2ZYVX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with paps/pap and p-nitrophenol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
b'DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 104
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zyvX00
3CIOA 121PA 3QXCA 1IONA 1AKEA 3HJNA 3Q5EA 1DEKA 1AZSC 4YMWA 4PHGA 2RMKA 3R8FA 4OQXA 1U9IC 2BMEA 3B9PA 2YHSA 1GRQA 2QQ0A 3W6NA 2XGJA 2WWYA 4B2LA 1U0HC 1F6BA 2ANCA 3EZ7A 2ZJZA 4I99A 1GL6A 3KJEA 2A5JA 3TVDA 1E9RA 2CL6X 1SULA 2JLSA 4YC7A 4C9BA 4BLRA 1YZKA 2I3BA 4M53A 4ASUA 2R44A 4OI4A 3EASA 1BO6A 4F7WA 1JI0A 1VECA 2GCPA 2CVFA 3ZVNA 5A5GA 1XU4A 4JT4A 5C4MA 2V6JA 3IEUA 4UXIA 1UBGA 5DI3B 2I1QA 4HYYA 4HB4A 4NE2A 2VIIA 2QL6A 3U60B 4FWIB 4PPFA 5L3VA 5L3QA 5JI3E 1UDXA 3E70C 2CNWA 3GJ8A 4C0QC 1OXUA 4FMDB 1KZGB 1DS6A 1ZD8A 2ZJ2A 1WA5A 1N3BA 1W36B 2AXPA 1TF7A 4OK6A 1US8A 3U4QA 2ZRKA 3LQRA 4D26A 1JNYA 3RDPA 1SVWA 4WIAA 4ARZA 5CB8A 3ND9A 1TQ2A 2VSOA 2C9OA 3ZZ0A 4DJTA 3AVOA 3KJGA 4M1YA 3E2IA 4UQOA 4IKEA 1OHHD 3V4RA 1NN5A 1YR7A 4QL3A 1KMHB 3UMSA 4R2HA 2QEQA 4BWYA 1XPUA 4KFRA 1CF4A 2XTNA 4XH9B 4NU0A 4PAMA 4B3XA 4HDOB 1UJ2A 2OXCA 3HYRA 4UNNA 3RYTC 3LWNA 1YJ5A 3V9PA 3IO5A 2IHBA 1NMZA 2YINC 3PXGA 4PC2A 4B75A 5L8VA 4HLCA 1FNMA 4YONB 3SYLA 3N2EA 4DIEA 1GKUB 2WICA 4IDPA 1M8PA 1Q0UA 1AZTA 1KI8A 4EPTA 1QHSA 1YVDA 3THOA 2W0MA 2CMKA 4B44A 3PITA 1TU3A 3K09A 4D81A 1ZUHA 1TEVA 2RGBA 3CRRA 2XZOA 5AR1A 3BB3A 4LJ7A 2VA8A 5JS8A 3SBEA 2Q3HA 3G0HA 2FSGA 4JVSB 4X8MA 4LGMA 3MWKA 2NIPA 1KGDA 1RRPA 2GCOB 3MAAC 2MMCA 3EG5A 4ZDWA 2OBMA 4IRUB 3LW8A 2GBLA 4D25A 1P61B 1NKSA 1YZQA 1ZM7A 3CLVA 1IAQA 1SXJC 1V43A 2J46A 4BQSA 3TUZC 1NN3A 3K70D 4D0NA 4P32A 1RW4A 4TMTA 2EFHB 4M9QA 3TSOA 4FI3C 2FSIA 1EGAA 3AP1A 3QKUA 5KSPA 2GRJA 1T5IA 3J81k 4OQNA 4Q01A 4OI2A 3FMIA 1T6NA 2UKDA 3WMFA 2QORA 1XCGB 5JHHB 1A7JA 5DI9A 2J0UB 1G4UR 4L16A 2XSZA 2WJIA 3IDQA 1P73A 4G5RA 3O8DA 5CM9C 3C7KA 2J45A 2OT3B 3SI7A 4OJQA 3IILA 3DOFA 2ZVPX 3QPWA 3BC1A 3LBIA 1UKZA 5BYJA 3ZZUA 1OKKD 3CRVA 3SQWA 5BYKA 4AD8A 2HF9A 2CLDX 2QSZA 2G0NA 1YE8A 4RD6A 5E7JA 1XTQA 1NN1A 2IYXA 2KB0A 3A1WA 1NJGA 2KE5A 4J0QA 2QROA 3U3KA 2CCGA 1E79D 2BMJA 3C5HA 1FUKA 2A5FA 4R98A 4TTRA 1E2LA 4L15A 4AK9A 1SVKA 4Q9JA 1NNEA 4JSYA 1L4YA 1U98A 2Q6TA 2OCBA 4QGAA 4B2PA 1E9BA 4JKIA 2C98A 2VQSA 2ZSAA 1M74A 4LV6A 1E4VA 4JJKA 2KI5A 1FL9A 3AEZA 1IXZA 4QBFA 1CTQA 5DE3A 3T35A 1OYWA 5C1BA 3U7GA 1NMYA 4DUGA 3LAWA 2ZI6A 2CCJA 3BWDD 4TLBA 2YOHA 1W44A 3OIVA 3M1IA 3GLGB 5CLQA 4HDCA 3MCAA 3TSZA 4BPBA 3UWKA 1KMHA 3P27A 2G77B 5AUOB 1CS4C 5CIWA 4JKYA 4KSBA 4KCGA 3X1WA 1H8ED 5FOUA 4B3GA 1HY3A 1ZM9A 2A5YB 3MRSA 4M0LA 3SDZA 3NWJA 1HT2E 4RVCA 3DMDA 4MDFA 1UF9A 1JECA 2REBA 2D2EA 3QKRB 4B3BA 1KI6B 2RGNA 3FKQA 3FTQA 2PX0A 4A0FA 4LRWA 1XZQA 2GZAA 1ZUIA 2FGKA 3ZVRA 1KO8A 5G40A 4Z54A 4G5OA 3GJXC 3FWYA 2ZRAA 1MOZA 1KDRA 2QPTA 4FIDA 1YRBA 1PLJA 5CB6A 2JGNA 1WP9A 2GCOA 3U7EB 1ODFA 1P2SA 2ANBA 2NO7A 3GD7A 3B82A 2GWHA 1PUIA 1E9CA 2VPPA 1JAHA 4XVRA 5K8UA 1ZU5A 1TNDA 2WSMA 3TK1A 1SVSA 3KKMA 1JQJC 1IJFA 2GZHA 3VHLB 3K9HA 4OK5A 3R9IA 3VHXA 3VR2A 4ABYA 4XVQA 3FKSD 5J5CA 3HDTA 3F8TA 4HAUA 2XEXA 4V0LA 5EP3A 3K70B 2RAPA 1NSFA 4V0MA 4TSFA 1I4TD 4TQUS 1M7BA 3T06B 2HJGA 1A4RA 1KDOA 2ZUCA 1AA9A 3HYTA 2J0UA 4PANA 3I92A 1VIYA 3PQCA 4JYBA 1U94A 1XP8A 2WPDA 4PAOA 1Q3HA 4GOXA 2XZPA 1JB1A 2OFOA 2HXSA 4OYHA 2JJ2D 1M2OB 1XD9A 3CWZA 1P60A 3VKWA 3CRMA 5DO9A 3ADCA 4YXWD 4Y0VA 4A9AA 2FG5A 5C4GB 1OT3A 3NVAA 3SFVA 1G8FA 2CEAA 4MYUA 3SR0A 1VCIA 1KK2A 2W58A 4HAWA 5FL3A 1E1QD 2CK3D 3IQWA 3NHAA 2A30A 2J87A 2MSEB 1GM5A 1TADA 1ZINA 1G3RA 2ZRLA 2Z4RA 3ECCA 3ZYCA 5HPYB 1Z0IA 2G0TA 1QHGA 1N0WA 4RZXA 5FH9A 1NVVQ 4QXAA 1OJLA 2W0SA 2ZSFA 3WNDA 2RGDA 2HLDD 4UNSA 1DAIA 2PH1A 2C5LA 1N5JA 2XOKD 3BERA 1W4CA 3CPEA 4KU4A 4LWZA 2ZJ5A 4BFZA 3UMFA 5HZKA 2VF8A 1I4DD 2KJQA 3KUDA 5JSZB 2BBTA 1DAFA 1Z28A 1R0WA 3OEHA 2ZRGA 3RANA 4DEXA 3GLGA 1S0UA 1WQ1R 3AUYA 1IN8A 2OESA 5G3YA 3FHTA 2PZEA 3QXXA 4Y0AA 5E4FA 1II8B 2D62A 3OHMA 1N0UA 1OIVA 2IL1A 2Q3FA 3AKDA 1PJRA 3R9XA 4Z51A 1OHHA 2QUZA 5B2ZA 2BEKA 1YRAA 4X8OA 3QE0A 4MRRA 4EFNA 2V9PA 1CR1A 2EU8A 4QM6A 4UNRA 1JXMA 1MT0A 4PPQA 2QNRA 2WKQA 3BIFA 5EP1A 4B3FX 1KI6A 4OHZA 3TAHA 5KDLA 4BFYA 1U90A 2IF0A 3QXJA 5KUTA 2GEDA 1W1WA 4AC9A 3LLUA 2LKCA 4OL0A 3BS4A 1H65A 4A0HA 1LW7A 4DB2A 2ZAOA 3GJ5A 2XNSA 3PIRA 5FTLA 2ZEJA 4UNPA 1D8TA 3REGA 1DE0A 3CX7A 4HAZA 1NVUQ 2IW3A 3RS5A 2IUSA 5JI2E 1Q20A 4P31A 2KBEA 1GRRA 4N0DA 3CPHA 5L3SB 5DYGA 4GOKA 4RZ2A 4DDUA 1XD2B 1EXMA 3QIAA 2DBYA 4M22A 1KSGA 1GTVA 1ZC3A 3CBQA 3HU3A 1Z0AA 2RB4A 4IFBA 4FMDF 2VO1A 2ZR7A 1XTRA 1FP7A 2B8TA 2IYYA 2IBMA 5EE9A 3EX7C 2IEZA 4MKFA 4NCJA 4B71A 4K46A 2QGZA 4F4JA 1OFUX 2AN9A 1FX0B 3AF1A 1GRNA 4S35A 4NYJR 2FSFA 4MUAA 4XD7D 3ZGXA 4B76A 4H1UA 5UKDA 2YYZA 2VSFA 221PA 4CEJB 1UKEA 2NO6A 3HPQA 1S3SA 3U7FB 1XTKA 1NLYA 3X1YA 4B74A 3JVVA 2QPOA 1JEDA 1ZP6A 3B85A 2VEDA 5D3MB 3N2IA 3VNVA 1QHHB 3R20A 4M1SA 2AXNA 2GEUA 4P4UA 3I8XA 1BYIA 2IYQA 1E79A 3LA6A 1XF9A 5TV2A 2ZI3A 1G7RA 1CBUA 3R7WA 4BFXA 3WMEA 4RZ3A 5FOVA 3WY9A 1TQDA 2JCSA 4HATA 1NF3A 2WJVA 4G0NA 