2ZYVX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with paps/pap and p-nitrophenol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 104
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zyvX00
1E9RA 2J41A 1GOTA 4EJSC 4NYIQ 3IIKA 5UKDA 1ZNYA 4D25A 3GEHA 3TH5A 4NYJQ 1NLFA 1WF3A 1Z0AA 4B3CA 4BEBA 4KSCA 3Q5DA 2JJ1D 1T5IA 3KTAB 4PHFA 4IOJA 2RHDA 4PFSA 1QHIA 4NPHA 4LWZA 3CRW1 1KKMA 521PA 4UJ3A 1XFAA 4DT1A 4JBXA 2RGBA 4DDWA 3H1TA 4S35A 3WNBA 3MLEA 3AB3A 5DI3A 1HE1C 1LY1A 1R10A 1U0JA 2R6DA 2R9VA 1TU4A 3DOFA 3EA5A 4TLAA 5FUWA 3VTKA 3CO5A 5AJZA 3RDPA 4NMMA 4WZAE 4MKGA 5CYPA 1W4RA 1SXJC 2BBSA 2W2TA 4TSFD 1CR4A 4ZDJA 3B2EA 4QM7A 1QHYA 2QBYA 4AG6A 4FW9A 4DHEA 3BFVA 4UNPA 2ZIAA 2Z6VA 1E2NA 2ZANA 5FOTA 2PMKA 1ZUHA 3V9PA 5IF9A 1DAEA 2ATXA 1OYYA 1D8TA 4IFBA 5DH9A 5FPHA 2LCFA 2CXXA 2BM0A 2QMEA 1TF2A 1MT0A 2RMKA 2FSFA 2O52A 2JASA 3QBTA 1OXXK 3IBYA 3PCRB 4OI0A 4KCGA 3CONA 2W58A 3TR5A 2BDTA 3GLHA 4OBEA 2FF7A 4XSGA 1P2TA 1GIAA 2YV5A 4GI7A 5GVRA 4TTPA 3FWYA 1VHTA 4WA7A 5B57C 1JEEA 2WAYA 2VRWA 3VX3A 2O0HA 1OXTA 4KYUA 5TVKA 4PSKA 1WXQA 1RW4A 4D0LB 5KSYA 1YVDA 2BHRA 1Z28A 3FMOB 2VP2A 1FOEB 3I8XA 4TLCA 4DLTA 1VYTA 4HLUC 3E70C 4ZO4A 4V03A 1Z07A 1T4GA 4LJ8A 4YQFA 4UNRA 2R6AA 1G8YA 4ZPXA 1E0KA 1RRPA 3EPLA 2ZRLA 3EW9A 4NYMR 4BECA 2VHTA 2B6HA 2HEIA 5EJEA 3N2IA 4IVPA 1IN7A 4BFZA 4AG5A 4MUAA 2ZUBA 3KB2A 2CEAA 2J5XA 3PUZA 4TQAA 4ZCMA 3AKDA 5BQ5A 1KSFX 5K8TA 1NP6A 4OQFA 4KBFA 5FOXA 3IO3A 3LLUA 2DBYA 4KSBA 1QBKC 1M8PA 1N6NA 5FFMA 4CT5A 2JIZA 4Q1AA 5CLQA 4AIIA 4OI2A 1DO0A 5LD2B 2GVDC 3MAAC 3CR8A 2DYKA 1UEJA 4B6EA 4HZUA 2ZRPA 4OI4A 1TAGA 4M1TA 4DCUA 1OHHD 4U00A 2IYXA 1A2BA 3BC1A 2ERXA 3U4QA 4Q4HB 5G53C 2CJWB 2W83A 4D0NA 1XJQA 3EZ2A 3K0CA 2SHKA 4JYBA 4TZ6A 4I1SA 4Q9IA 3SJZA 4Q1FA 2QORA 4B3GA 1IN4A 4URVR 1O3YA 2J7KA 4TT3A 1AZTA 3GLFE 1N6HA 1LF0A 2UZ3A 4YDSA 3PEYA 3GJ6A 4PANA 4LHWA 4HSEA 1ZCBA 4MYCA 1T3HA 3ZH9B 4JIMA 3SJBA 3ZVRA 5SZHB 3S1AB 3ND9A 1U2RA 5G41A 3SE0A 2NO7A 4CEIB 1KJZA 1E4VA 1E99A 2VP0A 2WSSA 4DRZA 2BMFA 5ELXA 3SJAA 1NKSA 1CR2A 2FEMA 5DYGA 4PO8A 1N6OA 2PZEA 4QRHA 5H68A 1OXUA 3KKOA 1CP2A 3IGFA 4R7ZA 1P60A 4C0AC 1KO1A 1AQYA 2HCBA 2MSDB 4JLAA 4EFNA 4G5GA 3SNHA 4JBYA 1XRJA 2HT6A 2N46A 3RS5A 3HPQA 2EU8A 4AWXA 2QN6A 3W8RA 2QL6A 1KHTA 2VHCA 4LBVA 3THXA 5FOUA 5F3WB 2I1VB 1N0WA 2MSEB 4LBYA 4B3FX 1E79A 2R8RA 3OEED 1E6CA 1SKYB 4LJ4A 2ZAOA 4TL8A 4US2R 4JJZA 5JRZA 2DFNA 3QBVA 4TL7A 