1CKEA 2PJZA 1EXMA 4IW3B 2R2AA 1ZC4A 1IY2A 4I1VA 3CR8A 5IK2D 2CHQA 1LF0A 1YZTA 5FR1A 5L3VA 3WYGA 3T1OA 2CDNA 2WPDA 3QIAA 4A8JB 2RB4A 2REXB 3IQXA 4LJ7A 4EKDA 1F6BA 4LJ5A 3SHFA 4BASA 1MOZA 4M9ZA 5CJ2A 1X8KA 1G7TA 2BMEA 3BS4A 2YOHA 5TXGA 4R7ZA 4IXNA 2QBYB 1UPTA 4JKIA 1S1CA 3VR1A 4XSHA 2HYDA 2ZRLA 3SJCA 2DR3A 4O2RA 4UJ3A 5CYOA 4I99A 5EP1A 1OH6A 3AVYA 3PEUA 3LNCA 3D3QA 3B7GA 4PC6A 3I61A 3ONWA 1OIVA 2NO7A 2ECKA 4ZKDA 4MRSA 4B2LA 4PSAA 3SI7A 4JLAA 4G3XA 1W2GA 2ANCA 5C46F 2ZRGA 4BQSA 4BFYA 1XTSA 1KHTA 2LCFA 5TVKA 4DSNA 1KMHA 4NKRA 2AWOA 2IS4A 4TL9A 3OFND 1Q0UA 4CVNA 1MH1A 4B3DA 1E1QD 3U6BA 3AVWA 4MGYR 1OXUA 2B7CA 4ILEA 1PZNA 2GK7A 3EZ7A 2MSCB 2D7DA 5BYKA 1NG9A 3Q8XB 1Z0DA 4A36A 3B1YA 1NIPA 1T9HA 1I4DD 2ASEA 2OFXA 4LHWA 3CB4A 3GJ6A 2FZLA 2VSFA 2P65A 1TUEA 2RCNA 5HR5A 2CVHA 4TZ6A 2Z6VA 4EAQA 2RH5A 1J8YF 1JPJA 3T5DA 1D9XA 3R7WB 1EWRA 3QKRA 3ASYA 2G83A 2JLQA 2CCJA 4NYJR 3UWKA 5KU1A 1E0KA 1ZUHA 2IL1A 2ZU6A 3EA5A 2WM9B 4PC7A 2O0HA 1MT0A 5FUXA 4TT3A 4Q66C 2ZYVX 3AKCA 4Q1AA 4II7A 3FMPB 1ZCAA 2HXSA 4V03A 2QP4A 2REBA 4V0ME 1DADA 4O3MA 4IKEA 1IHUA 3IIJA 5KOYA 3JVUA 1VYTA 4QHYA 3QXXA 2ZUDA 1FX0B 4ZDWA 2ZI3A 3BIFA 4B3FX 2WSSD 1I4TD 2YZ2A 2ZEJA 5AJWA 4NP6A 4DEYA 3BWDD 3P1JA 2OXCA 1W47A 4P32A 4D4JA 1XD9A 2V7QD 3QKUA 3VR4A 2WKPA 1ZRHA 3NXSA 4PSVA 3EARA 2CE7A 1YR9A 1PLKA 2QORA 4TL6A 3RS7A 3D8BA 2O8FA 4MUBA 2DYKA 3FFAA 4DRZA 1II9A 5KPJA 2GRJA 3RDPA 1G3RA 1NN3A 1ANKA 4HAXA 3T1TA 5JJIA 2DWOA 2FEMA 5FTNA 2RGNA 2ZJ2A 2J9RA 1O87A 1KO8A 2OILA 3TK1A 5EE0A 1Z0KA 4Q9LA 2OBMA 2HCJB 1PLLA 4DVGA 1FTSA 3ND8A 3ZQJA 2B6HA 4M22A 1M7HA 1KOFA 2XEXA 3UIEA 3AB3A 4FCWA 3BJIC 4JVNA 3HWSA 1CR4A 2ZSEA 4XVRA 1EFRA 3V00A 2O0JA 3OAAA 1E32A 3CRMA 5L3SA 4LPSA 1W5SA 2NMVA 1IXZA 3THOA 3QE0A 3NG1A 3O47A 4P4SA 2KE5A 2Q9AA 3D7MA 4NYIR 4TN1A 5H70A 3LXXA 1SKYB 2F9MA 1M2OB 1P72A 2UKDA 3ICEA 3RSOA 2R6CA 2EWVA 2GDJA 2QMHA 4LGMA 2ZR7A 3PEWA 3IIMA 4GOJA 1T3LA 3C7KA 4XOIA 3CPHA 2ZYWX 2X2FA 1BYIA 3LBHA 3OHMA 5EE5B 2Q9CA 3JZAA 2DPXA 4M1KA 5D3MA 1H8EA 1DEKA 1IN5A 5J4HA 4NCNA 4UXJA 3EPKA 4AKEA 4LJ4A 3WHLA 1GDDA 1BMFD 2YWEA 2JLSA 4A2WA 1P2TA 3U4QB 3GJ5A 3S1AA 2DFKB 2PCJA 3B60A 4FI3C 4Q7LA 2ORIA 3SHWA 1DAKA 4TL8A 2EFGA 2LKCA 4GT1A 4OHYA 1DTSA 1GL7A 1W4RA 3B6EA 1R2QA 4I4LA 5UKDA 2R6GA 4FW9A 3K0SA 2ZRBA 3RANA 2DHRA 3RNLA 1U81A 1XB2A 3I3SR 4A1FA 4JLMA 4C30A 4B3BA 2DWQA 3E5HA 2HT6A 1QHSA 1TU3A 1WMSA 4DIEA 2QAGC 3Q5EA 3UMRA 5TDHA 4URUR 5ELXA 2BBSA 1U98A 1G8PA 2PX3A 4NYMR 2JLZA 4F4IA 4RKFA 1N0WA 3TQCA 3ADCA 1U90A 4FIDA 4S35A 4E07A 3U5ZB 3PIRA 1C1YA 5GJCA 1CULC 5FOSA 3W6PA 4HAYA 5EXTA 5KDLA 421PA 2GWHA 3HR8A 4E03A 2FGKA 3RC8A 1KDOA 1UADA 4OHZA 2QT1A 1E9FA 4OQMA 1GIAA 1W36C 5EUQB 1NMXA 3A1SA 3C14C 2Q0HA 3SR0A 1W44A 4PX9A 1JEEA 5FPSA 2WJYA 3LQQA 4FD2A 1BMFA 3FTQA 1RRGA 1M8PA 4HAWA 2VSXA 3L0OA 2ZTSA 2XGJA 1AQUA 4FINA 3CUEF 3GMTA 3KKNA 1RJ9B 3GPLA 2OT3B 1CRPA 2V4ZA 4ZI3A 3VX4A 2J87A 4Q1BA 121PA 1G3QA 1TUIA 2G88A 2NO9A 2BBTA 2PX0A 4TMZA 4LYHA 3RRYA 1VCOA 4C9BA 2JDID 1GM5A 3K53A 4TTPA 1VYUA 1U9IA 4B33A 4Q1FA 4DCUA 3U7HB 1ELOA 4BFXA 1KZ7B 5F3WB 5A5GA 1XCGB 1GTVA 4ZIRA 2VHCA 2AD1A 1SZPA 1SVWA 1YU9A 2EVWX 5KPDA 4RY2A 2ZSDA 4B34A 4F4JA 5KDDA 