5AWFC 3T12A 4QRHA 3L2OB 1EESA 2WJHA 3CR8A 1SZPA 5FUXA 5K8LA 1EFHA 3Q7PA 4R9UC 4JBXA 4TYPA 5JSZA 1PLKA 1G41A 2OUKA 4HLUA 4MYCA 1CJKC 2C78A 4PZZA 3EPKA 1ZCAA 2F7SA 1KO5A 3AP2A 1NIJA 2PZGA 3TUIC 2B92A 2Z0MA 3TQFA 5E3HA 4BZQA 4CVNA 1GNQA 2BEJA 1K5GA 3DO6A 3ICEA 1Q57A 2A3RA 3UIEA 5LD2C 1KI1A 1DAEA 2P6NA 4WZBE 4PC6A 3SHWA 4HEJA 3MGCA 3EC1A 1DOAA 3K0CA 3ZLJA 4Q1EA 2EVWX 4LHZA 1HURA 3A4MA 5JFGA 4NCKA 3AVXA 2ZRHA 1UBEA 2Z43A 3NEYA 2X19A 1AS0A 2P0EA 1C9KA 4BLQA 3T61A 4EPYA 1Z06A 2FX3A 1EX7A 2AD1A 1ZM2A 3I72A 1D9XA 4M1KA 1RYFA 4HSEA 4KHZA 4DLYA 4MRSA 1GAJA 3R8CA 2EWVA 1DTSA 5ELXA 1F2UB 1M6NA 3JZMA 3TW8B 4C7OB 1MRNA 1E32A 4US1R 3KL4A 4D4MA 4LK2A 1UADA 3I32A 2BBSA 1XD2A 2PCLA 1GFIA 1KJYA 4JLVA 4F92B 4B2IA 4NPHA 4HZIA 4BECA 1Z3IX 4B43A 2GETA 2DY1A 1KHTA 3RS0A 3CF2A 3WRYC 1W0KA 3FKSA 1GITA 5AUPB 2GJ8A 2AFHE 2NG1A 2JDID 2SHKA 3QOFA 1VG1A 2QM7A 3NHBA 1HA3A 1P62B 3BH0A 1FX0A 2H92A 3QSYA 4KFSA 3L0PA 3UATA 1RYHA 1XJQA 1T3SA 2YVUA 3ZIAD 2YWGA 3W8RA 2HCJB 5JWOA 2D06A 2J59A 2JLRA 2VP2A 3IUYA 4NCHA 2WMOB 2J7KA 4OQLA 1GOTA 3TLXA 3TR0A 4CEJA 2H18A 2NZJA 1UBCA 1MO4A 1VYTA 4L9SA 3QVVA 2JJ2A 2V54A 5JCPA 5GJCA 2N1BA 2GF9A 1KSJA 3RS7A 2NOAA 2R6CA 3DPUA 3A36A 2DFNA 4YXWA 3PUZA 1PV4A 4PHHA 1J7KA 3BORA 1G5RA 3IHLA 3NEJA 1E9DA 2X77A 1QVAA 2X1VA 4JYCA 2GK7A 5KNDA 4DXAA 3TE6A 1NN0A 4ESVA 3WYAA 4ZCIA 2W2VA 1QHNA 2GXSA 1IY2A 2ZI7A 4MKHA 1E1QA 2CK3A 4URWR 1IY1A 3TAUA 3O8BA 1P3JA 1WXQA 2EFGA 1XXHE 1WDTA 4AYXA 1RC8A 3AVYA 4KJZA 1X8JA 2QBYA 3KKPA 4M4SA 4Q4LA 4MA4A 2ZI5A 3VTKA 2JLQA 2HLDA 1SKYB 2VF7A 2XOKA 3SZRA 4EDHA 4L8GA 3PEYA 3OE7A 3L0IB 3W5JA 2EYQA 4BZXA 4Q00A 3PR1A 3L82B 3LRPA 2D3WA 2GXUA 1OFHA 1E4YA 1U2RA 1E0JA 1TPZA 4NZYA 2OBNA 1MO5A 3RABA 2ZU0C 1HT1E 4TTQA 2QT1A 3AKYA 1US8B 1Z8FA 1TUEA 4QC2A 2WJGA 3IO3A 2O0HA 3NXSA 3NC0C 1NY6A 4LCBA 4MKIA 1T8UA 4O2RA 5GADl 2V55B 1B23P 1XCPA 3CNOA 4DLUA 2J3EA 3THYA 2J5XA 2RH5A 5FTJA 3ZDQA 2A5DA 1BMFD 2AFIE 1FUUA 1XRJA 2FDCA 4BLSA 1D2NA 2CVHA 1Z5ZA 3HP1A 4E07A 2OFWA 4LV5B 1GL7A 4LJ4A 3QF7A 2CDNA 2OV2A 3N5CA 4CIDA 1IXRC 2ZROA 2ZTSA 4IFEA 4DDVA 1F2UA 4Q18A 1GZSA 3SJAA 2XB2A 4LHXA 4C7OA 2LWIA 3GJ7A 4RCZA 3P32A 4EPXA 2XNDD 4FMBB 4XOIA 3H4MA 3FE2A 2Z83A 1QBKC 1EWQA 3ADBA 5FI1B 2IXEA 3GLIB 4ZI2A 3K53A 4BFUA 3NH6A 1VCOA 3CRW1 3TMKA 4V03A 1Z29A 2GAOA 3RLFA 5KNBA 4URZR 2AK2A 3P4YA 3RWMB 5J4VA 2C95A 2IYRA 2FNAA 2ZJBA 4LJ5A 4UJ3A 3A1UA 3IHWA 1KNXA 5TDHA 1YR9A 2MSDB 1G8HA 5BW8A 2W6ID 4FWTA 1Z6AA 4M2LA 1E2DA 3QI2A 2H7VA 4DSOA 3MJHA 1HE1C 3NDPA 1ONBA 2HCBA 3GJ6A 3B5JA 3TR5A 4RCYA 4JLAA 1NY5A 4HB3A 2FN4A 3PVSA 4RD1A 3W5IA 2NTYC 4BLPA 4DSUA 5AUNB 4TLDA 3H1TA 3A6PC 1SXJD 3EW9A 4H9GA 3ZVLA 2NGRA 1OFTA 4US2R 1E1RD 2B6HA 1E2NA 4AURA 2YKGA 4D0GA 1ZNXA 4HAYA 1E0AA 5B64A 3C41J 4RJLA 1L7VC 4YMSA 4C3ZA 5CIQA 1G19A 2GILA 3C8UA 1G17A 3IBGA 2P5TB 5TMPA 2MSCB 1TL7C 3ZQ6A 3VKHA 2ASEA 4IDHA 3B8HA 4NHOA 1YZNA 1DAKA 4D6PA 1OXTA 2D4HA 2FPKA 5CDFA 4FCTA 3RC3A 1RRFA 3EIQA 2YOFA 3L43A 1XBTA 2WVJA 1TX4B 4NONA 1FTSA 4TYQA 1VTKA 4HLDA 4NMMA 3OFND 1IM2A 1GL9B 5FTNA 2CLSA 2TMKA 1YHNA 2F1IA 1C4OA 2RGEA 3ADKA 4Z8YA 4GBMA 3OIUA 2YZ2A 3BFKA 4IW3B 1LY1A 1FW6A 1CR2A 1KK1A 1U0LA 1X3SA 2ODNA 5EQTA 1KIMA 2JIZD 2VLIA 1IBRA 3THXB 1JJVA 4GPTA 1E9SA 3GLHE 4E5UA 4WZ6A 1Z22A 2G83A 1VG9B 2HEIA 2RGXA 2ERYA 3BB4A 3U6KA 4PHTA 1MO6A 3AVQA 1XTIA 4EAQA 5FTKA 5DYIA 1E99A 1DO0A 5FFMA 4G1UC 3Q5DA 1NVVR 5GJVC 3AVUA 2V1XA 3GLIA 1Z0JA 5A4JA 1QF9A 4EJSC 1CIPA 2A7QA 4GSYA 1U81A 4LJ8A 4RKFA 3VMFA 1DPFA 2V7QA 3SNHA 2R9VA 1R8SA 2HYIC 1KY3A 2R6FA 2OZEA 4D82A 5JLJA 3K0EA 4GMXA 1UBFA 3IPYA 5JHGB 2JLVA 4ZDKA 1JALA 3MD0A 1W2GA 1S4QA 4P4SB 2QTVB 2QTHA 1P75A 4IEIA 1GVNB 2CL0X 1AIPA 3I3SR 3O47A 3X1XA 3RRMA 2CL7X 3NIBA 4E03A 2ZITA 1U8ZA 3C14C 2A9KA 5H8WA 4BLOA 4C4PA 1NBME 4PC3A 3NH9A 4FMCF 3ZH9B 3GPLA 3FPAA 4RD3A 5HE9A 4QOSA 2IX3A 3ZIAA 4BLTA 3U7HB 5HE8A 1LFDB 3B2EA 2CHQA 1NL3A 3QXHA 1VYVA 1GKYA 2WV9A 5KSOA 2BVNA 4A6PA 1CJTC 1G8GA 2BOVA 2P67A 4IVPA 2RHDA 4G5QA 1O3YA 1G291 1XB2A 5FPYA 4V02A 5JEDA 2Q21A 3ZQJA 1E2EA 2ZRMA 2QZ4A 2Z6VA 1SXJB 1FMJA 2F9LA 3KKNA 3OEED 1HH4A 4ZPXA 5FI0B 5J47A 4AY2A 2NMVA 3RS2A 1ANKA 4KV9A 1DG1G 1N5KA 4OI1A 4NL4H 1GG2A 5K8IA 2AHOA 1KI9A 3TQCA 4A8JC 3CNLA 4TZ0A 2D74A 1KNQA 2X2EA 4JJZA 3EPLA 3ONWA 5H68A 2X8AA 1W5TA 2FZLA 4TQAA 3QUSA 1KI4A 4GZMA 4D4KA 3AF0A 4XTRA 5K8TA 2FFBA 3FB4A 2G9NA 3SJBA 2ZE7A 1JPJA 2ZUDA 1U9IA 4KSCA 1KJWA 1G7CA 1N6RA 3B78A 2D2FA 1E2MA 3EARA 4JL6A 1ZIPA 1J70A 3KKQA 1AGPA 1PVOA 2OEPA 2ZRNA 5SZKB 4B48A 3OIYA 4W5WA 2QE7D 3T5GA 2JASA 4DLRA 3H0KA 2RGCA 5IRCD 3LX8A 2GJ9A 3EZ6A 4JLKA 1XX6A 2FFHA 2KWIA 3C4JA 4MRNA 4MGZR 3GFTA 4PO8A 3CB4A 3SYNA 1OLOA 2ZRPA 2IHYA 3GLFB 3THXA 2PCJA 2XAUA 4JBYA 4A15A 3SQXA 4DCNA 2PEZA 2IS1A 3W3AA 2GDJA 3FVQA 3KKOA 5KNCA 2BV3A 1YU9A 1BMFA 4PZYA 4HUQB 1E2JA 1VYUA 1Q44A 3S1AB 1UAAA 2C9CA 3P1JA 3Q85A 3QF4B 2JA1A 5KPDA 2O5VA 1NVXQ 1PUJA 3IIMA 4XWOA 4LYFA 3AUXA 5JECA 1X1SA 1COWD 3P4XA 2AR7A 3RNLA 2XTZA 2GJKA 1KI2A 4CZ2A 2PMKA 4JS0A 4ZIRB 1N6LA 4GOJA 3K8YA 2ZAMA 1S96A 5FTMA 4UXJA 2XNDA 1KO7A 4HDQB 4WXRA 2X2FA 4Q02A 1H8HD 