4D2IA 1QRAA 4AI6A 2PH1A 2IYLD 3K0CC 2QUZA 1QHHB 2A5YB 5H70A 4C0BA 4OQXA 1FX0B 4W5JA 4LJAA 2B7BA 1KDOA 4GMXA 4US0R 1UEIA 4HB2A 2H8KA 3B5JA 1WCV1 2RCNA 4B73A 2JLWA 4JLDA 4D26A 2AWOA 1R5BA 2HLDD 2PLFA 4QG7A 2ONJA 5GADl 2F3TA 4QGFA 4FMBB 5JFGA 4TYQA 3UPUA 4A8JB 1JR6A 4DBLC 4F91B 1W4BA 4FI3C 5D3QA 1NBMD 3AF2A 1BIFA 1UM8A 2DR3A 2A5DA 1BMFA 3D31A 3NTUA 3GLIE 3R8FA 2HV8A 4M9QA 5JSZB 3O8RA 1H65A 2R44A 3BOSA 3FFAA 3MSXA 5IDVA 4PO9A 2FPMA 4LJ5A 3EZ9A 1U0HC 5F9FA 1AN0A 3EIEA 2BEKA 2KI5A 2Q3FA 3HPRA 2ZQ5A 4KBGA 5FOVA 4HYYA 1AGPA 4KHZA 5EQTA 1G291 1MO6A 5LPNA 2ANCA 3AVXA 4JLJA 3TR0A 1ZVQA 4C3ZA 4M53A 5KDDA 3F5FA 3P32A 2ZSFA 1CEEA 3BD9A 1A82A 5KU1A 4KVAA 1IXZA 1ZJ6A 3U2QA 3L0SA 3THOA 1UDWA 4B44A 621PA 2PBRA 2PZGA 1KY3A 4LZZA 3THWA 1SVKA 2D2EA 3AVUA 1MRSA 1VPLA 1KI6B 1G6OA 3WXMA 3PIRA 1EESA 2QGNA 1IN6A 1XZQA 1N5IA 4DCVA 1W0KD 5JS8A 3OIWA 2GZHA 3CKLA 5JWRA 1M34E 4Z8YA 3PJRA 4TMWA 1G7CA 4WZBE 2G9NA 3RRNA 3LW7A 3PXGA 1R7RA 1HTWA 3MCAA 4IFEA 4N1AA 1OH5A 1XD9A 4P33A 4B2PA 1BKDR 1AM4D 4L9SA 3CLVA 2OCBA 4IHQA 1DPFA 2ORIA 2JAQA 2ZJ8A 3AP1A 4Q1DA 4G5OA 2FE4A 2WOJA 4MDEA 3L82B 2P0EA 4W9MC 3H86A 1D2EA 1ZAKA 2QRZA 1RC8A 3B78A 3IEUA 1MABB 3V4FA 4A9AA 5BN3A 1AJEA 5JECA 2R6CA 4CEHB 4N0DA 3EPHA 2YWEA 2IYVA 4G0NA 4FINA 3LRPA 1PVOA 2EFEB 1HQYE 3T1QA 5FTKA 2Z4RA 1NN0A 5FBWB 3OEHD 4PC2A 3QXSA 1Z29A 2CHGA 2DFKB 3EIHA 5EXSA 3B8HA 3IKJA 5D3MB 5KNBA 1KOFA 1DE0A 4P4SB 4HZIA 5AJWA 421PA 3CZQA 4CIDA 3M4YA 4KITB 4M9XA 3NC0C 4IOLA 121PA 4RZ2A 2EYUA 4FCTA 1DO2A 2RGAA 3GLHE 3FHCB 2RGGA 2ZETA 4H9GA 1E3MA 3C7KA 2L0XA 2QAGB 3T12A 1SVMA 3LBIA 1IN8A 4RFSB 1W2HA 5C46F 1S3GA 3MFYA 2E87A 2JLUA 1X8JA 2ZYUX 3K0AB 4B32A 2CDNA 2P6UA 4JLNA 1HH4A 4M1YA 4RKFA 4M9ZA 2ODWA 5EP2A 4PHGA 3KKNA 3OESA 4I99A 5L3SA 2VHUA 4OKSA 5J4VA 5DE3A 3QENA 3VR6A 1TTTA 3TUZC 5EE0A 3VKGA 5J47A 2C95A 5DGXA 3ZQ6A 2GEDA 5JRJA 3KQLA 2IT1A 1L8QA 1UBEA 2GTPA 2A30A 2A5JA 3C8UA 3Q7QA 4ZI3A 3X2SA 2FH5B 1E1RA 3GEIA 3EZ7A 4DB4A 2OFOA 1S96A 1EGAA 2OSBA 2OE2A 3UMFA 1AS0A 2FZ4A 3OFND 4RJLA 2J9RA 2ZITA 1E9SA 2ZSBA 4RZUA 4AKHA 4OJQA 4PSVA 3C16C 1QHNA 1KI3A 1P2UA 3QXHA 2W00A 2W2XA 1QZXA 1XEWX 5H8WA 1FFHA 3TVTA 1SULA 1NSTA 2IYZA 4MGIR 4IOMA 4F93B 3TQCA 1P9WA 1J8YF 3VHLB 2V3CC 2IL1A 1G6HA 3FMIA 2J3EA 1KAGA 4ARZB 4Z54A 4B47A 3K70B 4RD4A 4KJZA 5AUQA 4FMDF 4V0KA 3AF4A 2ZR9A 1JB1A 2ZRGA 3OIUA 4TTRA 1DTSA 1RJ9B 1TU3A 1KSHA 4M22A 4XH9B 5LBIA 2QPOA 2WWWA 3TSOA 4C2UA 