2OBNA 3K70D 2CMKA 1QZXA 2J5XA 2BJWA 2Z43A 2VF8A 5LB2A 2QUZA 3GLGB 3EW9A 1U8ZA 2G6BA 5HCNA 4TYPA 2CCGA 4NCKA 5SZIA 2ZUBA 3EG5A 1H8HA 2IYVA 1KY3A 1IM2A 3KB1A 4TYWA 1G21E 1W4CA 4CIDA 3AVTA 4AY2A 3X1WA 2GA8A 4DWJA 1OV4A 3QNUA 1P73A 1P2SA 3HYRA 4LDJA 3KQKA 3H1TA 4BWYA 3QEJA 4L15A 1G5PA 3G82C 3TLXA 1G41A 5CITA 2F3TA 1VG8A 4YMTA 1ZM3A 4P31A 3UMSA 1FQKA 1IY1A 1MO5A 1LY1A 821PA 5JS8A 2ZM5A 2DFLA 4PHGA 3RLFA 2MMGA 3SZRA 3NH6A 3RHFA 4KJZA 1W1WA 2V7QA 2WAXA 3C41J 2OCYC 4P4TA 2CK3D 2RHMA 4QFMA 4ZCLA 4EFNA 1JXMA 2HF9A 2UVQA 2FN4A 2VH5R 4LY6A 2G1JA 1EFCA 1EX7A 4G5RA 3HYTA 4CF7A 3GLGE 3AKEA 2OXRA 1KO4A 2BM1A 3ZS8A 2PZEA 3DOEA 3KXIA 1FUUA 3B9QA 3K0FB 3MWLA 4BRWA 1TQ2A 3WBKA 3Q5DA 3OE7D 4X8MA 1KDTA 3ADKA 4HB0A 3SYKA 2ERXA 4M9QA 2FPKA 2CJWA 1E2GA 1OYYA 2GXSA 4LJ6A 3TAHA 1F3OA 4KU4A 4L5BA 3VTKA 3AVPA 2ZYTX 1ZNZA 4MH0R 4AKGA 3B85A 2WWWA 3PFIA 1AGRA 2BOVA 2E1RA 2V9PA 3NC0C 2VEDA 3K0EA 3SYLA 3W9YA 1JQLB 1J7KA 1E2HA 2DY1A 5TV2A 3ZVRA 4BGDA 1GVNB 1OT3A 2O52A 2F6RA 3R9XA 3C8UA 2ZJYA 4BLSA 1OKKD 3LBNA 4MRNA 3ADDA 4ZKEA 1ZVQA 3IGFA 3QKRB 1XD2A 3QKSB 5DIFA 2RGGA 1NY6A 4RZ2A 1P2VA 1OH5A 4OHVA 4IRUB 3FYHA 2C9YA 2EWWA 4DUGD 4EFLA 3QG1A 2HLDD 1SXJB 3C16C 3I4LA 4TQUS 4ZDIA 1Z47A 4C0SA 5DGXA 1AS2A 1LFDB 1E94E 4A82A 2A5GA 5DI3A 5L3RA 1WF3A 2ZROA 4QBFA 4ESVA 4EUNA 4F92B 5JZVA 2CBZA 1Q12A 3RRMA 1NJFA 3Q3JB 3R20A 3QF4B 3P27A 1E0SA 1KI6B 4IHQA 3AVVA 5FOXA 5FUVA 2VSOA 3CNNA 3PUXA 2ONKA 4LBWA 2NIPA 2D7CA 3HPRA 3A4NA 4MGZR 4HAUA 3UANA 4DKXA 4CEIA 2GAAA 2C2HA 4HUQB 1CJUC 2QT0A 1Q1ZA 1XFAA 2N46A 2GZAA 4AC9A 4ACAA 2PT7A 1R0XA 4G1UC 2BC9A 2I1VB 3GEEA 5EXPA 1Z2AA 1SHZA 3GLIA 2JLWA 4K46A 4R9UC 4BRUA 1HA3A 2ZREA 1OB5A 5JRJA 3OAAD 4M8NE 1DELA 3CWQA 5EUMA 1AK2A 4GMXA 1QF9A 3CZQA 4DDWA 1ZD9A 4QM7A 1R0ZA 1MRNA 2F1IA 3K9HA 4JIMA 4FMDF 1P6XA 2IYYA 3FHOA 3I8XA 1XPUA 2QE7A 3PUYA 4B48A 3PQCA 3MAAC 3MG9A 4OK5A 2J7KA 5J4LA 2ZJ5A 3F3YA 4LOAA 3S1AB 3U4QA 1JEDA 4YLGA 3WMFA 2ZAMA 3OF5A 2AWNA 2O8BA 5AJZA 4D0LB 1BYUA 1IN4A 1KNXA 1YZGA 3M4YA 2WWFA 3GLGA 4BFSA 4A4DA 3W3AA 3T34A 2ZRIA 1ZM7A 3BH6A 3GEHA 3REFA 1BO6A 2QENA 4KV9A 1OF1A 5AJXA 1I2MA 4OK6A 1I2DA 2IHBA 4ZCMA 3HU1A 4A0FA 5CYPA 2BKUA 3TSWA 5CDFE 5DN6D 5TB5A 1R8QA 2VPPA 2H16A 2UZ3A 4QGFA 3CM0A 1YVDA 2O8BB 5HPYB 3KJHA 2WWGA 1HEIA 2RGAA 3DDCA 3PG5A 2RGCA 1RJ9A 3TIFA 5L3SB 1OFHA 5KHOC 4CEHA 4Q19A 2Q3FA 3NBFA 3BE4A 3UXMA 3U44A 5FL7A 4IFBA 3EIEA 1P9RA 2ZANA 3KJGA 4NMMA 2VYFA 2OSBA 3K9LA 1MABA 4U02A 1Y63A 3VKGA 4L8GA 5KDOA 4OQLA 1US8B 4U5XA 2BDTA 4Z54A 1QHYA 1R0WA 1JXOA 3OIYA 1VECA 3UPUA 2N1BA 1QG2A 5JFGA 3CO5A 5CK5A 3VU9B 4YMSA 2WOJA 1N0UA 3CF2A 5KSOA 2QMUA 2GILA 2NQ2C 1HE8B 4IVPA 4DCNA 4D82A 5KYKA 5JHHB 2WICA 2GESA 1OHHA 1X8LA 2I4IA 4BE7B 2IX3A 2ORWA 5AUQA 2QNRA 5FH9A 1TADA 2PZGA 3NBZC 2MMCA 4A15A 3W3ZB 2W6IA 1JAIA 1R4AA 4M9SA 3M1IA 4KI0A 4PZLA 4MRPA 4LHYA 4JVLA 2XXAB 2EU8A 4XTRA 3A58B 2W6JA 2JJ2D 4HEJA 1JR3A 4IDNA 4LJ8A 4NDZA 2IUTA 1NVVQ 2OLJA 4RD6A 1FX0A 3KXLA 1NVWQ 4URXR 4Q48A 3W5IA 1Z0FA 4HLQB 3SOPA 3WYAA 2C9OA 5DI3B 4RZUA 1XTJA 1OW3B 5FL7D 5AJVB 1E79A 4JZKA 2XB4A 2IBMA 2WWXA 4A2QA 2IYXA 2N42A 4BPBA 3ZH9B 2XITA 3QQ5A 2WKRA 4M1TA 4AKIA 4Q03A 1KJYA 1Z0IA 2DFTA 3AKDA 1NKTA 