1OW3B 3WHKA 4XVUA 1CXZA 1OV4A 4Q7JB 3EWSA 1BOFA 3RRZA 3AVWA 4JLMA 4QJ5A 2OCPA 3GQBA 4NYIQ 5KTYA 1EX6A 1L2TA 4HZUB 4P4SA 5DHFA 1RRCA 4LYHA 3QXSA 4PO1A 1BH2A 1FZQA 1XMJA 2Q0HA 4KBGA 4OK3A 421PA 4YMTA 3UANA 1G16A 5DLQC 3D7MA 3SE0A 1GIAA 2BCJQ 3VU9A 5AJZA 4KBFA 3UKDA 2QMUA 2W6IA 1R5NA 1JPNA 4QHSA 3MLEA 3HU2A 3VR3A 3MSXA 4QGGA 4NYMQ 3HU1A 2AK3A 3CRQA 2PX3A 3NBYC 4V0KA 4WXPA 4C0LA 5GJBA 3KQLA 5GJWC 3QKTA 4JLBA 2QTFA 4R71A 2CE7A 1P5ZB 1RIFA 5CM8B 1NSTA 2PEYA 1E2GA 3T1OA 4L4UA 2FV8A 4JLJA 4O25A 4WZAE 1SXJA 2VBCA 4IDQA 4DKXA 1ZUNB 2BIFA 5CYPA 3EC2A 5C18A 4ON9A 1G8PA 1KK0A 1SGWA 4MITA 1E1RA 1ZJ6A 4AKIA 1G4AE 1NRJB 4M21A 3SJZA 1T9HA 3WP0A 4AKEA 2I1VB 2B7BA 3REFA 4DRZA 4M1OA 5HCIA 1NJFA 3GCGA 3VFDA 4IOLA 4LOAA 2I4IA 4Q9LA 3VX4A 2H1LA 3CPJB 4D4LA 1F5NA 3EWAA 1CRQA 4TLEA 3BOSA 1Q1BA 5DHAA 3RRYA 5AJYA 4BFSA 3BJIC 1ZRHA 3R7WB 3LX5A 1MABB 5FBWB 3ZZTA 2ZYTX 4IJMA 2IYSA 1I4LD 1DAMA 3OFNA 3X1ZA 2R6AA 4A0GA 1WMSA 4B33A 2IYTA 2XITA 1NI3A 2WM9B 4B3DA 1RE0A 3AM1A 4GP6A 2B21A 4LUCA 5TARA 5JRJA 2ODBA 3M4YA 3GLFA 4PQFA 2K5UA 4QGHA 1HYQA 1JXOA 3B1WA 5FPTA 2RKOA 4M8NE 5TB5A 2KSQA 3BH6A 3I1FA 5LBIA 3GP8A 3NTUA 4HUQA 3AKCA 3F0TA 3S1AA 1NVWQ 4PX9A 5IHPA 3QF4A 2VHTA 4HB2A 2QAGC 4OHVA 2EW1A 1W7AA 5GVSA 3B1XA 5FR1A 4JMPA 3SFZA 1W47A 4ZDIA 2E87A 2HXYA 1WBDA 3UK6A 1WRBA 4ZIRA 4PSVA 5LB2A 1GNPA 2WWWA 4TLAA 5DGXA 1OSNA 1VKJA 3I8SA 2QQEA 4QKQA 1FOEB 1GP2A 1T0HB 4NCNA 1R4AA 5CK5A 1KYIA 1ZYUA 2GEVA 2NPIA 3DKVA 4NCIA 1BS1A 1E2QA 3MUFA 3WHLA 621PA 2GAAA 4I1VA 4U00A 1LNZA 5CJPA 4UKDA 2CHGA 2VHUA 4PR0A 1OB5A 2ZS7A 4HZUA 4QBGB 4URVR 3MG9A 1E6CA 5TXGA 1DAHA 1XTSA 2B8WA 2C77A 3AGPA 3EIHA 3QKSB 3QG5A 4PSAA 3PENA 2G1KA 2GA8A 1HTWA 4V0ME 4FD2A 3B1VA 4A2PA 1N6OA 3TNFA 1P4SA 4PFSA 2ODEA 2HF8A 4JLOA 3CF6R 3DEFA 4GZLA 1QDEA 1WF3A 2Q9BA 4NKRA 3V4FA 4DCUA 5FUVA 2HJVA 2WWXA 2GJSA 3MWJA 3LV8A 2D7CA 1CP2A 5FOWA 2IWHA 1SHKA 5KOYA 2Y8EA 2GNOA 2GVDC 1F48A 1VCMA 2BJWA 3AH8A 2QMHA 2OHFA 2ZRBA 4B3CA 1IN5A 1DO2A 4JIMA 4W5JA 3RHFA 1ZD9A 3EA5A 4G3XA 3Q72A 5KDDA 4XSGA 5EXPA 3ZD7A 2WOJA 1Z08A 3TIFA 2CJWB 4P3YA 4A2QA 6Q21A 2FF7A 1T8TA 3OEEA 4TZ6A 5E95A 1XDBA 2ZRDA 4EPRA 2QRZA 2BKUA 3IIKA 1LF0A 1OKKA 3B1YA 4G01B 1AQYA 2H8KA 2VYFA 4TMWA 1AM4D 2WOOA 1TQ4A 4C0KA 1MH1A 3AQ4A 2F6RA 3FOZA 4XWAA 2QY9A 1P9NA 1XCMA 2HYDA 1VDZA 1WB9A 3AVPA 4URYR 1MABA 1W4AA 4E22A 4GP7A 2FGJA 3AF2A 5AUQA 3SYKA 5EXXA 3KZ1E 3TRFA 2QA5A 2OCYC 3BGWA 3I73A 5FPSA 4O0MA 3GLGE 3HPRA 3C5CA 1GUAA 4F4CA 4FXPA 1T4GA 2N46A 4CGZA 2QBYB 4P4TA 1N25A 4PXAA 1CLUA 1N6KA 1P2UA 2QE7A 2WJYA 3KJHA 4N0EA 5HCNA 5JEEA 1Q22A 3KJIA 3GEEA 5KSZA 3BFVA 4RD2A 1K6MA 1P9RA 1J99A 3U3JA 4DHEA 2F43B 1K5DA 1OFIA 4GL2A 2WKPA 1WE2A 5BWMA 4FMCB 5LDDC 2IWRA 1Z0DA 1QG2A 2WHXA 3HWSA 1WCV1 5EP4A 3AF4A 4Q9IA 1SVMA 4LYAA 3U3RA 2W2TA 1EFRD 3TW4A 3QNUA 1ESNA 1IJEA 1SVOA 2XB4A 1H8EA 4HLQB 2JLUA 3WRXC 1R0ZA 1VHLA 1IN4A 4GNKA 1G20E 4ACAA 3THYB 2QN6A 1ZM4A 3A37A 5CJ2A 3VQTA 2QG6A 4PTLA 3NKVA 1E9AA 2EYUA 3K1JA 3T1VA 4Q4JB 1GSIA 2WZQA 4QM7A 3BE4A 2GHIA 1RFLA 3P26A 4Q4AB 4IOKA 5A0FA 3X1DA 1UKVY 4M1MA 1H8HA 3L8YA 1NLZA 1SVIA 4LJAA 4DCVA 2ZS8A 1RJ9B 5LD2B 1II0A 3RSOA 1M34E 2ZUBA 3WYGA 3QKSA 5BQ5A 2C9YA 2BJVA 5FL7D 1QHYA 4JLDA 2UZIR 5SZIA 4TWZA 3KFXA 4Q1FA 4TMVA 3TSWA 1E9EA 1E98A 3DVLA 3ZS9A 1XTJA 3DM5A 4RFSB 4EFLA 1P6XA 2J0VA 4POAA 4QFMA 2ZR9A 4E09A 4NBSA 3DMNA 4CW7A 1N6HA 4S2EA 4EPWA 3V00A 4Q5IA 3OAAD 4LC0A 4F93B 2ZYVX 2C99A 3VKGA 4QG7A 1E2KA 4RD4A 3L0OA 4PPNA 2HUPA 3LFUA 1N6IA 1KAGA 3IQXA 4D4JA 3OF5A 2IUTA 2ZI9A 1Y63A 4DCSA 1JR3E 4YQFA 3U3OA 2OE2A 2CLCX 4NTZA 3PUWA 2CJWA 4LBWA 4Q03A 2IYVA 4AIIA 3ZD6A 1TAGA 2ZJYA 2FH5B 1UPTA 2XJ9A 1Z83A 3BBPA 1CJVC 2AD5A 4ZDJA 4CEIB 2LCFA 2V3CC 4EIWA 4EFMA 1U0JA 1SHZA 3O8RA 3DZ8A 4UNQA 4Z1MD 2ZSDA 4IVQA 2ODWA 4DC9A 2LKDA 2ZM5A 2WBLC 1OXVA 2ORIA 4OKSA 2BDTA 3AF3A 1R6BX 2G6BA 4TLCA 4CT5A 1KZ7B 4DDTA 1KTVA 2JJ8A 4V0NA 3LY5A 1UDWA 5FBLB 1DARA 1D6JA 5DISB 4BRUA 1W46A 5FUYA 1RVDA 4MKGA 3Q7QA 1CKEA 2C2HA 2ZIAA 4IDOA 5M04A 2P6UA 3HR7A 2DWQA 2IXGA 3QPUA 4Q7MB 4QNMA 2G3YA 4BGDA 2F43A 1FNNA 2RHMA 3W34A 5FBVB 3TH5A 3SHFA 1E0SA 2PT5A 5LB4A 2NO0A 4OQFA 2QU8A 1E9FA 4YLGA 1N0VC 3BXZA 2DPXA 4IHQA 2OFXA 1TUIA 1GILA 2PJZA 4JVMA 4AYWA 2OLKA 2FEMA 2CXXA 2QT0A 4IVRA 5DNYB 2E9SA 1E2FA 5L3RA 1G3UA 3QY0A 3T1TA 2OO7A 3CX6A 4Q4JA 5JRZA 3G5UA 3PEWA 2EFEB 1Z63A 1W36D 2F3TA 4Q4AA 4LI0A 5FOSA 4DUGD 5DSZA 5JMTA 3A4NA 1RJ9A 3ETLA 5SZJA 4DCTA 1TF2A 1XJCA 1R0XA 2C96A 3C15C 1U8AA 2EFDB 5HKKD 3CKLA 4P0TA 1OXSC 2REXB 1QG4A 1QVRA 3EIEA 2QP3A 3K09C 3PEVA 4Q1BA 1G3QA 4RFVA 3TKLA 2FPLA 1OH6A 4RFSA 2PJRA 3T15A 2FPMA 2REOA 2W6JD 2ZPTX 2ZJAA 3A4LA 3MFYA 2CE2X 3ND8A 5EXSA 3VR6A 4ZI3A 2ATVA 2IYLD 2FMXA 3LH5A 2GBLC 2E1RA 5FPHA 4KFTA 3DL0A 4MGKR 3KUCA 1OIWA 1XJ0A 4KVAA 2F3RA 3KXIA 2ZE8A 4PAQA 1OH8A 3CH5A 3GFPA 1YZUA 4WAUA 1NG1A 4A1FA 2A5GA 2PMDA 4XD7A 3AVTA 2NQ2C 2ORWA 3WP1B 4DLTA 1UEJA 2R65A 1Z2AA 3K0FB 1MKYA 4CEIA 3UPUA 4KO8A 2J0SA 4A6XA 3A58B 2G1JA 1BKDR 3KX2A 3JVUA 4MYHA 2HT1A 4U5XA 3E5HA 1X86B 1W0JD 4MH0R 5J4YA 3VR5A 4DSNA 2VP5A 3T5DA 5P21A 1G64A 4DLSA 3B60A 