3ICQB 1ZCAA 5EE1A 3QF4B 4MGZR 1W4AA 4TSFA 4LV6A 3K9LA 1M1YE 4WAUA 3LA6A 2RGNA 1U8ZA 2ZJOA 3BH7A 4BFYA 2JGNA 1YHNA 5DISB 1L4YA 1KO7A 1GAJA 3VAAA 2FDCA 4DLRA 1R4AA 1WRBA 3W5IA 3Q7PA 1T3SA 4N3NA 2XXAA 5L8VA 3PEUA 3VFDA 3SU8A 4AK9A 3IPYA 3WMEA 1XPRA 3CBQA 3M0EA 1CF4A 3CW2A 2WAXA 4G01B 2NO9A 4QHSA 4IVQA 4KFUA 2IWHA 3CF0A 2OEPA 2NPFA 1G7SA 3T06B 1LV7A 2FFQA 1TF7A 5BYKA 1WA5A 3THYB 5KNCA 3QKSA 5SZKB 1KDTA 4CF7A 1I2MA 4TL6A 5DHFA 1KIMA 2VSFA 4QBGB 4YMSA 3X1XA 5IT5A 2Q3HA 1K5DA 3FKSD 4CDGA 4UXHA 2JLVA 1HEIA 1KZ7B 1H8HD 2AD1A 2G0NA 4KXFB 3AP2A 5GJCA 4D80A 2GDJA 4OQMA 1NY5A 4TTQA 4NH0A 1JXMA 3M6AA 2HDNB 3RNLA 5FPKA 4M0LA 5KPDA 3EARA 2WWXA 4RSGA 1IY2A 5HKKA 1N3BA 4HUQA 4C4PA 4M21A 1ZUNB 5E7JA 2JDIA 3ICEA 1V5WA 4QHTA 3N2EA 5FOWA 1VYUA 1XCGB 3Q85A 2AN9A 3F0TA 4BFTA 5KNDA 2RGNC 2H17A 3IDQA 4XJXA 5AUNB 4JLVA 4C0HA 2O8DA 2Q0HA 1OSNA 2WJGA 1W48A 4C7OA 2GRJA 1KK0A 3CPHA 4L9WA 1PZNA 4BLQA 3L43A 3UWKA 5FTMA 5JI3E 3I92A 3W6NA 2HYIC 4GFDA 4EQ6B 5HZHA 1JR3D 4KAXA 4OHYA 2ZR7A 3CM0A 4YXWD 3A8TA 5BYJA 2EQBA 1XWIA 4XOIA 3SHFA 2F9LA 5EXTA 4B75A 3NBZC 2OXCA 5EE9A 2E9SA 4JVMA 3U60B 2OILA 4D0GA 3C5CA 4DUGD 2IYTA 2IXEA 1XEWY 1AA9A 4LPKA 1X3SA 4AYTA 2H57A 1TUEA 3GJ8A 2LKDA 3AQ4A 3EWSA 1O87A 4JT4A 3GLFB 2BEJA 1W47A 3HU1A 2XOKD 1YZGA 4KLNA 2QM8A 1XBTA 2NMVA 2QM7A 8OHMA 4GSYA 1KSGA 3EPJA 3BB3A 4IRUB 1DAHA 2P6RA 1JI0A 1TQ4A 1L2TA 2QP9X 2XGJA 1EXMA 4URUR 3BS4A 2C04A 3EIQA 1U94A 1LVGA 4MITA 3U5ZB 3MWKA 2WMOB 2QP4A 1DAKA 1BO6A 1QF9A 1AGRA 2HF9A 4WXPA 4YDHB 4B48A 1OKKA 2V7QD 3I3SR 1VCMA 2D2FA 2ZVQX 4JSTA 6Q21A 4TL9A 2PL3A 2ZRKA 3BFXA 2PEYA 2O8FB 5HE8A 4HAVA 2JJ2D 2YHSA 4XTCS 5AJVB 3TAHA 2Z4SA 3NH9A 4AY2A 4Q4JA 2Z5FA 5AWFC 1N6IA 1OFHA 4GOJA 2H18A 2WIAA 3EASA 4NCNA 1G4UR 4TMTA 2YWHA 4XIGS 2RGEA 1W36B 5DSZA 2QE7D 2VP4A 3KQKA 4URZR 3ZVLA 3TK1A 4KVGA 4M1OA 1XXHA 4ESHA 5L3VA 2D7DA 3EC1A 2CCKA 2CL0X 5BXQC 1RKBA 1P5ZB 4GT1A 4EJSB 4QJ3A 1OF1A 2J0VA 1KJYA 3R20A 2IWRA 4XVUA 2P67A 1DARA 1T8TA 1W49A 2P5TB 4L5BA 1E2KA 2G3YA 3NVAA 1IM2A 2QU8A 5IHPA 2O8BB 3QVVA 1HV8A 1P4SA 2GXQA 3TBKA 5TV2A 3B9QA 4TWZA 3ZVMA 4DDVA 1HQCA 4YMUA 4JT2A 4S2EA 1Z0KA 3RAPR 2FJUA 1XTKA 1E9FA 3MD0A 3BERA 4MUBA 1OB2A 3QE0A 1XEXB 4BFSA 3LXRA 4JLPA 4C0KA 5FTLA 1IY0A 2BMEA 3PVSA 4LV5B 4Q9LA 1XTQA 3W3AA 1GL7A 1NVVQ 1SXJB 1XMSA 3GLGB 1Y3AA 1Z06A 3BAFA 1E1QD 2IA5A 3BFKA 4CT4B 2B21A 3IPXA 3OE7D 3ZDQA 1Z0DA 2G88A 4DEYA 3B9PA 1Z6XA 1ZW6A 1R6BX 2YC4C 