4WA7A 1J2JA 2ZS9A 4LBVA 4JLNA 1TF5A 5E7JA 2QTHA 3IBYA 5EZ5A 4D4MA 2EFEB 5D3MB 4BFVA 5FI1B 2FU5C 3FE2A 3R9IA 4XIGS 2RHDA 4D81A 3HU2A 1N5JA 2G0NA 3MWJA 2LWIA 3QVUA 5LD2B 2PMDA 5A0FA 1T0HB 2EFHB 1RFLA 1HTWA 5BN5A 1L4YA 1CRQA 1NRJB 2CNWA 2C9CA 1KDPA 3P20A 1I4LD 5F2EA 3T12A 2BCGY 3L8YA 2AD5A 3AP2A 4XWAA 1DG3A 3IHWA 3EPHA 2ZRCA 1E2LA 3MMPA 4QJ5A 5TMPA 1VPLA 1OXSC 4EQ6A 1WRBA 2B7BA 3LDAA 1VMAA 3HU3A 1M1YE 3W34A 4TLBA 4B2IA 2R9VA 4KVAA 4LUCA 1DAEA 1Z3IX 4CZ2A 2JJ1D 4I1UA 2AK3A 4PAQA 2R6AA 2FA9A 2WSSA 3WMEA 3R8FA 1XEWX 3H0KA 1VCNA 3I72A 3P32A 1XMVA 4R98A 5JRZA 4GDFA 3BB4A 2C5LA 5KNCA 4DC9A 2QZ4A 3NDBB 2F55A 3W8NA 1US8A 1T5LA 1CF4A 4Q7JB 3SC3A 4YQFA 1N6KA 2FF7A 2QRNA 1F2UB 2YOFA 4QNMA 3X1XA 4DLWA 2HJVA 1ZBDA 2ATVA 5AUNB 1EFUA 2ZRHA 5DE3A 5BN4A 1XJ0A 4NYIQ 1KSJA 2HDNB 5FPHA 3LX5A 3NHAA 2CK3A 3NBXX 2V8OA 3F5FA 1GRQA 3PUZA 1E1RD 1XJCA 1EK0A 1C9KA 2ZJAA 1E98A 1KO1A 1SHKA 1NY5A 2ZRMA 5D3QA 3AF4A 1GG2A 4JLOA 4B71A 1W36D 4MKFA 1WDTA 5JWRA 4KXFB 4HZUB 3UKDA 2VP6A 4TLAA 2WMOB 4Q5IA 2QA5A 4TMTA 2HEIA 1PLJA 2D06A 5G3ZA 4GZLA 2GCOB 3DZ8A 1VDZA 4BFZA 3IUYA 1L2TA 3K1JA 1E9BA 4B47A 4JBYA 5H8WA 4YMVA 1QHNA 3CF0A 2OCBA 2RGDA 1D8TA 1E1QA 4LCBA 3HP1A 3OFNA
chains in the Genus database with same CATH superfamily
1KR5A 1E0AA 3FVQA 4CQNA 3AFIA 1I6KA 5G1NA 3TLYA 3TZEA 1TLTA 3KLPX 2BZ1A 4M37A 5A3SA 1NSTA 2QQFA 1QIKA 1T9BA 3TE7A 4CMKA 1KZ1A 4YMGA 5K6TA 3O38A 3GPIA 4Q16A 1TCVA 1JGTA 2FP4A 3CT6A 4HQFA 4JA2A 4D9CA 4JD5A 3C3AA 3KC2A 1OZHA 4ND1A 2K2WA 4XWYA 1NRWA 3LBFA 4I9FA 4MRRA 2NLOA 2GAFA 2UAGA 3HJRA 1JJVA 3GVIA 1SU8A 3IILA 4YRBA 5K99A 1T5IA 3UCXA 4YCJA 4B76A 4DB4A 3D4PA 3T5PA 1GN9A 1TF2A 2YXNA 1JQ5A 2QDXA 2Z5LA 1V47A 2FEAA 3DZDA 3HKEB 4JL6A 3RREA 5A6SA 5EJ8A 2VUUA 5KTNA 2CVZA 4CU5A 1PEAA 4NR0A 4TYNA 2BVNA 2XGGA 1L1FA 3D54D 2BELA 4YV2A 4OXNA 3LVRE 1D2CA 1H0RA 2OKCA 3GLHB 3LIPA 3TPZA 4JC5A 4C03A 5EIEA 2GBFA 3OZVA 3ZGYA 2IS6A 1X15A 1EWTA 1XD2B 1U8YA 1VG1A 1RZUA 3UKJA 1K86A 3STXA 1Z5PA 4IIVA 1F3LA 3OKFA 4HRVA 5EA2A 4CQMD 4RULA 3I9V6 2FFHA 3NIDB 2WP0A 4OXKA 4CQJA 4NCXA 2JAPA 4DMHA 4RKQA 3B9RA 3EGXB 4C0LA 2OG2A 3U2QA 1VCHA 1LSSA 1EI9A 4F2HA 2GCOA 4KX5A 2Q2NA 3OVMA 1XKTA 3AUYA 3OTQA 2GS9A 2R60A 3BK1A 5ALMA 5G0SA 3TNLA 1Q7RA 2ANBA 4G5OA 4A27A 1VSVA 4YMUA 3OZFA 3B9PA 2OYSA 2QIPA 2QJTA 2I3GA 2H3EA 4L4UA 1Y8CA 4OFBA 1KXZA 4BLUA 3ISJA 3PQ5A 4KO1S 1QIJA 2C29D 3R6WA 2YICA 3IQGX 4EY4A 3S81A 4RMGA 1XELA 2EEPA 3BEDA 5FJJA 1FU8A 1XEXB 4QC2A 1P1JA 1I3NA 3QLTA 3LCJA 1AQ6A 3X2FA 5AHWA 2GF0A 3LP5A 1A69A 4NPCA 1SKQA 3RM3A 5ALUA 4TWZA 4MZDA 1RFGE 1DTWA 1Z4NA 3KIPA 3OCJA 4EHLA 2Q6OA 1Y1PA 2J3KA 5CFRA 2DBYA 4BU1A 2NADA 5G2OA 1ZA2A 3OLCX 3OJEA 1N3YA 1LDMA 4ZVTA 5GV7A 4ITVA 1QS0A 3B53X 1L4NA 3GN2A 4LHSA 3IMKA 1OXTA 3CKKA 5ALVA 5AYVA 5DF1A 1V6AA 3KEOA 4RKRA 3T3DA 5F23A 5HQ3A 2ODWA 4FNMA 1PL0A 4H1TA 3D0RA 4WBXC 5A6SB 4ZV4A 2ZYSA 2GK6A 2Y68A 4Z9FA 2Q6KA 3FWKA 4GSKA 2W2TA 2IPNA 2P8JA 3HG7A 1Y37A 3O8LA 4O29A 4DA4A 3V80A 1KYWA 5M29A 3PLAE 2I34A 2GD6A 4AX8A 3A9SA 3FYTA 3WISA 2GM3A 2O2ZA 4V3BA 5E7IA 5C35A 5FUQA 1AMOA 1SCQA 4O2LA 1PG0A 4ZO8A 4E1VA 4RV5A 3V42A 1N6NA 1JB1A 4R05A 1JZQA 1RS0A 1VPTA 4PGMA 2ZYHA 1VKRA 4KBGA 