1HV8A 1KI3A 1YR8A 4NYIR 4XJXA 3LNCA 3GJ3A 1AN0A 1ELOA 1D9ZA 1ZW6A 1EFTA 1FQJA 2ZJ8A 1XEFA 4LHWA 2ZYUX 4PSKA 3X2SA 1LF5A 4LC1A 2WPDD 4K8OA 2VTKA 4C0BA 1VIAA 2ZI4A 1OB2A 2ONKA 1Z47A 4NYMR 3BB1A 4MQBA 2IT1A 4LY6A 4DLWA 5HR5A 4D0LB 4JLPA 2ZE6A 5F2EA 1W36C 2BCGY 2DYKA 2H57A 2ZANA 2NZ8A 4QBHA 1G6HA 1FPMA 2R8RA 1M7GA 1T3HA 5EZ5A 2AWOA 2IF2A 4G5SA 1EFRA 2YOGA 4WW0A 4RSGA 1KOFA 1ZBDA 2GTPA 1QHXA 5HTKA 2ZRFA 3I4LA 4QHYA 4Q1CA 4JBWA 3DHWC 2BMDA 1N2CE 4Q21A 2XX3A 2IS4A 3Q9LA 3A1TA 5ANRB 4KVGA 1G21E 3EA0A 3NC1C 2EFCB 3LW7A 5F9FA 1T3LA 3LBHA 4G5GA 3CF0A 2EQBA 2UZ3A 3HR8A 4ESHA 4OHXA 3OESA 4OHWA 2OAQ1 4ILEA 1SQ5A 4HAVA 1DADA 2VHJA 3OEHD 3DM9B 3LD9A 2IS6A 2RGNC 2QAJA 5H1YA 5EXTA 3QQ5A 1N6PA 4H1VA 4MRPA 5FL7A 2ONJA 1L8QA 1XEWX 1X6VA 1XZPA 1IXSB 2O8FB 2FZ4A 3CZPA 3RVBA 3FHOA 1CEEA 3CR7A 2VP9A 2F1JA 2IS2A 2Z4SA 4KODA 2JDIA 1G3IA 2GESA 3OAAA 3PV0A 4ITRC 4WVFA 5JWRA 821PA 4LV8B 4AKGA 4LX0A 4DWJA 4A82A 4B6EA 2GXQA 3VU9B 4A36A 4Q9KA 2R2AA 2ZE5A 4EJSB 2AKYA 1GWNA 3KQNA 2O8EB 3K9LA 1EK0A 3K0FA 5JJLA 1EFCA 4LHYA 4BFWA 1S3GA 3AP3A 3L0SA 1NIPA 1R8QA 4NH0A 3O8CA 2FEOA 4PC1A 1XPOA 2J7PD 3ZVMA 1GNRA 4CF7A 4Z1MA 2C8VA 3D8BA 5C2JB 2P5SA 1NP6A 2IYUA 1TEXA 2QP4A 3LVRE 2GXAA 1SKYE 2JLYA 3CM0A 2BM0A 5CDFE 2FSHA 3VNUA 2QMEA 1KDPA 3K0AB 2ATXA 1XWIA 2P3SA 3NBXX 3NBZC 1MV5A 2RCNA 5KPJA 1UEIA 1L4UA 5BN5A 1S9DA 3U6BA 1X8LA 1HUQA 4IXMA 1D2EA 1ZNYA 2MMGA 2OM2A 2R6DA 3GJ0A 3Q3JB 4GFDA 4R2IA 5IK2D 4QJ3A 1AKYA 1F2TB 1G5TA 1YZGA 4WBSA 3W6OA 5CYOA 2JLXA 5F3WB 4KYUA 4I4LA 1W4RA 4DIDA 1JR3D 1RZ3A 2EWWA 1KAOA 2Z5FA 1IY0A 3AKEA 3CZQA 3SOPA 1CU1A 4AI6A 5FBRB 1JAIA 2ECKA 4LBVA 4DLXA 1R7RA 1M7HA 4MDEA 4QNRA 4A8JB 3ZS8A 1LV7A 2QP9X 5BXQC 3ICQB 5KYKA 2O8CB 3W8NA 2O8DB 1KK3A 1XMVA 1P72A 2FFAA 5DI3A 3R9WA 4EKDA 1E96A 2H5EA 4US0R 4U7DA 1ZIOA 1RRGA 2YWEA 2JEOA 4V0OA 3P20A 5JZVA 2W83A 5BN4A 4MGIR 4DB4A 1IQPA 4FINA 4B73A 1TQ6A 3G82C 3PCRB 1N6NA 4N1AA 4PZLA 5IDVA 3GLIE 1P7CA 4HUTA 2QRNA 3DKPA 1Q1ZA 1M1YE 4JL5A 1J8YF 2WWGA 4KAXA 2NO1A 4NDZA 5G53C 1G7TA 3GMTA 3N70A 3RS3A 3UMRA 4XWKA 2BBWA 2QPAA 4Q19A 1LVGA 2XJ4A 1R5OA 5HKKA 3EPJA 4AYTA 4X8LA 1A82A 1DBSA 1IN6A 1AS2A 3CW2A 3FMFA 1U8YA 1SKQA 4I81A 5HZHA 4CEHB 2O8FA 3U44B 1R5BA 1Z6YA 5DIFA 1XEXB 1XMSA 4TYWA 2KBFA 3CWQA 3UXMA 3TJZA 1P2TA 2H16A 3LVQE 2DCUA 2W6JA 3BH7A 2JLZA 5FOXA 4TMKA 1G7SA 1TF5A 4B6FA 5C46F 3ZJYA 3SU8A 1ZVQA 4CT4B 1KY2A 1KI7A 1VPLA 3C16C 4TL6A 4C2UA 3PG5A 3T1QA 4TQ9A 1TU4A 5EP2A 1ZNZA 2XTMA 3K70C 2DFTA 5G3ZA 2DFKB 3I61A 5EUQB 4LJYA 4EJSA 3WMGA 2O8EA 1DELA 5LPNA 1W48A 2PLRA 2ZREA 1XEWY 4PPGA 2CCKA 2WSSD 4Q1AA 4TMZA 4LHVA 5EE1A 2C03A 4WA7A 2WJJA 5TY0A 3KQKA 3U5ZB 3CH4B 3PUXA 3WYFA 4ZV4A 4A2WA 1X1RA 1LTQA 1NMXA 2GZDA 2OBLA 2W2XA 1T5LA 2ZSBA 1OH5A 1W0JA 4Z8XA 1EFUA 1ZU4A 4PHFA 1KJZA 4N3NA 3M6AA 2ZXUA 4MUBA 1HQYE 4JVNA 1KO4A 1W0KD 2DFLA 2ZJOA 4NP6A 2IK8A 3W6PA 1OH7A 4XSHA 1TMKA 4F38A 3K0AA 4KXFB 2QM8A 1YZLA 2FOLA 4B47A 2JJ1D 1W5SA 2FJUA 4IOJA 3IIJA 3QENA 4O3MA 2QENA 4LBZA 1A1VA 4Q1DA 1E0KA 4PO9A 5G41A 2VRWA 3FFAA 3KB2A 1VHTA 2BM1A 1F2TA 2G88A 1J90A 5B57C 2OXRA 4OI0A 1Z2CA 3K9NA 2IYWA 3FMPB 2ZS9A 3B1ZA 4ACBA 4AG6A 2PT7A 3NG1A 4A8JA 4R7ZA 4HLUC 4DZZA 2IC5A 4GT1A 4DBLC 3W3ZB 2R62A 3SBDA 2UVQA 3E1SA 3SEAA 2O8CA 2O8DA 4KLZA 3K0SA 3B9QA 2A78A 5JWHA 3U2QA 2F55A 4CDGA 3ASYA 4HI0E 2L0XA 2JIZA 1KDTA 4AWXA 5H70A 2IXFA 2ZQ5A 4XTCS 4M1TA 2FE4A 4TN1A 4FW9A 2O0JA 2V6IA 2HDNB 1KSHA 1JQLB 1RPZA 4OHYA 2WAXA 1G8YA 1WBBA 5DN6D 3K0CC 4JZKA 2YC4C 1DVRA 4TL8A 3OE7D 1MRSA 4DSTA 4Q7LA 4RD0A 4ZCMA 2P2LA 3CX8A 3I5XA 5BN3A 5CK4A 5FPKA 3M0EA 1R10A 2OCAA 3AV0B 4L9WA 4A92A 1BIFA 1XXHB 4BRWA 3LLMA 3WBKA 1JJ7A 1OF1A 1FFHA 1CR0A 1E2HA 4CEHA 4K81B 4QBIA 1CULC 3VR1A 1KSFX 3U44A 1XEXA 4AG5A 1DAGA 4UJ5A 4D2IA 4RKEA 4BFVA 3LQQA 2XXAB 3EPHA 2FFQA 4KYIB 2QAGB 4TT3D 4AKHA 1W2HA 4DEYA 5CLLA 1A5TA 3KDSE 4QGFA 3QKRA 4C2TA 4EUNA 2GK6A 2WWFA 2ZR0A 3GJ4A 2IUUA 3MJRA 4RZUA 4ZO4A 3KFVA 3QPVA 5AJXA 2JAQA 1B0UA 1KO1A 3VR4A 1CJUC 4LPKA 1QZXA 1CJMA 1IN7A 1EG7A 2ZVQX 2P6RA 2VP6A 1SXJE 5EZ6B 3RRNA 2WKRA 2IEYA 4OBEA 2O8BB 2FA9A 3F5FA 3B7GA 3PUVA 3QEJA 3AB3A 721PA 2F9MA 1JR6A 2BHRA 3EXAA 3GEIA 3TUJC 3WBJA 1U99A 1XPRA 1XMIA 4YDSA 2Q9AA 4C30A 4U02A 4DDWA 2QI9C 4OQMA 2WMNB 3RAPR 1JEEA 3I62A 4TYNA 2J7PA 3D3QA 1E2IA 3MWYW 3KTAB 1S8FA 2VL7A 2ZU6A 3UG6A 4GDFA 2WTUA 3B6EA 3KB1A 4L5BA 1E69A 3H2YA 2V4ZA 4I1UA 1D2MA 4Q4HB 1NG9A 1W49A 2CBZA 2AL7A 3PFIA 2NO9A 4LYJA 1EWRA 2WIAA 1KKMA 3L8ZA 4LZZA 4CYMA 4ZKDA 2BWJA 4RY2A 5SZHB 2WIBA 3W9YA 3KXKA 4D80A 3BRWD 1PLLA 2PBRA 5FUWA 2O0KA 4C0HA 1VMAA 5IK2A 3QBVA 5J4HA 4QJ4A 1Z6TA 3PEUA 1HE8B 2AKAB 4HAXA 1NBMD 1QRAA 1G3MA 2VHQA 3GLFE 1ZCBA 1G1MA 4WOPA 1FTNA 4ZCLA 1JR3A 2AWNA 3UWOA 4F91B 3QVUA 4UXHA 5B30A 1P9WA 1XFAA 1J8MF 1T91A 3BK7A 3BD9A 5KU1A 5B58C 1E2PA 1NLFA 1UFQA 2H17A 1ZNWA 1ZD1A 2YNMA 3A8TA 2DR3A 1OXXK 4O2LA 5JS7A 4GMDA 1XD8A 2YWHA 3IEVA 1S1CA 2A2ZA 3A1SA 3LXRA 3DZDA 3H86A 3QG1A 1N5IA 3F3YA 1ETUA 1E3MA 4ASUD 3FMOB 1A2BA 4URXR 1ZMXA 4IEEA 2NPFA 2J41A 1KMQA 2YC2C 1Z07A 5TVKA 4MYTA 1TTTA 4GRAA 1Z0FA 4QHTA 3LBNA 4URUR 3I5YA 1R0YA 