2WPDD 2BV3A 3LQQA 2OCAA 2C99A 4JSYA 1HUQA 4A6XA 5F9HA 1Z8FA 4KFRA 1EX7A 3HJNA 1UFQA 4G5QA 4Q00A 4DCTA 4FWTA 3ADCA 2NIPA 3SR0A 1G8GA 1E98A 1OXSC 3IHLA 2FX3A 4FCWA 1A1VA 4EPVA 4Q7KA 4US1R 3VR4A 3UMSA 4NP6A 3B82A 1UKYA 3EPKA 3MUFA 1HT2E 1CRQA 3IHWA 2BJWA 2Z0MA 1YJ5A 2FZLA 1XMIA 4B3XA 2F1RA 3CF6R 4A0FA 3DEFA 3L8ZA 1ZM3A 2PX3A 3LX8A 2W6IA 2IEYA 3KJIA 2CK3D 4LHVA 4DDTA 4PAOA 1LFDB 1S3SA 1IOZA 4PQYA 4DT1B 1Z6TA 1ZMXA 2ZS8A 1Q3TA 4Q1EA 4IEIA 2KJQA 4FMDB 1XF9A 4MRNA 4POAA 3LBNA 1E9DA 1W5TA 1X86B 3EG5A 3T1TA 4B74A 4I1UA 2YINC 2GCOB 1TUIA 1VIYA 2C9OA 1ZM7A 4AYWA 2XSZD 1GM5A 2QBYB 2YZ2A 1XPUA 2V4ZA 3TE6A 5FR2A 1SKQA 2VSXA 1GTVA 2ZU6A 4RFVA 3K70D 4Q5IA 3QY0A 1NJGA 2B92A 1GG2A 3CH4B 3OEHA 3BORA 5TARA 1DAMA 3RABA 4U5XA 3VNVA 1F3OA 1G5RA 2C96A 1XD8A 5KHOC 4GOKA 2Q9CA 3A1SA 2V1UA 5J5CA 2IS1A 1R0WA 2CHQA 4FMCB 3VNUA 5GVSA 5DLQC 2C8VA 4I81A 1NLZA 5TMPA 1UF9A 2CCGA 4D82A 2O8EA 3I4LA 3CRQA 2VLIA 2I1QA 3AGPA 3GLHB 3UG7A 1NI3A 4TMVA 3RYTC 1VCNA 2AK3A 3SI7A 1N6RA 4CZ2A 2MMCA 4TLEA 3AVVA 2GEVA 5IRCD 1WQ1R 2KB0A 3TUJC 3N5CA 3LXXA 1ZIOA 4GP6A 3TVDA 821PA 3CX6A 3UKDA 3QEJA 2K5UA 5B58C 4JBWA 3A4LA 1GL6A 4J0QA 4V0MA 3O47A 4M1SA 1TQ6A 2KBFA 2C9YA 1SVSA 1IQPA 2IXGA 4LYJA 3RSOA 1ANKA 1J70A 2AFIE 1IAQA 4TYPA 3B1VA 3AUYA 4Q19A 3DO6A 3R7WA 5G3YA 2PJZA 5C4MA 4WBSA 2UVQA 4D81A 4A1FA 4BPBA 3I73A 2CLCX 1CS4C 1RYHA 3BIFA 4AKGA 1KO5A 3WRYC 2OBNA 3AUXA 3ZLJA 1W0JD 5CITA 5DYIA 5FH9A 5EP1A 5EXPA 4JLMA 1R0XA 4NL4H 1Z6AA 3CUEF 3FTQA 3F8TA 1Z63A 1T91A 2Y8EA 1PV4A 3G0HA 4RCYA 5FUVA 3OFNA 3RRZA 5E3HA 4Z1MD 1FUKA 5C4GB 1OE0A 1E2FA 3I32A 2WIBA 2ATVA 2BBOA 3B1XA 3REGA 3SDZA 3KQNA 1UBFA 2IF0A 2XB2A 3ETLA 1MO5A 2BOVA 2ZUCA 1Q22A 1MR3F 1PJRA 4X8HA 1JQJC 5LDDC 3V4RA 1KTVA 4ZDWA 3VR2A 4E5UA 2FNAA 1WDTA 1AS2A 2J59A 4NCJA 1NN5A 2RB4A 4Q7LA 4GDFA 3LAWA 3E2IA 3L0IB 4PHTA 3PENA 2QA5A 4Y0VA 5JHGB 2PCJA 2J7PD 1KSJA 3E1SA 5GJWC 3CPJB 3G82C 1HE8B 1I2DA 2DCUA 3FHTA 2QQ0A 3DL0A 1L4UA 1RYFA 4BUJA 3RC8A 5JJLA 2XNDD 3TAUA 1F48A 1H8EA 2HCJB 1R5OA 1SHKA 1WB9A 4A0RA 2GZAA 4MKIA 4Q4HA 4ZIRB 2XX3A 2CJWA 3W9YA 1J99A 3K1JA 5EE5B 4IDHA 4PSAA 1G4AE 3QKTA 3TW4A 1NG9A 1K5GA 2F43A 1HT1E 2FSHA 2XZLA 3KJGA 2CE7A 1JAHA 1OIWA 3B1WA 1CR1A 1A7JA 3B85A 4GL2A 5EE3A 4TYWA 3PR1A 3THXB 3KXIA 3KJEA 1VECA 1XTIA 3VX4A 1D2NA 1GKYA 3ZD6A 4QKQA 4CEIA 1H8HA 4LYAA 2NGRA 1G7RA 1LS6A 1EFUA 1Z3IX 1M74A 4D4KA 5L3QA 4CYMA 4A6PA 3AVQA 1XXHE 3UK6A 4RD6A 2X77A 4XVRA 