1KFKB 3HKBB 4BDSA 4OYLA 2GPYA 3OPXA 4K9MA 1NAHA 3QOFA 5KYGA 2O1EA 1W9MA 3G2PA 4JUIA 3P9IA 1FQOA 3W6OA 3SE7A 5C1PA 3KE8A 1L8QA 3NRBA 2WJVA 4CM8A 5HEKA 3S1SA 2CFTA 3NVAA 1MB0A 1U7ZA 5CUQA 3GLUA 1FRVA 2Q46A 3INNA 4PCVA 3U7IA 3VPBA 3U80A 2KHZA 5E3JA 5HE9A 4NBWA 1CUUA 4LY0A 2GCNA 2WJ4A 3BHIA 5HDBB 4EVIA 1JAHA 4OIFA 3E8MA 1AKWA 3VOSA 4C2AA 3DOCA 1VCIA 3CR7A 5G3YA 1WPXA 3QXHA 3ZQ4A 2GHRA 3WYNA 2ZRKA 3VYUB 3CKMA 4LYFA 1YTUA 1HURA 3P9NA 3JATB 2HRQA 4XM2A 5CB6A 2KI5A 2XUAA 5JAUA 1K3UB 3TQFA 1CJMA 3OLWA 1YL5A 1NBOA 4DLYA 3FA2A 4HQRA 2R8PA 4PG7A 3RV4A 3F9IA 1QM5A 3DVAB 1H1LB 4JZYA 1LNZA 3VZCA 2AX4A 2VNAA 1NF8A 3HMKA 1J39A 4MPTA 4B44A 1KO7A 4EATA 2YJNA 1D4ZA 1WMDA 4YFVA 1DKNA 4LDNA 3UEOA 3GUCA 4PG8A 2HO4A 2WE8A 4CKBB 1O0BA 2M6RA 4JSYA 5IBPA 3K70C 3FB4A 1XCLA 1A2QA 3VYSB 1G19A 2ZFUA 1WDMA 2EL7A 3IB3A 3K6JA 4JGGA 4KYUA 2JCSA 3QHQA 4B3RB 4DLXA 2UXCB 4KNYA 1A7JA 1V95A 2QYTA 4CV2A 2V03A 1SB8A 1A4RA 2CXXA 3H8JA 3NPAA 4KJXA 4KR0A 1TTTA 5AR1A 2G40A 2H7CA 2VWPA 2WSMA 4CL3A 1OBVA 5L8VA 1I10A 1ENYA 1SD5A 1VBKA 1W49A 2X40A 5HF8A 5JXGA 5MDHA 1AHNA 4KCGA 1DOAA 1L6RA 1MV8A 2WSYB 3PITA 4M89A 5CHYA 3UT5A 5CBPB 1WETA 3SN6A 2AEEA 3SGLA 2YOGA 4DLSA 3SJBA 3AF2A 4BUJA 2WB2A 3H6HA 3HR4A 2CFCA 1WKVA 3G3EA 4M3NA 2NM0A 4KXXA 1GY8A 1Y5MA 3GFTA 5TPZA 3SJ7A 4EI7A 3BILA 5GOTA 1CR2A 1UIMA 4MW4A 3H0CA 3F8WA 2QRZA 3LPMA 1T3SA 2GLTA 4NMHA 3IJ5A 2CLIB 2W6ID 3L7NA 4RM3A 2C7VA 1DRJA 2X41A 3A4VA 4J7UA 4CNBA 1ZGCA 4CM9D 1PS8A 1O5TA 1A2KC 1GARA 3HC7A 5A9SB 3CZPA 4B6OA 3CO0S 3L4BC 4FR2A 5CBKA 4TS1A 2REQB 2Q7OE 1NUSA 3O83A 2O3SA 3U44B 4AYXA 4YMHA 2FRDA 4IKOA 4UMVA 1CZHA 5DHUA 2VP0A 2J0UB 3N59A 4M1ZA 1W73A 5FTLA 1NUAA 2BGJA 2OC9A 3HI6A 3M2TA 3O9ZA 4UPDA 1G6HA 2CJPA 2WOOA 5DB4A 4EHBA 1ADBA 4AIIA 1J8DA 4K9OA 3TCKA 1LQTA 3P9ZA 3CEJA 2Q3BA 4GMFA 3A3KA 4AN4A 2JK0A 1VZ3A 3UVEA 1QU3A 1G8JA 4EB6B 4LGCA 5I9IA 1PF7E 1Y1SA 4I1YA 3TIVA 3OOJA 3ROZA 3KJIA 4TS9A 4PO1A 2N0SA 2PYIA 2A1IA 2XXBA 5EWMB 1G8YA 4W8OA 2ILVA 1AN9A 4OKSA 4MQ4A 4AMGA 3FUVA 1G3MA 2PNJA 3E70C 3SDZA 3IAM6 3EQ2A 3I04M 4WWHA 4YJHA 3UGJA 5D00A 3EPLA 2GERA 1PNRA 1LB1B 2CMHA 2FG7C 3R09A 3FOCA 3ROGA 3X1MA 3ZCTA 4DPKA 1X7WB 5LP1A 1UMDA 2X4LA 1N1GA 3E35A 4M2LA 3OQMA 2HLDA 1P62B 1IRXA 4IFTA 2IOQA 1ZUD1 4NENA 4ZO6A 1W88A 3G23A 1LI4A 1U6IA 4X6UA 1H2XA 4QOSA 4CXMA 1FOEB 1OC4A 3B1ZA 3LS2A 5BNFA 3NBAA 1DX4A 4OF4A 1IY0A 2AOUA 4BQPA 3ZC3A 5JATA 1THGA 3JTEA 4EYEA 3GOHA 5E9WA 3JATA 2ZOSA 1G18A 2VP5A 1ODSA 1JAZA 3DZKA 4XH9B 3VTAA 1T2CA 4LOJA 1X7WA 4TTVA 5C81A 2HAEA 3D6MA 3K8ZA 4QPZA 1CVRA 5F1PA 4KITB 3A6DA 4GR9A 4PQFA 2BF7A 2YIJA 2P6PA 4KBFA 3HDHA 5DTQA 2FZVA 1IUOA 2QTCA 3PDJA 1CDOA 3LGAA 4YONB 1DOHA 3BA1A 3JQ7A 4YXWA 5JISA 1RHQA 4HL6A 4XSGA 4C4YA 2O8EA 1EVLA 2EEZA 2TRSB 3IQIX 1Y9EA 4G26A 3BEOA 4Y2SA 1KH2A 4XIFA 2IITA 3LSYA 3MTAA 4NTZA 4F5DA 5CXUA 4GOOD 4EYOA 4ITRC 3AETB 4IZHA 3PFNA 4YACA 5K4GA 5FWAA 4EYKA 1U65A 5ELMA 3AHGA 3IX7A 1I3OA 3HYSA 4ZDJA 1E7QA 4ZYUA 3DVLA 3Q15C 1FRQA 3A25A 1Q44A 5KHLB 4PTZA 3GJQA 3H1EA 1OA0A 2G76A 2ZYDA 5CIQA 2P4SA 5DYYA 3Q6NA 5ADWA 3ESZA 3N07A 4INAA 2EBUA 4MVWA 4OQDA 4PONA 4RVSA 1BE0A 3SEAA 4OEHA 3SVLA 1JSCA 3Q85A 5L3QA 2IYQA 4AYWA 3HYCA 4P08A 4J03A 