4JSTA 4BE7B 3QBTA 1COWA 3DOEA 5JBQA 2ZRCA 1XXHA 1AQUA 2CNWD 4I1SA 2YJTD 1II8A 3ADDA 3CNNA 2Q9CA 2OILA 4I1OA 3LO5A 3SN6A 2ZETA 2IA5A 1OE0A 1Q3TA 1ZC4A 1AJEA 2QGNA 2XXAA 4JT2A 1J2JA 3FYHA 1FP6A 2W00A 4BZPA 1JBKA 2WAYA 3GFOA 2WWIA 2QAGA 2F1RA 5FOTA 2OAP1 3EZ9A 1K8RA 2HT6A 1SVLA 2VP0A 4YMVA 3FHCB 2WWHA 1P2VA 3BFXA 3Q8XB 3FDIA 2BMFA 1I2DA 4YDHB 4IDNA 4IOMA 5KHOC 1VG8A 2GF0A 1DG3A 1Q1QA 4ZKEA 2OSBA 4LSGA 5KO2A 4TL7A 4C0SA 5AK0A 2XZLA 1Q12A 2J9RA 3B13B 1V5WA 5J4KA 3A1VA 3SC3A 5F98A 5EJEA 1OIXA 1S2MA 1F3OA 3WNCA 3GLHB 2O8BA 2PL3A 4EQ6B 4P33A 1MR3F 2WSSA 3OIWA 2ORVA 3PUYA 2B7CA 4C0AC 3CUEF 1I2MA 1UM8A 3OZXA 4TTPA 5E7IA 5FBQB 5L3SA 1FMLA 1F60A 1YKSA 2V7QD 3BAFA 4FN5A 2O52A 4II7A 5JJKA 1C1YA 4M9SA 1O87A 1OPXA 3MWLA 3KQHA 2OLJA 8OHMA 3KTAA 1BYUA 2R6GA 4Q48A 3PJRA 1Z6XA 1YR6A 2VHCA 2QMOA 3KQUA 5EUMA 3KXLA 3TGPA 1LB1B 1HEIA 3SS8A 3QJYA 4Q4HA 2BKEA 1S9HA 2JJ1A 4PQYA 3LDAA 4W5HA 2V8OA 2DWOA 3FFBA 4DT1B 4JL8A 5J4LA 3CO5A 2ZSEA 5GVRA 2J1LA 1LS1A 4MRVA 3IBYA 2VP4A 5KDOA 2Q3MA 4LBYA 3THWB 1A2KC 5EE5B 5F9HA 3IKJA 3NDBB 3DDCA 4FCWA 4LJ6A 5JJIA 3EZ2A 1QHIA 3D31A 2AX4A 2XSZD 1IHUA 5D3MA 4F4IA 4PQRA 1QHHA 2RGAA 4A4DA 4BASA 3WXMA 1W4BA 2FWRA 1Y3AA 1ZAKA 3AVVA 4CRWB 5JCZA 4M1WA 2ZYWX 1IOZA 1HQCA 3NBFA 4M9ZA 4OJKA 4B35A 2YV5A 4IXNA 4BFTA 4FCVA 1D5CA 1XNJA 4EPVA 4MGYR 2GVZC 4KITB 2GCNA 1X8KA 3QEOA 2D7DA 5KSYA 3ASZA 4LJ9A 4Q66C 1Q1EA 5DN6A 2CHVA 4JLNA 1T0JB 1N5LA 1AK2A 4KFUA 2HV8A 4DVGA 1GDDA 1MO3A 3GEHA 1Q21A 5D3QA 1AGRA 2IYZA 3D6TB 5L3QB 4X8HA 3U4QB 1R2QA 2GJAA 5FR2A 4C0JA 5IT5A 4TMXA 5IF9A 2YWFA 4ARZB 3TVTA 3SJCA 1KKLA 2N42A 1G6OA 3JZAA 1VG0B 3VAAA 4TT3A 2BBOA 2VH5R 3IGFA 3TBKA 4DLZA 5CITA 1FQKA 1G18A 2FU5C 3RS4A 3LXXA 4XIGS 3K9GA 4BEJA 4BUJA 2V1UA 1CRPA 4NYJQ 1VCNA 4ERNA 1E94E 2JATA 4Q47A 1G9XA 2PZFA 2DHRA 3H84A 2GKSA 3GLHA 4LDJA 5DH9A 4TL9A 4EQ6A 1YZTA 2C04A 4TYYA 3W90A 1II9A 2QSYA 5EE3A 4DLVA 4HB0A 4YMUA 2OG2A 3VX3A 2ZRJA 3RC8A 3RWOA 3UG7A 1Z6GA 4BEBA 3RSLA 3U3MA 4LPSA 3U61B 1NKTA 3EZFA 1YQTA 4W9MC 4B34A 2ZRIA 5J40A 3MMPA 521PA 4KLNA 2DWPA 3T34A 4B32A 3WNBA 2BC9A 2RGGA 1GKIA 3CONA 2ERXA 5E7MA 1ZM3A 2F1HA 1UKYA 5EE0A 3EAQA 2VSXA 3IPXA 4DT1A 1RKBA 1LS6A 2J0QA 2P65A 3FGNA 5AJWA 2PLFA 3AGQA 5AJVB 1ESMA 1CR4A 4GI7A 1OYYA 1S1MA 4JVLA 1PZNA 4TSFD 4Q9HA 4M9XA 4A0RA 3THWA 1Z0KA 2JLWA 4W7SA 2DB3A 4PC7A 1G5PA 1NBMA 1AS3A 4KI0A 4Q7KA
chains in the Genus database with same CATH superfamily
2B4YA 3CIOA 3KOUA 3AUUA 1R66A 3ACBA 3NWEA 3FTNA 5DEOA 1NR7A 4H3KB 4YV1A 4YMWA 1ZSVA 3FRJA 2AMLA 4G1EB 2QQ0A 2FXIA 3RD5A 4BDSA 3WL4A 2AVDA 2PIDA 3CSSA 4B8YA 5C80A 4COKA 5IDQA 1GL6A 1KEUA 3UH1A 4D9FA 3FHJA 4YC7A 4QU8A 1SULA 3IB3A 4WZAB 3E1GA 5BQOA 1T9GS 3FSGD 1TECE 3GGDA 1QCDA 4ASUA 1YA4A 5HSGA 4OI4A 1QS0A 3L4BC 5KNDH 3INGA 4PXSA 4EO4A 4YRSA 5K6AC 1VECA 4PRLA 3ZVNA 1TDJA 4BNXA 5A5GA 4N12A 1XU4A 2BPOA 1ABFA 2H31A 4O2AF 5ITZB 1UBGA 3RHTA 3EXHC 1UFOA 3FWZA 2I1QA 4NE2A 1FRZA 2QQFA 3LUDA 2OXIA 4RX1A 3ZV5A 3H2SA 4LTNA 3CWCA 2X9QA 3NANA 4DUZB 3SVZA 3SOZA 2ZIUB 3KPWA 1J2YA 2Y0BA 1N3YA 1OXUA 3CA8A 3DLIA 1T6XA 3GJ8A 2VKQA 1G8SA 4GQAA 4HNGA 4MYRA 4NNJA 5F5NA 3WMXA 1R74A 3LOPA 4OLAA 3NBQA 1ENOA 1TF7A 1US8A 4MAAA 5CBPB 2GTHA 3LQRA 2AN3A 1JNYA 1SVWA 1RQRA 1XCLA 3Q3GE 4LS3A 4ARZA 2NACA 4FZ3A 5CB8A 2Z30A 3N0TA 5J2UF 2DQYA 2JRCA 3GDGA 1N1GA 3IP6A 2C9OA 3ZZ0A 5E6UA 2JKZA 5IT4A 4OLJA 4KX5A 3QVJA 5KTMA 3LP5A 4UQOA 1L0BA 4J7CA 1OHHD 2C2MA 1S89A 1RHUA 1B8VA 1YR7A 4QL3A 4ZAYA 4ZEXA 1CF4A 1XPUA 4MVJA 3KYDB 4NQRA 2TMDA 4XH9B 4ZCSA 2I9KA 3RYIB 3HYRA 2H4YA 4I5FA 3E2PA 3EMKA 4UNNA 3V9PA 4HQ6A 3SC6A 3N2NA 1NMZA 4MCHA 4L0DA 5L8VA 3ROZA 4HLCA 3VC3A 1C9NA 5K3BA 2UYCA 1ZEJA 4AW9A 3N2EA 4DIEA 1Q84A 2B5WA 3ETDA 3M4ZA 5H0IA 1A8SA 1L7BA 1Z4OA 2QXYA 1OD6A 4LRYA 1YACA 1X7XA 2R4QA 2VJOA 5A3VA 3TI7A 3E7FA 3IB6A 1SH7A 3ZJVA 1WG8A 4G0PA 3THOA 1R88A 4KIGA 4LGCA 1VPVA 2P2CA 4CM4A 3EXEB 3K09A 4X9XA 1WMEA 1ZUHA 3M9WA 1UFRA 4CETA 3GT3A 2WE8A 4HWOA 1HDEA 5NULA 2XT6A 4JVSB 2J6HA 3Q6MA 1M2FA 1G8AA 2BFFA 3MWKA 2NIPA 3LBFA 4PGFA 3O8NA 3AI2A 1RRPA 3H9JA 2JBAA 1DQSA 4RXTA 5JTUA 4ZDWA 2MMCA 3EG5A 3HJHA 1SEVA 1ML3A 1TTPB 4N5NA 1YL7A 3MTEA 1UC5B 1BZYA 2JJQA 1FB5A 2CHEA 2I33A 4ESEA 2GM4A 3NKFA 1KE2A 1DQRA 1Y3IA 1HG0A 1NV8A 4HRVA 3LTNC 2Y1CA 2ZZKA 4GEKA 1GXSB 2X14A 4R6XA 2XRZA 2GASA 1H42A 1W30A 3BULA 5CVEA 4OQZA 1UOQA 3BHMA 2ZIXA 3WI7A 4L5CA 4BKQA 4ZMSA 2EFHB 4BRZA 4CKEA 4EATA 1Y1LA 2BCEA 2RHRA 4FI3C 1EGAA 3TLAA 5KSPA 4JKOA 5JQGF 3MBIA 5E4JA 3DW1X 3ESDA 3KV3O 4OQNA 2C84A 3GLSA 4AO7A 2H06A 4Q01A 3ZCQA 4F5EA 3PWKA 1BDBA 1T6NA 5EIFA 5JHHB 5KI6A 4M0PA 4KWTA 2BSXA 2J0UB 3K0BA 1EAMA 3VISA 4EHNA 2O3SA 2XSZA 3ICWA 1PL0A 2WJIA 1QNFA 5EZYF 1MHTA 4JENA 2C4MA 5ILOA 5EMLA 5CM9C 1CJSA 5EHNA 2YZKA 3ONEA 3PP8A 4OJQA 2ZVPX 1T8SA 3ONFA 5JZBA 1UKZA 1NFRA 4YTEA 1OKKD 2DJIA 3DBLA 4LOLA 5FLKA 5GGYA 5BYKA 4I9GA 5DX8A 1BSVA 2CLDX 2X5JO 2G0NA 4HLNA 4MYSA 1ES9A 3R40A 1DAOA 4RD6A 5E7JA 4P80A 3CCFA 2GRUA 2IYXA 1NJGA 2F3QA 2KE5A 5TF4A 2P9YA 3G8YA 4HYTA 2CCGA 5D6OA 3QM1A 3ZCVA 3Q2KA 5LZ4A 1ZD3A 3G0IA 1J25A 3RKRA 5THKA 1EUCA 1RYNA 1R4ZA 