1KDPA 2DWPA 4YMWA 3VQTA 2WKRA 2YJTD 4EKDA 2IBMA 1E9EA 3X1ZA 4DLZA 3K53A 2IX3A 1T3LA 1ZU4A 2WKQA 1NMZA 2ZRFA 2GBLA 4D4JA 1NSFA 3Q9LA 2ZM5A 1P9NA 2GKSA 5BW8A 1R2QA 1SVOA 4Q21A 3DKPA 1W36D 4DEXA 1IXSB 1Y63A 3JVUA 4LHXA 1FQKA 1CLUA 1KI8A 1ZM4A 5FOSA 1NL3A 2A2ZA 2ASEA 5JCPA 2AHOA 4UNSA 3CF2A 3BH6A 1X1RA 3O8CA 1QHHA 2EFHB 2QG6A 1ZNXA 3QUSA 4LBWA 3AH8A 4YXWA 2FMXA 3KUCA 4JYCA 3R9IA 3P26A 1IN5A 3IQXA 2VP6A 2Q9BA 4MRPA 3GFOA 5EP4A 3RLFA 5BN4A 1DELA 5CLLA 4JMPA 1QDEA 4XWKA 2ZAMA 3BB1A 1CU1A 3BGWA 3FKQA 3DM9B 2CNWD 2AKAB 4DUGA 3HYTA 2GWHA 5KYKA 1VDZA 1XTJA 3DVLA 1GNQA 3CB4A 5CIWA 1DG1G 5M04A 2O8CA 2ZU0C 4HUTA 2B8WA 1SHZA 4AD8A 2AL7A 3SEAA 1KNQA 2NOAA 2RKOA 3BWDD 3C15C 4G1UC 3OAAA 1SXJD 3MWJA 5HE9A 3TSZA 1U8AA 3THWB 2HF8A 3R9XA 3KKPA 3UWOA 4PO1A 4B6FA 3FMPB 1QHXA 1FNMA 4NCKA 1UADA 3EXAA 2G77B 2XAUA 3H0KA 3X1DA 3WY9A 3WYAA 3QKRB 1ZRHA 4EAQA 2WVJA 3CNNA 1EWRA 2AX4A 4P0TA 5FBVB 4IDPA 2CL7X 2MSCB 3JVVA 1ZM9A 5DIFA 4C0QC 3K0EA 1YR8A 1IBRA 1YRBA 2VTKA 4K8OA 1M7HA 2ZRJA 3H84A 1U8YA 4NTZA 1E32A 4GZLA 1Z22A 4KLZA 3WP1B 1P73A 4LI0A 1XCPA 3PEVA 1E9BA 1COWD 1D9ZA 2RGDA 3VR3A 3FPAA 5HZKA 4B33A 4MA4A 2R65A 4MGYR 2GJAA 4JKYA 4MKHA 3RS2A 1ZM2A 3ZIAD 1GRNA 3E5HA 2WWIA 4OJKA 4Q01A 4DCNA 1RVDA 4DIDA 1E69A 3D7MA 2VIIA 2OO7A 2G1JA 1C1YA 5JLJA 1N5LA 1Q1ZA 3KDSE 1XTRA 2CVHA 4CEHA 1DS6A 5IK2A 1XMVA 1FQJA 4JVLA 2FSIA 5CK4A 2EW1A 1VG0B 1JEDA 2ZSAA 4CEJB 4UNNA 3UXMA 3PQCA 4WW0A 3BB4A 1Q1EA 1X8LA 5HPYB 1JAIA 4UNQA 3K0SA 2ZE8A 2EWWA 3W3ZB 2PEZA 4Q9KA 4B3DA 4V0ME 5CDFA 2JLXA 2GXUA 4LHZA 1OLOA 1KI9A 2REBA 5EUQB 3SYLA 2OESA 4MYTA 5J40A 3OIVA 4P31A 5KTYA 1YR7A 2VHJA 3TRFA 2VF7A 3P4YA 4KO8A 5TB5A 1OFIA 2OG2A 2ZJ2A 3QJYA 3OE7A 1DADA 2FFAA 2H1LA 4ZCLA 1Z6YA 3WYGA 3SN6A 2WPDA 4TN1A 3MJRA 4RFSA 4G5RA 3RS7A 4U02A 4GOXA 3VR1A 1CJMA 1GKUB 3GFTA 3OF5A 2J0UA 2ZRHA 1SGWA 1EFRD 2W0MA 5FBLB 3GJXC 3BH0A 4MQBA 2ERYA 2KSQA 2QZ4A 3TSWA 4ASUA 4P4TA 4TMKA 2ZI9A 4A0GA 3U3OA 3T15A 1EFHA 1IXRC 4NYMQ 1V43A 4LUCA 4UXIA 2QTFA 3NEJA 2ORWA 1Q1QA 1S0UA 3TKLA 5BWMA 1RRFA 3D3QA 4WIAA 2ONKA 3KFVA 4LX0A 4MRVA 3EZ6A 2H16A 3I72A 2JJ1A 1FZQA 1E2PA 1W2GA 1RRGA 2C78A 3G5UA 4NYJR 4TMXA 5KDLA 2CK3A 2PX0A 4A4DA 3FDIA 3KFXA 3KL4A 4OHWA 2AD5A 2YOFA 3B60A 1FMLA 3IQWA 4PZZA 1Z2CA 5KPJA 3RRYA 4PPGA 2JIZD 5KSZA 1I4LD 2AXNA 2G1KA 5FL3A 1GDDA 2Q21A 3A1VA 3QI2A 2FGKA 2ZE5A 2VH5R 4BLTA 3I5XA 1G8FA 3LD9A 4WVFA 3AKEA 2ORVA 2HXSA 3WMFA 1NNEA 3IBGA 4RD0A 