2PD4A 1V2GA 2C5BA 4RHCA 3K9WA 1CTQA 1ES9A 1L8AA 3LPDA 5BNZA 1SC9A 3LXRA 4JB8A 3OETA 1T2AA 2JASA 1C50A 2Y9MB 3E9RA 4F72A 3R9WA 1A9OA 3H65A 5GVRA 5GJWC 2ZRFA 1WXQA 3MGBA 2VT7A 5EIWA 5AXDA 3SC4A 4UPVA 3ZNNA 1UMKA 4C78A 1UOPA 3UA3A 2Q8QA 4REQA 3DOJA 1DUSA 2QTAA 1ODJA 4C88A 5AKYA 1X1RA 4V1CA 3SCZA 4M38A 1H4TA 4PWZA 4DCJA 2PKXA 1KVSA 2DQYA 2V8BA 1IEWA 3EFOA 3KKMA 4GBED 3I6IA 4I81A 2LVBA 3SC6A 3ZHRA 2ACKA 4ZHQF 3FPEA 4WK2B 4UU0A 3TXYA 4EPRA 1YDEA 2A8YA 3BFKA 3GNSA 4ZJYA 4YWHA 1Z4LA 2B8WA 2X58A 4WLEA 5K8LA 3OP1A 1ACJA 1KQOA 5SZKB 2IDJA 2QP9X 3FPLA 1W35A 4KO3S 4ENQA 2KYRA 4GWKA 4PZPA 3IQFA 3MIIA 1B42A 1E0JA 3MT8A 3PQDA 5CIWA 3VKHA 4AZVA 5EZ6B 3RVLA 1T6YA 1OXMA 5DASA 1B8OA 3BGWA 1E4VA 3MS4A 3KE9A 4M4SA 2VP9A 5F1OA 4BQNA 1GA4A 5BYAA 2AG1A 3MB5A 1R6XA 1T3GA 1EJ2A 3QXCA 5IUKC 1U0JA 1NA5A 4YPOA 3GI1A 1XEWY 1PL6A 5GZ3A 5AUOB 3DV0B 2XT9A 2D13A 3RRNA 4DLRA 4KBYA 1IATA 3EW7A 4TV9A 4KWIA 5I9NA 2C5AA 5LQMA 1DWOA 1IN1A 4QO8A 3AIOA 3R8CA 4RY9A 2VYNA 1LV7A 2GN2A 2H1RA 3AFHA 4K7JA 1NZDA 3EIWA 1LVHA 3UQZA 4I1PA 2QRHA 2ZETA 4YCDA 1RI3A 1JSLA 2FW9A 4DV7B 5M04A 3AR3A 5G40A 5KJ1A 1QGZA 1U7OA 1OXXK 1OIXA 2VJMA 5DISB 1QLJA 2QLFA 4LOIA 1AGNA 4PGHA 2PUVA 2AQIA 4IOLA 3NHFA 4XQ9A 2J07A 5ILGA 3UPDA 1EP1B 3PFWO 1CU1A 3QXGA 3RQIA 5HCIA 1SQSA 2WJ6A 3A6GA 3NNSA 2X9NA 1C4KA 3CA8A 4CNQA 5TF0A 2OD2A 3KWLA 4XZ3A 1LU9A 3C8MA 3DZBA 3KYDB 3PF8A 3RGWS 1TLLA 1IHXA 2QRGA 4P33A 4WZ6A 3O9VA 4LFBB 1BTOA 3ETCA 1XMSA 4M0EA 3HHEA 3TLGA 1ZD1A 5KQRA 2H7XA 1EFKA 4R83A 1O89A 3QG5A 4MRAA 1MIHA 1YI0A 1D2NA 2XA9A 4G5GA 4GXNA 2PKEA 3QEBZ 1SXPA 2HMYB 4LA4A 1Q2UA 4JQOA 3N2KB 5HHTA 3AFNA 3HY6A 2NU9B 3GH3A 4PHCA 4ZOCA 2ZBUA 2GNAA 2CXSA 3ESAA 4EZEA 5BUCA 2JGDA 3OQPA 2YINC 3RS0A 1OLUA 3VJKA 4H31A 1X1CA 2CKMA 1EB9A 1VOTA 2A30A 3T9FA 3UG7A 1PE0A 1YFJA 1EVEA 3IMEA 1LSJA 3K0KA 1Y9JA 4NOLA 2AI1A 2Y71A 3QXSA 3L0SA 1E9DA 5DYNA 1Y6RA 1MG0A 3DDZX 4KQ2A 1QCDA 1SBNE 1FL9A 1VL5A 2RC6A 1GNSA 3NAGA 1GTL1 2Z8XA 1UJ2A 1PYDA 1QRAA 1E6EA 2E0IA 3GD7A 3ND5A 3QOWA 4ZC1A 3T35A 2NUBA 4RVCA 1S9DA 3L4EA 3ZJ5A 1Z4OA 3L6RA 1SG6A 1K6IA 3ZQ6A 2R48A 2G4LA 1NASA 3N2EA 1TZKA 3WYFA 1PT7A 2DCUA 2AOWA 2BFMA 1YZQA 3BICA 1JN0A 3H97A 1R10A 4DMUB 2VTDA 4Q1DA 2ZATA 5JBIA 3GJXC 3I9JA 4CETA 1EBBA 3TRKA 4CTKA 2IS1A 2FFAA 3HFJA 3HKCB 3IE2A 3UNXA 4Q05A 3TLMA 3QWHA 3ZE6A 1H93A 1JI0A 1JA0A 2F43B 3OZGA 4FN5A 1R0RE 2G28A 4M9XA 4W1SA 5AK0A 3GLIB 2E55A 5EE1A 3RE1A 5FI3A 1CQXA 1S8AA 1SC1A 3L7CA 4I4TF 3H7IA 2YMLA 4GOND 1HDZA 1OMOA 3G6WA 1X9GA 4N01A 3RS3A 1TM5E 4BAZA 1CIJA 4CLRB 1M0TA 4K8OA 1GJRA 2AN3A 2WZDA 2RONA 3G2HA 4C04A 5IUNC 4OFWA 4A6XA 5IJ0B 4NNPA 3K0CA 3R0ZA 2Q1WA 1HORA 1V2HE 1IXRC 1DIOB 3DONA 3RS5A 3D4NA 3O2SB 4RABA 5EWLA 3LRTA 4A16A 4QARA 4F2GA 3L8CA 3LW8A 3BULA 4YGYA 5JLJA 5AH0A 1A1VA 4AMZA 2FEOA 2XYPA 3VR5D 1TZJA 1PFKA 5CA1F 1KGSA 2O2CA 1WY5A 2O48X 3KFVA 4KTVE 3LWBA 5FFNA 3VQTA 3WGTA 3ONEA 2ISSD 4HUJA 3GG9A 3QYAA 1HM5A 3THYA 1WE2A 3I52A 2ECOA 4RNCA 4JBLA 5E3IA 3KQNA 1ACLA 4B87A 2MYPA 3ZU2A 4U9IS 5PGMA 1ZN7A 4D4GA 1HDCA 4P98A 1UDCA 3VDQA 2IP2A 3NWBA 1NJ8A 1L5HA 4Q6WA 5FPKA 1YR6A 2VDUE 4RY8A 3HK2A 3CEPB 2WZQA 2BGRA 2HSJA 4MB0A 4J9UE 4J29A 1GQOA 1SVOA 4R1MA 4JYZA 