3IEPA 5I5EA 2W4IA 2R1TA 5LZ8A 1L4YA 5CGQB 3TIIA 2OCBA 4H08A 1BWRA 1WMAA 4NS1A 3S8MA 4CGYA 2MT9A 4HYQA 4Y1RB 3PUIA 4UTOA 1L4MA 2NSJA 2BKAA 4W8HA 3WZLA 4LV6A 3F6PA 4KIWA 3RVLA 1PF7E 1FL9A 1AC5A 1PNQA 4NBTA 1IXZA 1CTQA 2D1FA 1U6JA 2FSUA 3E9YA 3PXBA 4KMRA 1OYWA 4WXEA 5FNVF 4AQDA 4UTNA 3LAWA 1H85A 2C29D 2CJFA 1XWFA 5TMDA 4DQDA 1JEOA 1EXWA 4QAQA 4U2CA 1YCHA 4YJKA 2ZI6A 1L1QA 3SYTA 2CCJA 2K2WA 3BWDD 4TLBA 2A5LA 3HYLA 4IDGA 4II2A 3OIVA 1B2LA 3UAGA 4EHDA 4JN6B 5CLQA 1ZK4A 4JUAA 1R00A 3C1UA 1CUGA 1YI0A 3PI7A 1QHFA 2ORYA 1WVGA 3MT7A 3P27A 4QDJA 4BE9A 1F12A 2OP1A 1RTKA 2XY4A 4QDOA 5ICCA 4KCGA 2I3ZA 1Z38A 5ELLA 4WL0A 2M1XA 5AVWA 1ONSA 1HRKA 3HXPA 3PEEA 2XNCA 3WB2A 2XUGA 4F12A 2IZ0A 2HDOA 4HGNA 1XZLA 1XL0A 3HKDB 4MWEA 4UUNA 2GUWA 3CCCA 2D2EA 3B8EA 2AUTA 4H0CA 4YMLA 1ZWLA 4NJMB 2PX0A 3S2YA 4LRWA 1XZQA 1P0PA 4IJQA 4J76A 4RA9A 4C0HA 3FZNA 4EG4A 2BHSA 2NZXA 1KWKA 1PWXA 4YP1A 1KDRA 4FIDA 5F2OA 2OA0A 4ZICA 1YRBA 1KMCA 3OSZA 3EBLA 3EDRA 4X92A 5CB6A 1U2EA 2WYWA 1EIZA 4IQGA 2ANBA 4C05A 1TVCA 2NO7A 2HTEA 3GD7A 4HDRA 2EAUA 4KQJA 2ACEA 3ZYZA 4DABA 4ECEA 1QVWA 3GAFA 4ZYTA 1E9CA 1RWNA 1JAHA 2I80A 4XVRA 1DRKA 1ZGCA 2JI9A 3DXFA 3F78A 4NBWA 2N3ZA 3NUZA 1BEEA 1JQJC 3TI9A 2EF1A 4TV9A 5DLPA 3VHLB 1KQ3A 3I9JA 1LSSA 4EMTA 5IPFA 4PSUA 3A7EA 3EY9A 5BMVB 4XVQA 1M34B 3OOWA 3M4XA 3HDTA 3F8TA 4L9RA 5EP3A 5DTJA 1HNZB 1WUYA 2Y1KA 4TTIA 1ZJ4A 3V1MA 3BMQA 3C7CB 1M7BA 3T06B 2X1HA 3RIMA 4CF5A 1XLTC 4QOGA 3VTZA 5I4BA 1P31A 4DQXA 4N9QA 5FA5A 4RS4A 1FRQA 3JR3A 3HYTA 3FCSB 3HDVA 1N77A 5JZMA 3BGVA 4PANA 1Y4SA 2F59A 5ITVA 5D7BA 5K8CA 4E33A 4PZCA 1ZQ1A 1BXRA 2K6GA 1Q3HA 3FUXA 2W2KB 4GOXA 3WL8A 4UFPA 5JBIA 3HP7A 3AZPA 5F77A 2HXSA 4OYHA 4F5ZA 5K2OA 1YU6A 1M2OB 5BR8B 4UREA 1GPLA 4KHPB 3D4BA 1B42A 2BZ0A 4K9KA 4NABA 1U2ZA 4H16A 1DC7A 1GZ7A 5E9QA 4EY5A 5MGBA 3AFNA 2FG5A 2I29A 4UHEA 3IKVA 1CS0A 5C4GB 4BLWA 3SFVA 2A1UB 2WP0A 2CEAA 3KKKA 5AKEA 1FYVA 4MYUA 1I3CA 1DDIA 1NZDA 4LA4A 5BNIA 2W58A 4HAWA 5FL3A 2CK3D 4ZVQA 1LUAA 3JWJA 1I7PA 1EVEA 2MSEB 3NHAA 3Q9SA 1GM5A 2X0EA 4P0PB 5B3JA 5JUWA 3IEIA 4GXRA 1Q7EA 3L1UA 3P9NA 3NCTA 2ZXEA 4G36A 4ITUA 3DONA 5LA6F 1QRRA 5GIPE 3C7AA 4FT2A 3EDYA 1T0PA 2I66A 4DL9A 4UNSA 1DAIA 5IARA 2C5LA 3MRTA 1QYWA 4JR1A 1PHRA 2LPMA 3EIXA 4LYDA 2HCRA 3R3HA 1I4DD 3KUDA 3W78A 4FJ0A 2BBTA 4E1BA 5JSZB 4I9FA 5HUQA 1R0WA 4FDAA 2ZRGA 2F17A 3O1LA 1Y5RA 3GLGA 1WQ1R 1EFKA 1AD2A 1ODCA 1P1FA 1KFEB 1ZMOA 2OESA 2PZEA 3AUYA 1GQYA 3DWEX 3QXXA 1N0UA 4EY6A 1NNLA 1JQEA 3AKDA 1PJRA 2VOJA 4Z51A 4DMCA 3R9XA 1JT2A 2QUZA 3RTEA 1ECFA 3KJZA 1CUCA 1SKMA 2G04A 3IT1A 1I4OA 1TM1E 2FSSA 4IZ6A 1SUEA 2HRDA 4PCVA 2WNHA 4IPTA 1SG0A 1FMCA 2EX1A 3A25A 1BWQA 3AILA 3P97A 4WADA 5B7GA 4QM6A 2RB5A 2EIXA 3OCCA 4WE3A 5JIBA 1JXMA 1MT0A 4PPQA 1TIPA 2X8JB 3CEJA 4XPZA 3IJ5A 4XDYA 3ORFA 4B3FX 1XRPA 4KVZA 3C85A 3HUUA 4BFYA 1NXQA 4HNSA 3ZWCA 2IF0A 3WVNA 1WMFA 4AZ3B 3JYPA 4AXXA 3ESXA 1VHWA 4RY8A 3WGMA 4IDAA 1W88A 4QJIA 1Q1GA 5K0LA 1FBNA 4NNPA 3GZNA 5AJTA 2YYAA 5CEFA 3LLUA 1KARA 4YHBA 3PHHA 4OL0A 1DCMA 1G20A 3C6QA 4Q3DA 3UHOA 2ZAOA 1GCAA 1FCJA 4H0NA 4EMUA 2R47A 2PY6A 1ZXBA 5H83A 3FF4A 4NENA 3REGA 3WGKA 4WLFA 3CX7A 3BT7A 3FR8A 1LNSA 1NVUQ 2IW3A 4FCCA 2GZSA 4LCJA 2JA2A 4NSNA 3RS5A 3WWZA 4UOEA 5CEJA 5JI2E 2QLBA 2COEA 2DFPA 1GRRA 2UYYA 4N0DA 2Y05A 2QD1A 3AWDA 4MMYB 1R0RE 5T8KA 4IVNA 1KSGA 2O14A 4OMFG 3HU3A 5KNBD 3TLCA 1DC3A 2OMKA 2XQVA 2VO1A 3FD8A 3OQBA 1DIGA 3PFHA 4FMDF 4O08A 1TM7E 5ESWA 2Y77A 2B8TA 2POQX 4KZKA 3TECE 1E6UA 2AT1A 5G1NA 3V4ZA 4CIAA 2BFCB 4FOPA 4B71A 4F4JA 4QLOA 1AV7A 4XUGB 3WYDA 2BMVA 1FX0B 1H0KA 2GAJA 4J1TC 3OCVA 5E0KB 1MW8X 4G1VA 5JANA 2H4HA 2E82A 4AO6A 2EKZA 1P7WA 2C92A 2ZIGA 3IUEA 4KH0A 1UK8A 1T9GR 5C35A 5I7FA 1JFSA 2G4LA 3CF4G 1R1DA 3JQPA 3WGLA 1V39A 2E4VA 4PNPA 1Y5NA 2NO4A 4YRJA 4AF6A 1DKLA 4BO0A 1UT8A 1J8QA 2NYVA 4E14A 3ANLA 1UKEA 1ULZA 1USIA 2NO6A 4DMUB 4RKQA 1DDOA 1WU7A 4IIBA 1XTKA 4ER5A 1NLYA 5JCOA 4OLBA 2ZDGA 3L7DA 1JEDA 1CY0A 4QUBA 2B37A 2X76A 3KEGA 1IDOA 5D3MB 5LCXA 1NVFA 3WQBA 4RETA 4BNNA 3Q6IA 3HR4A 2ON6A 4YAUA 2H3EA 4M1SA 3MHTA 2XWPA 2V6MA 1C14A 4P4UA 3ZK8A 1C7IA 2PSEA 3I8XA 2XCRB 1BYIA 5TV2A 1U7UA 5GPBA 4OLHA 3PNYA 4UCXA 1V11B 4FX2A 1YE5A 3DUFA 3KEFA 4QX6A 4BFXA 2I3GA 4ECAA 1Z4NA 1TQDA 1ZGJA 3HUEA 4HATA 3R9KA 1NF3A 4G0NA 3U31A 4DNPA 5JO0A 1YNOA 2E4XA 4RVNA 2O3RA 1WZ2A 4GNRA 3L2OB 1EESA 4EG8A 4KO3S 4MAMA 6REQB 5FUXA 4RF5A 2C4WA 2ZYRA 4PTYA 5FO0A 4D9NA 4WOKA 3UMGA 3U7RA 4P92A 4P3OA 2ZUTA 4B79A 3FPLA 1JLLA 1PQPA 1CJKC 4TV9F 1KPHA 4NAUA 2UYQA 1ZI9A 4PZZA 1ZCAA 3EPKA 2YVKA 2NU7B 4Q82A 5KYXB 2PZGA 4U8HA 3TUIC 5E3HA 4Y8VA 3WKAA 3WR5A 3I1YA 1Z0SA 1XU7A 5CJJA 3T7KA 2Y0CA 2WLSA 3DO6A 3NYIA 4P7JA 3TG8A 4R2KA 1JA1A 2A3RA 5C52B 3AIIA 2PFKA 2I4NA 1DAEA 3BK1A 5LP6C 2P6NA 4WZBE 1MX3A 2NQTA 3KCNA 5KWIA 2EGUA 2W43A 4IUCS 2EP8A 3K0CA 3ZLJA 2HPVA 4J43A 5L4SA 2XDQB 1VI2A 2EVWX 1HURA 2ID8A 3A4MA 2JI7A 3NHWA 1QFJA 2Y76A 3RU3A 4QSHA 3X2FA 3DOIA 3LX4A 4RJ2A 1AS0A 3U13A 2AC7A 2DOKA 2GN6A 3HY6A 2V7TA 1JDZA 3T61A 4CKYA 3EGDA 4EPYA 3GEMA 4AFNA 1ZM2A 4BO8A 4DSZA 2JKVA 5CVVA 4KHZA 1J0BA 2FY8A 