2A78A 4B76A 4JLOA 2F7SA 3K0FA 3VU9B 2YOHA 4ARZA 2BM1A 4HDQB 2ZI6A 2FEOA 4LOAA 4O2LA 2V6IA 2JA1A 3PUVA 4DXAA 2CLDX 2IEZA 2ZYWX 4FMCF 4TT3D 4XD7D 5L3RA 1AK2A 1G5TA 1GVNB 2IHBA 2NO6A 2IYUA 3K09A 3A58B 4IDNA 3QF4A 2GK7A 3QKSB 4HI0E 5DHAA 4D4LA 3W8NA 5E95A 2KBEA 1GRRA 5H1YA 3A36A 2GJ8A 4HB0A 4WZ6A 3WMGA 4Q03A 3U44A 3QPVA 3RHFA 1KZGB 1E2IA 1T6NA 3U61B 3BJIC 2WSSD 2QTHA 3RSLA 2WKPA 3ZS8A 3SYKA 1GSIA 1R5NA 1TX4B 3NEYA 2ZRBA 3CRMA 5J4YA 3CX7A 4HAYA 1YE8A 3AP3A 3IIMA 2Q3MA 2WJVA 5CYOA 4BGDA 3MRSA 5CJPA 2WJYA 4UXJA 3PITA 5GJBA 1QG2A 3PUWA 2IYRA 3FVQA 2R6FA 4DZZA 5EXXA 2X19A 3THYA 4Q9HA 2JCSA 3IIJA 4O2RA 4M2LA 3L8YA 1EG7A 3Q8XB 1QVAA 2DFTA 5AR1A 4FWIB 1F2UA 1P3JA 2ZJAA 1P7CA 5HR5A 2UKDA 1Q44A 4B3BA 1EX6A 3MJHA 3FOZA 4LPSA 1NN1A 5FPTA 1W0JA 2CLSA 2XEXA 3GJ4A 3ONWA 2V9PA 3LDAA 2A5GA 4C7OB 3B6EA 5DNYB 1NKTA 2NG1A 2JLZA 4NBSA 1UBGA 2G6BA 5FUXA 1XDBA 3LY5A 4Z1MA 3GJ0A 4Q48A 1A4RA 3MMPA 4V02A 4B35A 1OXVA 2REXB 3RWMB 1K6MA 3K09C 3DZDA 4EFLA 2XTNA 1GFIA 1QG4A 2J0SA 4NE2A 1GP2A 1R8QA 3GD7A 4IOKA 4ZV4A 2LKCA 5JBQA 1OHHA 1TQDA 5AJYA 4MYUA 1GNPA 4HLCA 3UANA 2AR7A 4JS0A 5JEEA 4ZDKA 1SVLA 3HP1A 4JL8A 4OQLA 3BE4A 2JLQA 1BMFD 1ONBA 1US8A 4QJ5A 2X8AA 4EPTA 2OXRA 1N25A 4TYYA 1NN3A 3FE2A 3GJ3A 3CRRA 4NU0A 3C4JA 2FA9A 1QHSA 2ODBA 2GHIA 3TJZA 3MWLA 5KUTA 4HATA 5HCNA 1YQTA 1G19A 1PUIA 4B71A 4LBZA 3LX5A 1CR0A 4M4SA 2YKGA 1NIJA 3B13B 3AV0B 2O5VA 4DB2A 3CZPA 1GWNA 4FIDA 4Q47A 1KKLA 1TL7C 1G64A 1ZU5A 1F60A 2OZEA 3ZZUA 4DC9A 3NXSA 1II8B 4YMTA 2O0JA 4OK5A 4YMVA 1Q0UA 2VHQA 3V00A 1DBSA 1G7TA 1WMSA 4PC1A 3H2YA 4Q4JB 5HCIA 1UDXA 2GJ9A 5CB8A 1SVWA 1AKYA 2A7QA 2QEQA 2VYFA 2B8TA 2A9KA 4HAWA 2YOGA 1XD2A 3SFZA 5FL7D 1M6NA 4AKEA 3OEEA 4DLXA 3QPUA 4V0OA 1N6PA 2BKEA 2BWJA 5JS7A 3ZJYA 1F2TA 4LGMA 4KFTA 1I4DD 1OJLA 1XXHB 1JECA 4HLDA 1OFTA 2P65A 3DMNA 1CJKC 2F3RA 3ADBA 1PLLA 1R8SA 1WBDA 5BN5A 2OAP1 4QBHA 2O8FA 4Q1CA 4O3MA 2BC9A 1WP9A 2HLDA 1TMKA 3CWQA 2W6JD 2IS4A 4Q4AB 3LVQE 5FPSA 4F38A 2KWIA 4ESVA 1KO4A 1MV5A 1XNJA 3KX2A 5B64A 3TGPA 1UBCA 2FPLA 4Q9JA 1PUJA 1XMJA 1NBMA 3GFPA 4Q18A 1TADA 3OZXA 4HB4A 5CDFE 721PA 3RRMA 1X8KA 4L8GA 4LDJA 3CNOA 3GLIB 4IDQA 1U98A 4EJSA 5K8UA 4Q66C 1LB1B 2YNMA 1G8PA 3SQWA 3KXLA 2X2FA 4QJ4A 1G21E 3ZZTA 3FB4A 3SBDA 2O8BA 3EC2A 1MKYA 5K8IA 1EFTA 1W1WA 3AF0A 2IXFA 4XTRA 5DO9A 2CNWA 1ZP6A 4ZCIA 1E4YA 1YZTA 1Q12A 4LY6A 5FBQB 2F55A 1YZUA 1KI7A 2BKUA 2DHRA 3L2OB 2NO0A 2O0KA 4GZMA 2F1JA 4NKRA 