3G79A 3T9CA 1HNWB 5IHXA 3N6RA 3AUKA 5C1BA 4UUNA 5A6VA 2JS7A 1XDWA 1GPH1 1YT5A 1ZMOA 3WP1B 3JR7A 3KWFA 4CKEA 5AVJA 3ECAA 3KG2A 2C4HA 2XZPA 3KZVA 3O8DA 3RRZA 2AG8A 1KOLA 5A7GA 5ICCA 5JC1A 1ZD5A 2IOHA 3NOOA 5D7NA 3W9UA 3WJ2A 5AM3A 4YALA 3WK9A 5I45A 1IY8A 2PUDA 2QSYA 1AX9A 3K9NA 4B5LA 1YBHA 2XX3A 3RAEC 4FMCB 2AFIE 1R8XA 3GLQA 3WBBA 2XH8A 4KGZA 4CRWB 1U9JA 2N9UA 2I2BA 4NH0A 1P5ZB 4JU9A 1MQAA 1T5BA 1F2TA 1SO8A 1Z2NX 2E4ZA 2FPMA 2O7SA 4IP0A 5G0UA 1L7PA 2IYTA 4BC1A 4UHHA 3FGPA 2PXCA 5FOUA 5F64A 2VBFA 1GYPA 1QQ6A 2OHXA 1R18A 2C57A 2H9AA 2HEGA 3KJFA 4ZTZB 1GGVA 3FYSA 5EP3A 1HT3A 4M7WA 4XIIA 1KEZA 3C7CB 1GR1A 1XFDA 1G98A 2P3SA 2RH4A 4FE7A 4GX5A 4AUNA 3HR7A 1U0TA 1FB5A 3OWOA 4D44A 2OAP1 4MA4A 4DLKA 1U63A 1UBMS 1N2CA 4E1BA 3BXGA 1MHPA 1SCJA 2JIRA 3E8XA 3RW9A 1GT6A 2VDJA 2XWSA 2VNJA 3H16A 1Q57A 4WBSA 4FHDA 4F9EA 3L4JA 4BRSA 3GRCA 2BMFA 4QBIA 3FHLA 4DT1B 1FFHA 5H59A 4U2BA 3BWMA 2F43A 1TMKA 5BMVB 2WJGA 3EOBI 4YT8A 4CLXA 1M5RA 3LQYA 2WRZA 5HS6A 3TVTA 2QSUA 1GPYA 1WP4A 4NJMB 3UC9A 3HY3A 1E1MA 1N5KA 2JJ8A 1WCXA 4CN8A 4UJ5A 1KSHA 4FD3A 1K7FB 3CNBA 1C4OA 1MR3F 1M2OA 1D3AA 2HREA 2BR5A 4XUDA 3VAAA 4DLLA 1GZVA 3NC1C 4QDXA 2OO7A 5CMLA 4BWFB 1G59A 2ET6A 2WIJA 3PE6A 3TJMA 4BWVA 4ZAXA 4KQFA 5BOVA 2H52A 1XMQB 2B0JA 3FETA 1F2VA 4CUJA 1WNTA 2JI4A 4OAQA 4P3YA 1YE5A 4QREA 3HDYA 1ZSYA 4NYMQ 4Z1MA 1JHPA 3PPYA 5K5EA 3KQHA 2RD2A 3ECSA 4GYYA 3ILVA 4OH1A 1BROA 4LC9A 4BATA 1OFUX 2Q6IA 2HWUA 4HJXA 2Q5HA 2ZAIA 3IE0A 4JJKA 4HNQA 3OX1A 1Z3CA 1T3TA 3VZDA 1AA6A 4J94A 4RNDB 3SJAA 2P5SA 3RTCA 1HNZB 1EVKA 3OIGA 2A4MA 1NVVR 3C6MA 4L02A 4PEVA 1E3EA 4K03A 2A5JA 1WW3A 1PVDA 2YR0A 3VMMA 4HWKA 4YP7A 2IU3A 3VX3A 5I7SA 3AERB 4K28A 3TD6A 2QAJA 4QODA 3BXXA 4Y1FA 1D2AA 1H9CA 2AR9A 5HUHA 1VGRA 5IDQA 1F8UA 1GKYA 2P9CA 3R6TA 2ZCUA 4EPVA 3GU3A 4DLTA 1PG5A 3CH6A 2PZJA 4JL5A 2HBRA 1ADYA 3PI7A 1QKIA 1G6KA 1LTHR 1MTZA 2QE6A 1HL7A 5JS7A 1PV4A 1ZWKA 4R1NA 1FE8A 4KIGA 4EMTA 3ILXA 5AK3A 4ETWA 1LBSA 3AUTA 3NIBA 4G5XA 2FSGA 2QL6A 2Q6LA 1ZK0A 4GMKA 1BFDA 4WESA 4TUYA 5G0VA 3TWOA 2L18A 3P2IA 4UW9A 3VR2D 3JD2A 1EK2A 2WHPA 4CW7A 2JANA 1H2RS 2NTJA 1LJLA 2YASA 4NQRA 3T1NA 3RF7A 3IKTA 2E9SA 3JD3A 5AI9A 3U4HA 4QJ4A 1DWQA 3T4EA 2BR3A 3KFXA 9LDBA 3FTPA 5JCJD 3FUXA 4R84A 3SEZA 2DR0A 4YREA 5TT1A 4Z4CA 4J1TC 1AXEA 2X8LA 4WKBA 4K6KA 3RTBA 1QGOA 3I28A 1SH7A 2HFKA 1X1DA 3EVCA 4RH1A 5EJIA 5GOZA 1KE1A 2DR2A 2FJPA 1KI4A 2C8VA 3WGYA 1IVYA 4Q3NA 4OB8A 4MUKA 1JHOA 4HH0A 1FUEA 4MEBA 1Q84A 2F4NA 3HFSA 4E33A 1L5RA 2UVPA 2IPXA 4BLWA 3PJDA 1TAGA 1AM4D 3UUEA 3DE3X 1FX1A 4IJQA 3V9PA 1H69A 4AG6A 2AW5A 3BDIA 2G5TA 1G6OA 1CS0B 3NBUA 4ZCTA 2P7HA 3A3PA 3PHIA 3T9DA 3L0CA 1KEKA 4OY3A 4OI2A 5CHEA 1XEFA 3G2MA 4R69A 1RQ2A 5IXYA 1TI7A 1F2TB 3B70A 4BP1A 2RGUA 2Z30A 1ZICA 2FGJA 4RS3A 2IHTA 3LP8A 3ZQKA 1UIRA 4Z0NA 1X13A 1WVMA 4YDQA 4HGRA 5HP4A 5LIRA 1DE0A 2VUIB 1PV2A 3H99A 4MZXA 4LHXA 3ZW8A 1ADJA 1VBFA 2X7XA 4MR7A 2WINI 5KOHB 3T3OA 3OF2A 1MO3A 1PJ3A 2O8CB 4F1WA 4ZOQI 3K2IA 4ZXFA 4YRFA 3S2ZA 4LF4B 1KMMA 5GGYA 3ZXYA 4OCZA 1NKVA 4YT2A 2A86A 4GOMD 3AV3A 4HB4A 2XE8A 2DZDA 4MR8B 5FBLB 3NNDA 4BLRA 2DSNA 3A37A 2H06A 4UQPA 4C6TB 5B12A 4G25A 1GR0A 4LJRA 4U2FA 1FTQA 5SYMA 2H0QA 