3PGA1 3JWHA 4Q4DA 4DLYA 1X7HA 3V8QA 4JC5A 4TMFA 1NXSA 2CLEB 1LFAA 3RIHA 1KQNA 2AJTA 1QONA 3N53A 2I99A 1M6NA 3ENWA 1H1LA 5F1KA 2ZJ3A 2DX7A 4R8MA 1E32A 1RI5A 2YRXA 5PNTA 4D4MA 3GAMA 4C06A 3SYMA 2VJBA 2VF4X 1DBPA 3BVPA 1FSPA 4Q7QA 2IZ1A 2FPXA 3L4JA 5HX7A 1KJYA 4QQFA 2GM3A 4NPHA 4WFQA 2XYQA 3WADA 1TKBA 1Z3IX 1A8HA 3F1LA 5CX1B 2GETA 1XJWA 2DY1A 3HI4A 3RS0A 3WRYC 3SY8A 1W0KA 3FKSA 5KOIA 5C1IA 1WXDA 3NHMA 2ASVA 2NG1A 3H5TA 1E7RA 3STVA 3LZCA 5K0CA 1FDOA 1P62B 2P77A 5C9ZA 1L5ZA 1T24A 1C4XA 3CVVA 5GV8A 4C3OB 1O77A 1J39A 3QHAA 3PTLA 4FDLA 4NECA 4EI9A 2JFNA 3F9CA 1PVVA 2PS9A 2PZJA 1IWPB 3OJLA 4JJ8A 3JAMA 1EHCA 2D06A 1DFIA 1HTBA 2VP2A 3GPDG 3QWBA 4L74A 3ZNPA 5IJ0A 2W8BB 3C0KA 2NZJA 4L9SA 3AUTA 1UWKA 2GF9A 1UXJA 2HIHA 3TOSA 2J9YB 3A36A 3HA5A 1NUPA 3PUZA 5CT9A 2ZW9A 3BORA 3NRBA 4AZTA 3IHLA 3R0JA 1E9DA 1S2NA 2X77A 3H8JA 1JFTA 1QVAA 4CMJA 4L9AA 3A04A 1HFKA 4NEQA 1F17A 4DXAA 1TLLA 1KVQA 4P3KA 2D1SA 2W2VA 3FTDA 1YIDA 2GXSA 4KQ1A 3WX0A 1ZITA 1V3QE 1E1QA 4MW0A 2FDRA 4L6IA 3EHDA 4X3OA 3D8UA 1IY1A 2EL9A 6NULA 5CFLA 1ZSYA 1WF6A 5WRFA 1P3JA 2RJOA 4QASA 2YJ3A 4YUVA 5A06A 2XHEA 4AYXA 5FAKA 3I42A 4KJZA 1X8JA 5KEIA 1X2EA 4M4SA 4Q4LA 3PQ8A 3N5KA 1KJ8A 3FAZA 2XOKA 3SZRA 3LI2A 4LYGA 4D99A 2NAPA 4BZXA 4ND8A 3PR1A 4EB3A 2ISSD 5K7SA 3L82B 1PDVA 1QV7A 2VJYA 3MTAA 3DDOA 3H18A 3WFIA 1V5FA 4U7GA 5HFJA 1TPZA 2AXEA 1RI4A 1MO5A 2WG0A 2YWXA 4W63A 1LV8A 1LBSA 3AKYA 4RAQA 2B1QA 3VPAA 3A9WA 4EKGA 1VB5A 1WZEA 1C80A 1FMFA 2M6RA 4RMJA 3IO3A 3RIEA 4IFTA 1CZNA 1T8UA 4ENVA 5GADl 2WAOA 2JAOA 1MA0A 1BA3A 1XYGA 3KJFA 3R23A 2AQKA 1CUSA 3FX2A 4P36A 2R3SA 3AJRA 3N76A 5FTJA 1QH1B 5ICSA 5KWSA 2ZJ4A 4DIDA 1E4EB 1FS5A 2AFIE 3GMIA 1FUUA 4UW9A 2VBGA 5J2TF 2FDCA 3AR7A 5A9TA 4DILA 4RWEA 3HP1A 4X66B 4BCBA 1EIWA 4BMVA 1DO8A 4RWZA 5DTIA 5LQDA 3OP4A 3GFQA 5FLYA 3MCWA 2ZIVB 2P6MA 1GNLA 1IXRC 2ZROA 3I2YX 4IFEA 3UB3A 4O33A 3VVCA 3H87A 3PDCA 4R9RA 3G23A 2XB2A 4NZPA 3EUEA 2BM8A 4X5OA 1O0BA 2VBFA 4RCZA 1G21A 4EPXA 2XNDD 4AKSA 4FMBB 4XOIA 4BC0A 5IN5A 5HKBA 3CUVA 3FE2A 4KQ6A 1QBKC 1QFYA 4W9NA 3GLIB 4AY6A 2JHPA 2FE1A 1GKKA 1QVVA 3TMKA 5HK9A 2A9QA 4WNCA 3T4XA 1N7HA 1D0IA 3AEKB 4WEOA 5ED0A 2AK2A 3ID6C 3P4YA 3RWMB 4BNHA 5F73A 2HM7A 5J4VA 3KYCA 4BNTA 4E5KA 2DY0A 4NZZA 2C95A 3VXKA 2FNAA 2ZAGA 2E0IA 1XNHA 3GZ4A 4J16C 4UJ3A 3A1UA 5DJ5A 3Q5GA 1KNXA 3QWFA 1YR9A 4GVPA 2WMDA 5BW8A 5AI6A 4FWTA 3ORYA 4I9HA 4AECA 5IJXA 4HNTA 4KXUA 1PO7A 3I09A 3VR3D 1GV1A 1PR0A 2ZPUA 1HE1C 3QYJA 4R68A 4ARUA 5M34A 2PNJA 4LZJA 1JTFA 5DWVA 3HGMA 2JAHA 3RT9A 1EXVA 2XGGA 3UNXA 4K1LA 1RTTA 1Z16A 3AEXA 3V8MA 2ZQYA 3L92A 4EYEA 1QYIA 1K8QA 2NTYC 4DSUA 4TXNA 2ZT7A 3PPIA 3IXQA 2PS1A 5EQFA 3A6PC 1RI3A 1VHJA 3BK2A 3ZVLA 4D4IA 1J49A 3HEMA 1L7NA 1WZUA 4PIPA 5ALZA 1ZNXA 4U2DA 3WIDA 1E0AA 2WMYA 3AZQA 3C41J 1K27A 2HL6A 3DFUA 4Q16A 4C3ZA 4GKKB 5ULLA 2GILA 2Q1WA 3IBGA 1DKQA 1ECJA 3VSBA 4EY3A 5DP2A 2LIVA 5KOHB 3ZQ6A 2OD9A 4FYMA 3VKHA 2ASEA 1Y98A 2EKPA 5FUBA 3L9XA 5TS2A 1FDUA 2J3JA 3B8HA 4DE5A 5FBZA 2YXLA 5TPWB 4D6PA 5A4KA 1OXTA 1YV9A 1RRFA 2VATA 3OPMA 4EYQA 2A92A 2YOFA 3IC5A 3ZCSA 3L43A 2R6R1 4NH4A 2IEGA 4FFOA 1SIOA 1XQWA 2WVJA 3EXIB 1NT4A 4J9UE 3K8OE 5D01A 1U2DA 3AX6A 4OOEA 4RK0A 3I1IA 1IM2A 4FGZA 4R2WA 2QU7A 1K8XB 3TLGA 4YQYA 3WSWA 4I50B 2WM8A 1UM9B 2HTFA 3L1VA 1DQZA 4Z8YA 4R1TA 2OXTA 2DRIA 1XTTA 3IRUA 5BUZA 4PCAA 3LC1O 1ACJA 2O2CA 4QSMA 1K3TA 1PJ2A 1KK1A 1OBHA 2ZBRA 2ODNA 1KIMA 5TJ9A 4GI5A 1HE4A 3P2JA 3PNVA 4YJ3A 4TWBA 4PYQA 1Z22A 2G83A 4QYMA 4GR5A 2HEIA 2RGXA 2ERYA 2I5PO 4JUCA 4QRDA 1DRVA 5ES4B 4IGKA 4KPGA 4RYDA 3AINA 3ETHA 1HDZA 1DWOA 2Z9CA 5HRCA 1H1TA 3V9AA 4EAQA 5FTKA 3SSNA 3GDHA 2VF2A 4X1KA 8LDHA 1BGVA 3AXTA 3KR1A 4X3PA 4G1UC 1XT6A 1NASA 2PZKA 3PFBA 1NVVR 1XHLA 1Z0JA 1QF9A 4HNAA 4KYVA 4EJSC 3DCNA 3G5MA 4KMSA 3V97A 1DPFA 2V7QA 4CT0A 1M1YA 2H1SA 2J4FA 3BSYA 1Z15A 1KY3A 4UEQA 1U7WA 1MVLA 2D5AA 4DLLA 4GMXA 2PANA 2WFMA 2GGSA 5JHGB 1N2EA 3NEPX 1QZZA 1JTVA 4P4SB 1S4QA 4JJAA 2QTVB 3I39X 3CX3A 4UPVA 3I3SR 4OJTA 3IKLA 4EHBA 3NIBA 2ZITA 3ANSA 2MYPA 2C1XA 3TD2A 4C4PA 3G9XA 1XV5A 3KOOA 3QBDA 4FMCF 4DM7A 3ZH9B 2UVPB 3NWOA 4UTPA 4RD3A 4LCEA 3T9EA 4QOSA 4DJFC 5K8VA 2IX3A 2FZKA 1IUNA 5ICFA 5G2OA 5TGZA 5KVAA 1PEYA 2PN1A 3U7HB 3U17A 3C3EA 4ARAA 2CHQA 4DJJA 4WACA 2ATCA 3T52A 3HXQA 3QXHA 2WV9A 3TFOA 1OGYA 4W1QA 5KSOA 3PNBA 4G6ZA 3CNQS 1MEEA 3H3XA 3A0RB 4A6PA 4GMFA 4FYKA 1G8GA 4U9HS 2P67A 3T3DA 1O3YA 1IJKA 1G291 3T7JA 3U81A 3TF5A 4V02A 1XTBA 2OORC 4RHFA 2ZWOA 4BVKA 1Z3CA 5JEDA 1PG2A 3U0BA 5BSVA 2NP6A 2D5LA 2QZ4A 3LHDA 5AOBA 4AKTA 4JUFA 3KKNA 2D2XA 5J47A 4REOA 4PN3A 4GH5A 5CW2A 3STUA 1YZHA 4XR4A 1Q11A 4AY2A 4OI1A 1FNCA 2XUDA 4H6VA 1G5HA 4S0ZA 4YY3B 3CZ5A 4INJA 1ID8A 2FQQA 4G0ZA 3T5PA 1CV2A 2HNBA 4TZ0A 3A3PA 1B8PA 2X2EA 2ZLBA 1NWHA 3PQ7A 3P2MA 2YVLA 4NZNA 3WJ2A 2XCOA 3JAKA 1B8OA 3TOVA 3GLTA 5AM3A 3QUSA 3B3FA 1KI4A 4KC0A 5K8TA 2JBHA 2OB2A 2XE8A 4BGUA 1V3VA 5EKUA 3ZG6A 3ADOA 1U9IA 3OJWA 2IELA 1Y6QA 2IXTA 2YUIA 4KSCA 4JL6A 5H59A 4UDOA 1ZIPA 2BP7A 1J70A 1I94B 3CVJA 1YUMA 2QTWB 4O29A 4YK7A 2Q49A 2HHAA 3OMLA 2JASA 5E6SA 3H0KA 5IH7A 2EWMA 1A96A 