2IYYA 2RH5A 4W5HA 3KZ1E 1YZKA 4E07A 4V0LA 4A15A 4RY2A 1UJ2A 4A92A 4A2QA 1KMHA 1KY2A 2J46A 2OBLA 2AK2A 2QPAA 4UQOA 1SXJA 4K81B 5FBRB 1E96A 1YRAA 4NONA 3GLGA 3GQBA 3QPWA 1ZC3A 2VBCA 5J4LA 1E2LA 3NDBB 4DLYA 2OT3B 2C03A 4AC9A 1LNZA 2H7VA 5LB2A 3WYFA 1JPJA 4DDUA 2F1HA 1HY3A 1W0KA 3WNCA 2IC5A 3U3KA 2VO1A 3CH5A 4G3XA 4EPYA 4XWOA 1DG3A 2FSGA 3A4MA 1KI1A 1TPZA 3CRVA 5J4KA 2HYDA 2PMDA 1S1MA 2JLYA 4U7DA 3I8SA 4TQUS 3F3YA 2F9MA 4IVRA 5DI3B 4C0JA 3VMFA 1XJCA 1KK3A 2GJKA 4MKFA 2BJVA 3ASZA 2QP3A 1WE2A 4R71A 2D4HA 1HA3A 3EA0A 5J4HA 4QL3A 1XJ0A 3TNFA 3NHBA 1RPZA 2DFLA 1COWA 2GZDA 3KTAA 2OCYC 2VP9A 5TDHA 3AF1A 5EZ6B 1ZD9A 4K46A 3KQHA 4OYHA 4TYNA 1N0VC 3GP8A 2CE2X 1IJEA 2WSMA 1Z47A 1T8UA 1FP6A 3D8BA 3ZIAA 4D6PA 4HLUA 2ZSEA 4HEJA 3KJHA 4QFMA 4PZLA 2ZRCA 2IUSA 3HDTA 4LC1A 4W7SA 3RC3A 1AZSC 2GCOA 2D06A 2XB4A 2O8EB 4V0NA 1JQLB 2P5SA 5C1BA 4MDFA 4CVNA 2XITA 2ECKA 1U9IA 2D7CA 1NRJB 3FFBA 4NCHA 1XTSA 3VKWA 1CRPA 4L15A 1W44A 1NMYA 2C2HA 1QHGA 1YZNA 4A2PA 3U7GA 3LVRE 5JZVA 1UKZA 4IDOA 1OB5A 5JHHB 4P32A 3AM1A 2QROA 4OHXA 4PC6A 3R7WB 2IYSA 2W2VA 2QMUA 3SQXA 5JJKA 3DPUA 5ANRB 4MYHA 2DWQA 2R62A 3Q72A 1FMJA 1CJVC 4TLDA 3NBYC 5CB6A 1QVRA 1JALA 2QTVB 2ZRDA 2FGJA 4Q7MB 3AVTA 3HU3A 4W5WA 4X8LA 3ZZ0A 2GXAA 1NJFA 4M1WA 1ZNWA 2OFXA 2Q9AA 3GJ5A 4LJYA 1EFRA 5EP3A 4OK3A 3FYHA 2GNOA 3TLXA 1SZPA 5A0FA 5HKKD 4NDZA 1DAGA 4LCBA 2YWGA 3LBHA 3U3RA 1L7VC 1ZD8A 3O8BA 2GK6A 1Q21A 2QENA 2JDID 3EZFA 4DSTA 4BFXA 1W4CA 2ZI4A 1OFUX 2ZYTX 4DLWA 1C9KA 3OHMA 4HZUB 4DSOA 2WWYA 3AF3A 1U9IC 2R2AA 4FN5A 5FI0B 5KOYA 3P1JA 1CBUA 1XCMA 2VA8A 3U4QB 3HWSA 1VCIA 2WV9A 5CM8B 1RFLA 1BS1A 4JKIA 1NG1A 4AURA 3I5YA 2WZQA 5A5GA 3KQUA 4KYIB 1VIAA 2JLSA 3B7GA 3T34A 1B23P 3UIEA 4QOSA 2GA8A 3QVUA 3AVPA 1P72A 4BEJA 4ERNA 2CHVA 4JL6A 3TMKA 2V54A 1Q3HA 3CIOA 1Q57A 4QXAA 2JJ8A 1E2EA 1NVXQ 2V6JA 1AQUA 1P75A 1G5PA 3L0OA 3U6KA 2BCJQ 4IEEA 4QHYA 4OK6A 3U7EB 2WTUA 1G1MA 1BYUA 4QGAA 4XD7A 1KDRA 1NVWQ 2F43B 4WXRA 3NBXX 4M8NE 3CWZA 3A6PC 1DAIA 1G16A 4ACAA 1Z0FA 2QSZA 1R0YA 3UG6A 2ZRMA 3NC1C 2J0QA 4RD2A 1ZD1A 5SZIA 3S1AA 4UJ5A 3FKSA 3R8CA 1XX6A 1VCOA 4PPQA 4ZIRA 4R9UC 1E2DA 3T1OA 5F98A 2IUTA 5L3QB 2IHYA 1FP7A 1HYQA 3QQ5A 4EPWA 3W5JA 4MGKR 2ZJBA 3PUXA 1E2MA 1M2OB 2ODNA 3P20A 4KU4A 1OKKD 2FU5C 2DWOA 2ZE7A 1F6BA 1ZIPA 5KSPA 5KDOA 1IY1A 3AVOA 2WJHA 1FUUA 2PLRA 4HDCA 1KAOA 3WBKA 5LD2C 2QGZA 2G0TA 2PZFA 5AK0A 1FW6A 1XU4A 1ZNZA 1J90A 4BFVA 5GJVC 2E1RA 2QY9A 