3RK1A 1JLRA 4I08A 3QY9A 2OHHA 2B8TA 3EOZA 4C4ZA 4A6EA 3ZU6A 2QTRA 1VL0A 4H35A 5CJJA 3RUEA 3THRA 2QRLA 5J4KA 3DFIA 5KQSA 4JLVA 1RRPA 1C7QA 3ANYB 4MUNA 1MO6A 3A7EA 4XVHA 3TB6A 2V6IA 1GUZA 2WSBA 3BHNA 4WZBB 4G41A 2ZRPA 1WU7A 3F8TA 4JMLA 4W9MC 1HT1E 3HLYA 3ZZUA 1Y4ZA 4WZAE 1DAIA 1NX9A 1KJNA 2DKFA 4FFOA 5B3LA 1X6VA 1RYEA 2YYYA 5IULC 1GAEO 3CRQA 5E4JA 5FYQA 2YWRA 1DBRA 4B3GA 2OZLA 1WTCA 4R8MA 5AKGA 3VHXA 2Q5CA 5TT0A 3R8XA 6YASA 4D4LA 2ADMA 3JWGA 1NONA 1WX1A 2Q99A 2HBYA 2RHGB 3EVZA 1E1DA 1KL7A 3ML1A 5MHTA 4PC2A 5AWFC 1N7JA 1RLIA 2UZ1A 3H2KA 2PZKA 1OJ7A 4P3OA 3KZMA 3C5HA 3L41A 1D1TA 3VR4D 5JEDA 1ULUA 1X8JA 1E62A 1VTKA 3GJ3A 3D4IA 3HCFA 3OCXA 5FTWA 5KJEA 1ONOA 5H68A 5T5QA 5TARA 3FAKA 3NJ8A 5BVGB 2Q21A 2JLXA 1MABB 3ZY6A 2CDBA 2M1ZA 5DBEX 5DSZA 4IXDA 3F46A 5PNTA 1QDUA 4F1JA 4RVNA 4D3YA 4FILA 1X87A 2ST1A 2VSYA 2CY0A 3EMVA 3SKYA 1E6KA 3UGKA 2W2VA 1E7RA 4J16C 3PFHA 2FQYA 5IF3A 1ZJ5A 3EVDA 2MYTA 3ADOA 4JMPA 4D41A 2JGAA 1XTKA 3N2NA 2I76A 1PGOA 3V1UA 3EEBA 4WERA 1E2FA 1KKUA 1SXJC 3F9RA 4R40A 1NVFA 2QTWB 4F9GA 2HSZA 3ZLBA 4HEHA 3TE6A 5HS4A 3SBDA 1KYYA 2I29A 2WUEA 3O3NB 4M1QA 3QPAA 3ZJ4A 1O0SA 4ETIA 4BS9A 4X44A 5I4BA 2H0RA 2YVLA 4MYHA 2H57A 3CH5A 3LYUA 3ZVLA 4JK3A 2W6JD 3URMA 1U1EA 2SCUB 3OQJA 1PCXA 2W22A 5MN4A 4WIAA 5F9FA 1X7YB 3I2HA 2J08A 1G7SA 3FBGA 2ZUVA 4WSOA 3UYLA 5I47A 4L8YA 3GBPA 1PEDA 3DKPA 3BGIA 3KR0A 5D7BA 4ALNA 1EUDA 1H6BA 4B7CA 1QDEA 2H1IA 4PPGA 2C96A 3WLJA 2VPQA 3KOXA 1FNBA 3CU5A 3OFSA 4P4GA 4E5YA 1GSHA 4NOKA 4BECA 5CG1A 5E9AA 4JJZA 3FJYA 1UZLA 2BGUA 4P4UA 5I9TA 5IBQA 1IK6A 2B0CA 4ZGWA 3HUEA 5JSZB 5HRUA 5P8WA 4GEKA 1NLFA 2WTUA 1ZCZA 3KUDA 3HBLA 3VAZA 3WGKA 1OBFO 4QGAA 3P0EA 2VDOB 1Z6XA 1U28A 3RSCA 3ZLVA 2O5EA 1EFDN 4UBMA 5M7EA 2JGKA 4LISA 3SYNA 1NQXA 5K20A 3HTXA 2VO1A 2VTVA 4OX9B 3SX4A 3CIOA 1SU4A 2W58A 3H42B 3JVIA 2JA1A 2JFNA 4LQDA 4PHHA 1M1NA 1FTNA 1RLJA 5FFFA 1S4QA 2WA1A 2QM3A 4UC0A 3U7JA 5DM0A 1T91A 1RRFA 2RJOA 3EODA 3KAJA 3ZHYA 2CNNA 1T15A 3DL0A 5DGCA 1V1JA 1FA9A 1C3JA 3UC5A 2OESA 4HO1X 3VSBA 2D0OB 2P2LA 3F6CA 3A6HA 3HCRA 3CLTC 4GKBA 2P6OA 3CRRA 2I33A 3BRCA 4MUGA 4ANFA 4CU2A 2ATXA 2IA5A 4MYUA 4RMNA 3EASA 4L73A 1EDOA 5EKXA 2GF2A 3QFSA 2VAVA 2EKZA 1G9XA 2IXEA 4GH5A 1MT3A 4ZU3A 2G9QA 4LOHA 1KK0A 3FM9A 4JQZA 1XAIA 1VQ1A 4D25A 2H1SA 5EJ6A 3G68A 1MVLA 2GZ1A 1N8SA 1C8BA 2X1MA 3K5PA 4B4UA 2EV9A 4HFMA 1LZKA 3O4VA 5B3JC 2FETA 3ROEA 4JIGA 1ORRA 4NZZA 4B7UA 1FMTA 4YC7A 4H9GA 4J0KA 3ZZ1A 2VHJA 4AY5A 3SFVA 2EX4A 3FYCA 4TQ9A 3ZI0A 2YHSA 1Z38A 1E5DA 3D6TB 4ZCSA 6ABPA 3DTVB 5HDQA 3RAPR 1U3GA 2NACA 2D3WA 1RP7A 4R2WA 3HB7A 2JD0A 1D2MA 1XCOA 2DHEA 4QXRA 3SX2A 1ZIPA 5JZMA 1BQEA 2H5JA 3UB4A 2AC7A 2O23A 3RAGA 4MMXB 1DU4A 3MJVA 2NU8B 3QE9Y 2J3EA 3BMNA 1QC5A 4RK4A 2E48A 3BMQA 3VYRB 5D5PA 4DSZA 5AT1A 4Q34A 2Q62A 1P0CA 2CDCA 1HGXA 1VLZA 4V2UA 2XUQA 1NSYA 2W4IA 2FSIA 3P97A 3SZGA 2ISCA 1JB9A 5THQA 2HXGA 3B9BA 4WXRA 3UB2A 3VR5A 1A9TA 2IXFA 4LI3X 4II2A 5BQ5A 1GFIA 3ORFA 3QVGB 5HMMA 1W5EA 4K6OA 2P1RA 5DTRA 3IO5A 4DIUA 1V5WA 1YRBA 2QGFA 2F9LA 3ORSA 3P8ZA 4RCYA 2O5RA 4DR4B 5JDCC 5SYAA 2YFHA 2IRWA 4JEMA 2H11A 1MEEA 4TM7A 2GVDC 2PRKA 5HE8A 3RJ5A 1HF3A 4XOUA 4RFSA 1VXRA 3FNHA 5TQ2B 1E59A 3WV4A 