3JQGB 2RGCA 5HUJA 1HZJA 1Z8NA 2GJ9A 3RGGA 3OUZA 4JLKA 1AKWA 1KGSA 3LX6A 2YNMD 3TXYA 2XDWA 3C4JA 1IVYA 3DZKA 2A9VA 4MRNA 3CG0A 3GFTA 3MT9A 3CB4A 2ZRPA 2IHYA 5AVVA 2G76A 4KI7A 4UUBA 5HQTA 1I6LA 4CHTA 5KX5B 2CLMB 3IEKA 2GDJA 3BUSA 3V4SA 4EARA 2Q8QA 2PS0A 1LQTA 4HUQB 3SM9A 2QN8A 4FYVA 4RM2A 3S1AB 1ADBA 1A9SA 1WMBA 2F3UA 3IMCA 1W5BA 3JD4A 3QF4B 3R0QA 4GSKA 1KH1A 3P9IA 5CNKA 1IUOA 1OLUB 5BPFA 3LK6A 3IIMA 3H04A 4Q3EA 5E6RB 1H6DA 4WHMA 3W9SA 4N3CA 4G0MA 4CZ2A 4RPJA 3NNNA 3PIDA 4JS0A 3RK1A 2O1EA 2FZVA 3FNIA 3NV9A 1X1BA 1X74A 2B34A 2HMUA 3C39A 1TFRA 3PDUA 5FTMA 3ZHBA 4ENTA 4Z9AA 4HDQB 2FN9A 1H8HD 3WHKA 3B89A 3B70A 1SXQA 4Q7JB 1PKXA 4OVKA 1BOFA 3UH0A 5K4HA 1WD5A 3OPYB 3W7AA 4M8LA 4HWPA 3ZDEA 2RK6A 1ONPA 3UXEA 1J8DA 3VU1A 5KTYA 1EX6A 4HZUB 1NDHA 1T0BA 2V58A 3K9FC 1KY4A 3QXSA 3DE2X 4OK3A 1YVPA 1CIVA 2YXPX 1RMQA 3AUJB 1G16A 1MNAA 5GZ6A 3V8EA 5DSTA 2VAMA 5LM3A 1L5VA 1GIAA 2JF0A 2BCJQ 3IS3A 4PX5A 3A6GA 1KVTA 3NIDB 2BFEA 2AN4A 1OQAA 3JARB 3KYIB 4KBFA 1JPNA 1U6KA 3GQVA 4V0QA 4KQCA 4M89A 5EFZA 3HLTA 4E2XA 1NX9A 4LE1A 1LDNA 1JILA 1L6IA 4LJKA 3BDVA 2IHUA 3CRQA 3S28A 1JFFA 2NVWA 2QUIA 4MVJI 5DHSA 2X9NA 3KQLA 4OB8A 4JLBA 1KZ6A 3TZEA 1PR2A 2BF4A 2N47A 2Q0SA 3FPJA 2YTZA 3P9YA 3QUBA 4F1JA 1AGNA 4FYPA 3R8XA 4L4UA 1W6UA 4O25A 5JMPA 3P4UA 4YJ3F 4BOYA 2CD9A 3K1TA 1XXLA 4EY7A 2HHLA 4ON9A 1SGWA 3GG2A 4MITA 4WCFA 1UBJS 3BWVA 4KO4S 3RHSA 4MW9A 5KQRA 4OF4A 3V33A 5IS2A 1P45A 4AKEA 1YGPA 2I1VB 2IIBA 4AUKA 4ZN6A 4W5QA 2YH2A 1J1UA 1BCSB 1DSSG 2LZ0A 3GCGA 3LYAA 2J3KA 3HEBA 3AC0A 1SO8A 3JW8A 2IYAA 4ZHSA 2YNMC 3T4UA 4EYKA 4LDPA 3VX4A 2H1LA 4ILKA 2BTQA 3OQOA 1T1SA 4K6OA 3T0FA 2HRRA 5K05A 1CRQA 1Y1KE 3Q1KA 4AVYA 1A98A 1T6BY 1WY7A 1MJ5A 1Z36A 2PZMA 2DZDA 1H9CA 5DHAA 3RRYA 3BJIC 4JWKA 4RVSA 2G8NA 2R79A 1MABB 1ECBA 4JQYA 1YNSA 2FW9A 4IV8A 4QU0A 5GONA 1TYCA 3ZZTA 1W35A 3G13A 4HFNA 4IJMA 5BSGA 2IYSA 5DCUA 1I4LD 1KYVA 1U0NA 2AOTA 4OOFA 1USKA 3ZDXB 1IXYA 4U9UA 1ZY2A 5EWMB 3LUAA 1DCKA 1WPXA 2EKLA 1NI3A 4M1QA 4AB1A 4AQ7A 1KORA 4HV4A 3C3BA 3GGCA 1P1CA 2NVOA 3VI4B 2B21A 4CQMA 1B15A 2H65A 4MWDA 2ZCUA 5JRJA 4R69A 4N8EA 1FU7A 4YT4A 1WUIS 2Y1WA 4J7XA 4F5YA 4YECA 4QGHA 2NPOA 3ZZ1A 4UQLA 3COYA 4M8NE 4WD3A 2YRFA 4E15A 1FNDA 1PW5A 3B51X 3NVMB 4INPA 3USES 2FSPA 2R8BA 3DL2A 3F0TA 4EG3A 4HB2A 4RZQA 3NTQA 1IJBA 2EW1A 5HUHA 3UKOA 1EUYA 2ZCJA 4B4WA 5LOVF 1W47A 4DDHA 1YR3A 3UK6A 1V8PA 1GNPA 3AB7A 3ETNA 3IP5A 2PKEA 4TLAA 5DGXA 3RW9A 3ZBPA 3I8SA 2QQEA 1NW8A 1FOEB 1GP2A 3EF3A 4P4LA 4YRTA 5L95A 5LMNB 4MQEA 2Q28A 1Z4MA 5CK5A 5KTPA 3GV0A 2NPIA 1XTZA 1CSEE 1E2QA 3UXYA 3DV2A 1QE3A 3UFXB 2GAAA 4A0SA 2AH5A 4UKDA 1N9GA 2CHGA 2VHUA 3DV0A 1ETHA 1MGPA 2ZS7A 4FOTA 5AO9A 4C78A 4URVR 1JSCA 5TXGA 1OC2A 2C77A 1P7PA 1XKTA 2I2CA 3CLUC 3EE6A 3Q10A 4RPIA 3FNEA 4LVUA 3QG5A 4F6LA 3BL8A 3PENA 3LKBA 3SZOA 1VLZA 1DQPA 2GA8A 1HTWA 1YFZA 1Z4QA 2DFVA 4S2UA 2XI4A 5HKLA 3T4PA 4RC9A 3DEHA 3NGXA 1GR1A 1GHTA 3CNHA 3NEAA 4JLOA 2W2LA 2HQ1A 3HL4A 2WQ7A 3H9CA 1OLSA 3R7AA 1V5EA 1WF3A 4GP9A 4OP2A 4GAEA 3V4FA 3PFWO 1ABBA 5FUVA 4EMBA 1D1QA 2NNLD 5HFNA 2Z08A 3UTDA 2VG8A 4QPZA 4EHKA 1UMCA 4WZZA 5FOWA 1ONOA 4J1SA 4P2GA 1IYZA 2OGTA 2GVDC 5ER9A 3D0KA 3CIFA 3DLHA 4M38A 5AW3A 1WZIA 1JHUA 3MIIA 2CMDA 1P9OA 3B1JA 3I6YA 3MPUA 4JIMA 4G3XA 5IEJA 1ZUNA 5EXPA 4MQ4A 5CT5A 5IVIA 2WOJA 3ZC3A 4DWOA 1DMSA 2HIGA 3CJQA 4C87A 6Q21A 2AC2A 5B1YA 4HPWA 1QMGA 5EJ8A 1ZR4A 4OX9Y 4TZ6A 3MS7A 1XDBA 2WINI 3KDAA 5HG0A 2YVAA 1CNEA 2FLVA 4HWGA 2CJXA 1J97A 4HFJA 1I7QB 1U5BB 2WOOA 4BZWA 3E5NA 1MH1A 4GQBA 3HL0A 1UEXC 4XWAA 5C81A 2QY9A 1R6TA 4O4JA 3P0HA 3FSJX 3QHQA 4YP5A 1C0LA 3HKCB 1WB9A 1COZA 2FHSA 1PP4A 3I3OA 1SC6A 4GM1A 4M6WA 2WJZB 1OLXB 3BFJA 2G6TA 3D5QA 3H5IA 1O6FA 4J4BA 3PXXA 4URYR 2IYFA 3AF2A 5DTRA 2XT9A 5CXQA 3IJRA 4XJVA 2H2AA 2OCYC 2QA5A 4MV6A 3TO5A 3TSYA 3L7LA 3HPRA 1EGMB 3IQEA 1O08A 3IV9A 1T4GA 2R8XA 1M1NA 3HXKA 5AFSA 4Y2XA 1YVEI 2P3QA 2P9EA 1CLUA 4B7UA 2FSVA 4BV3A 3QE9Y 3RJMA 5JEEA 3VV3A 1Q22A 3GEEA 4GLOA 5KSZA 4CMIA 1AMNA 2X41A 4X84A 2GN1A 4H60A 2HA4A 2PX8A 4DSAA 4I55B 4J0IA 3CNBA 2WKPA 5D1HA 3UUEA 5ALVA 4AN0A 5BWMA 3CZCA 4FW8A 4HDNA 4OTZA 4XARA 3WGJA 2F8SA 1MZPA 4LTMA 1FX1A 1KETA 2WHXA 4NU6A 2AN1A 3N9IA 5EP4A 2DH6A 1SVMA 4LYAA 1NLUA 1N7JA 4HEHA 3KR9A 3U3RA 5ALEA 2D2VA 4WCDA 3TJRA 3WZMA 5U9CA 5C1DA 3HJAA 4YUYA 1XIVA 4L7VA 2CUNA 4LXTA 5JH7B 3HKEA 2Q45A 1R0CA 1SXHA 5E3JA 2HD4A 1V5IA 3DA8A 5CJ2A 3I05A 2EBWA 3ACCA 4XIYA 3IT0A 4PTLA 3X1MA 1E9AA 2AYYA 4G37A 2EYUA 2IV3A 3C24A 3K1JA 3JSXA 3WJAA 4CNQA 4JGGA 2WFLA 1T5HX 2WZQA 3AFHA 4KRYA 3KFLA 2XWJI 3X1DA 1EP3B 4M1MA 4JEIA 4GOND 2V7XA 2II6A 3ME5A 2UUBB 4BO4A 1RJ9B 4RKWA 1TRKA 3LWZA 4DLPA 1QAMA 5LD2B 1PL8A 2ZUBA 4DCGA 3JQAD 1GKLA 1WW8A 3QKSA 1TCAA 1RQLA 4DRYA 2BJVA 3FMVA 4DV3B 5K3FA 4NF2A 2UZIR 4ZAVA 5SZIA 3B6JA 4TWZA 5CHYA 4Y6GB 1ISPA 2BR3A 4HGPA 1E98A 5GONF 3DBVO 4I9UA 4E5NA 4N47A 4RM3A 2OPBA 4BMPB 4JYZA 2J0VA 3UWMA 1T2CA 4EM6A 2Q0XA 2P90A 4NBSA 1SUSA 2SKCA 3AFGA 3DMNA 1T9AA 4J0DA 1IATA 1L7OA 5FFFA 4CW7A 5JJBA 3RS9A 3SSMA 4F93B 2ZCVA 2C2KA 2JI8A 4CM5A 2I67A 1XDDA 1SOVA 3ZW9A 3OZUA 2C42A </