4JVMA 4ZODA 4ME6A 2CEKA 5AVXA 2ZITA 4IWXA 3KZNA 1DWPA 2QD2A 4IOJA 4EVRA 2E89A 5LLSA 1N7GA 1NVEA 1UEIA 1YZUA 1ECCA 1Y6QA 2CJWB 2QQ0A 3MTQA 4OGFA 3R7BA 2NVUB 2CKDA 4TRRA 3VR4H 1SVSA 1Q17A 4WK6A 2UVDA 3GCDA 1OVGA 5D5HA 3T0GA 4ICIA 5C4MA 1JHUA 3UJCA 4FDAA 3GUUA 1WNFA 1TUGA 1P1RA 3D2CA 1TL7C 3JASA 2A9JA 4Q3CA 4TKZA 1NR5A 2HHLA 2OGUA 1ULTA 3MNFA 2DUWA 2WM3A 4HADA 3QQPA 4BNDB 3KV3O 1XRMA 2X6TA 3FMIA 3HMQA 3L7JA 3M3PA 5CXXA 5LPNA 1JEYA 2VLIA 5SV2A 3A0RB 4JC4A 3DHNA 3NM4A 3JQ7B 5DHFA 2ZCVA 4C6TA 3DFFA 2F3UA 2C59A 3D7KA 3HXMA 1OFVA 1WCYA 2LTAA 2QM7A 3GMSA 3OIUA 5FUWA 5KYVA 3RKSA 2W0SA 3GFVA 5JUWA 2ZB4A 4Z9BA 1TCCA 2BAGA 1G291 1TA4A 3DC7A 4HDQB 1TVEA 2CNLA 1F2DA 3EVEA 3ME5A 4MWBA 3RROA 5LQRA 3IH5A 3RS7A 3TUZC 1F12A 1OWMA 2WJZB 2XMGA 2ZTMA 5BWMA 2L69A 5EIHA 1F1BA 3OEEA 4PFKA 2CHEA 1I1HA 5IHPA 1P1KA 1X0VA 4MWEA 1L4EA 3B2NA 4D5EA 4UVEA 4BNVA 2YW9A 1A77A 3CH4B 3JRWA 2F64A 5JWHA 2WHEA 2Q1SA 3UW3A 4ARZB 1RM4A 5TLSA 2VYVA 3AXTA 1VC2A 4KLNA 1PUJA 4YAJA 2OL4A 5T64A 3EXHB 3ZHVA 2YH2A 1OU0A 2A0FA 2IH2A 4E5UA 1FYDA 3HB5X 1UZNA 4OBBA 2QRVB 4RQTA 2GARA 2QMQA 1CVLA 1IXYA 1JBKA 1RTKA 2B98A 3A9WA 5AW1A 2ZSJA 1Y1LA 4QTUB 4ETNA 3B12A 1TQ8A 1A0OA 2F7SA 3EDYA 3WRVA 2RGEA 3S8YA 2EJBA 2IQ5A 2WNSA 3NH9A 3PKJA 3MWFA 3ROMA 1YQWA 2QUBA 1D4AA 3LMKA 1RZ3A 5DO9A 4C7XA 4G8BA 4ZN6A 5ITWA 3ELUA 5KINB 4BLPA 1I0LA 1Y5RA 1TM3E 2A33A 2B94A 1ZVVA 3CS3A 3NB0A 3QH4A 3WGOA 1EIWA 1XKQA 3ANSA 3FKQA 1IK4A 1OLSB 3DMNA 9LDTA 1EBFA 4GI5A 4QHTA 2AQKA 4B5KA 2Z6UA 1X9IA 3GRKA 2H18A 3AUUA 3F3MA 1SBQA 4RANA 1VL6A 1DC6A 4PIMA 4RD3A 5GINE 1Y9DA 4DDKA 3OWXA 2JAUA 4X62B 1OYWA 3BQMB 4E7OA 3H2IA 4M83A 4TZ0A 2HUNA 3KR2A 4Y1EA 5TGDA 5KKCA 1E6CA 4HKTA 3HO8A 1XYVA 2Q50A 3LLVA 5JAQA 1KRXA 1GKLA 3D8NA 3QE4A 4J07A 1ULBA 4B8YA 3FRHA 2B8EA 2JH9A 5EJ2A 5JO0A 3GAFA 1CEXA 3JALA 1TVKA 1T8PA 2X0JA 4P84A 4YRPA 4F3KA 1DARA 3I5YA 3UG6A 1DIAA 1QP4A 1YB2A 2PWBA 2YVUA 1W2HA 3PC8C 4K9DA 1TKRA 1UMCA 1WP9A 1NKSA 3TW8A 4IV0A 1X1EA 3Q41A 1G66A 1KC1A 3W6UA 1KS9A 3WRXC 3U16A 3RI3A 2G09A 3QRWA 4ODIA 3R0JA 3RH0A 3I92A 1UBNA 1CQWA 3ABOB 4X92A 8MHTA 4H27A 4DMGA 3FNRA 5KC8A 7AT1A 1P2GA 4CLEA 1NPDA 3OKAA 4MVXA 2O3UA 2JIMA 4UM9B 2CD7A 1TXGA 4R7TA 1H8HD 2D74A 2FWPA 2YBDA 3FHJA 3FOBA 1E79D 3HJNA 2ZWOA 3LWNA 4ZD6A 3ZDRA 5I7FA 3QGMA 2FSSA 1X7XB 1IJFA 4DV6B 4WOPA 3N6VA 3II6X 5HMLA 3WK4A 4MUIA 2J3HA 2IH5A 1GITA 7REQA 4MVJM 3AEQA 2V6BA 3PNBA 3FCYA 4IIEA 2IZZA 2WIBA 3ZOZA 4BJHB 1NW3A 1CR0A 5JVDF 1ETUA 3IIKA 1TAQA 13PKA 1JEYB 3X3HA 1M75A 3F4KA 1IOVA 4C7VA 2NQTA 1Z4PX 1VE6A 2P4HX 1EM8B 2CUTA 2E5WA 3DA8A 3EXEB 1X80B 1MB2A 2NO1A 3ZTTA 3AF3A 3C0KA 2Q0QA 4Q4AB 2EOAA 2A78A 3KAKA 4GFDA 1LDBA 1FXWA 4NYJQ 4UNSA 1ONSA 5CNMA 3TSOA 2WT8A 1ZIYA 3EYAA 2YUIA 1KAMA 3WWCA 2YHUA 4E13A 4IMPA 4EHDA 3Q5GA 4JL8A 4CF6A 4NCBA 5E4TA 1L7VC 4DR1B 4ESOA 3OCYA 5JCZA 1RBQA 2NPOA 3R75A 2D2VA 2UXBB 1VHDA 3JU3A 1CE8A 3T5BA 1IB6A 2XD9A 4PRLA 4YJGB 3K4QA 3STVA 4B74A 1LVUA 2PQ2A 2PYZA 3KYCB 3I5MA 2R6DA 4LS3A 4N7MA 1H4VB 1KKLA 1KVQA 1QYIA 1V9LA 3OM8A 1DG9A 4EG0A 3N0RA 2Y05A 3A7DA 4EF6A 2FX3A 2O2EA 2V4UA 4TTQA 2FZKA 3UJPA 3ZY3A 3E3AA 4M60A 1DKQA 3T5CA 2ZPAA 3E0XA 1JAYA 4BNDA 2BJHA 3JQAB 5LBUA 4A10A