1EK0A 3NBFA 1P62B 2GEUA 3FHOA 4L4UA 5AUOB 2NZJA 1NBME 4OI1A 1C4OA 2OFWA 3AVWA 1VYVA 3W6PA 4LJ7A 1EWQA 2XJ4A 3LNCA 2VEDA 4RZ3A 1FX0A 4B34A 1JR3A 1TEXA 4C9BA 1HURA 1GZSA 4EIWA 3T5GA 4Q02A 2ZROA 2RGXA 4DLVA 5JWHA 1E9AA 1CXZA 2RAPA 4MRRA 1S9DA 4URXR 1G3MA 2F1IA 1P6XA 2V8OA 4LJ6A 4M9SA 2GVZC 3B1YA 1UKVY 2XTMA 3ADKA 4M1MA 1KI4A 2BBTA 1IONA 1G20E 1ESMA 4A8JA 1YR9A 1MO3A 2FFHA 2NTYC 4LV8B 2O8CB 5A4JA 1ESNA 1NMXA 1ZC4A 4RCZA 4RVCA 4KFSA 4F4CA 4ZKDA 5E4FA 1II0A 5JSZA 1CTQA 4JZKA 1SXJE 2FWRA 3RVBA 1VMAA 2X2EA 4MRSA 2IS6A 3GLGE 2VP5A 2XOKA 3P4XA 4PPNA 4BASA 4QGHA 2OCPA 4X8OA 1MOZA 1S8FA 3A1UA 5JI2E 3MWYW 3P27A 3RWOA 1GUAA 4TLBA 4XVQA 3WHLA 2JLRA 2IUUA 5DN6D 2GBLC 1MRNA 1SVIA 1NY6A 5KSOA 1VG8A 2AWNA 1U0LA 3PG5A 2UZIR 4KI0A 2ZJYA 4O0MA 5AUPB 1AKEA 2EVWX 2GXSA 4QNMA 3B1ZA 1DAFA 1Q1BA 3IUYA 5CIQA 5CM9C 2V7QA 4F92B 1P61B 4ILEA 2XTZA 2V1XA 4JVNA 1R0ZA 4KV9A 4II7A 2ZSDA 1Q20A 3K9NA 4R2IA 3WP0A 3HR8A 2JJ2A 1KI6A 3QIAA 3NH6A 1E2JA 4EPXA 2QAJA 3LV8A 5JCZA 2ZS9A 3IO5A 1OIVA 1UKEA 221PA 4GNKA 1TQ2A 3C41J 1GNRA 2VF8A 5FL7A 2QRNA 3QOFA 2W6ID 3JZMA 4P4UA 3NHAA 3QKRA 2ZYVX 4QBFA 5G40A 2WICA 3QF7A 4A8JC 3PV0A 2QE7A 1Z2AA 3UMRA 2OV2A 2QT0A 2WBLC 4R98A 5TY0A 4WOPA 2GAOA 1N5KA 1T0HB 2GCPA 2OUKA 3AKCA 3ASYA 4HB3A 4PPFA 2XZOA 3VKHA 1TNDA 2B7CA 4C30A 3I1FA 2IS2A 5CJ2A 2OLKA 4M1KA 3HR7A 2ZREA 4ZDIA 4PC7A 1XEFA 5EZ5A 3AKYA 5DI9A 1XZPA 4BZXA 1MABA 4B43A 1I4TD 2W6JA 3SC3A 4ZKEA 2ZI7A 2WM9B 1BYIA 1RZ3A 1GRQA 3L0PA 3ZS9A 3T1VA 4X8MA 2ZE6A 4GPTA 2H92A 4BLOA 4CRWB 4QM6A 4DSUA 2PT7A 3AVYA 5D3MA 2VQSA 5FR1A 4P4SA 3LQRA 4BRWA 3EWAA 2BMJA 2PJRA 2BBWA 4ABYA 4TMZA 5L3SB 5FUYA 2A5FA 2XZPA 2ZEJA 4Z51A 3GEEA 1OH7A 1UAAA 4DCSA 2DY1A 1E1QA 2ZS7A 2NPIA 3LH5A 1NVVR 1VG9B 1J2JA 1NIPA 4PQRA 2QAGA 3HYRA 4CEJA 4LHYA 3SBEA 3R9WA 1XB2A 3KUDA 4DWJA 2NZ8A 3WRXC 2QPTA 1CKEA 4LC0A 3VR5A 2BMDA 2J0UB 4A2WA 3K0AA 3ZD7A 2F6RA 4IKEA 1X1SA 2C98A 2ZTSA 1BOFA 1E0JA 2W0SA 3U7FB 2BIFA 3QG1A 4YONB 2QI9C 2ZI5A 3K9GA 4BFUA 1N5JA 2EFDB 4CGZA 1E0AA 1MO4A 4RD1A 1TF5A 2FG5A 2J45A 3D6TB 3LO5A 3CR7A 3FGNA 3NWJA 1YZLA 2KE5A 1M7BA 2C9CA 2BVNA 2GESA 3FMFA 1P2VA 2QMOA 4EPRA 4PQFA 4F4JA 2CVFA 3T35A 4DVGA 3DKVA 4NCIA 4NYIR 4RD3A 1G3IA 2AFHE 2DPXA 3GMTA 4BLRA 5E7IA 4I1VA 1OH8A 1GILA 1YR6A 2HXYA 1N0UA 4JL5A 1E9CA 1IHUA 1KMQA 3O8DA 4PXAA 2CL6X 2REOA 1LF5A 3N70A 4PHHA 1G3QA 2ZUDA 5F2EA 4H1VA 3T5DA 4A82A 1M7GA 1T5LA 1FNNA 2GCNA 4PR0A 3SYNA 1N6LA 3X1YA 2YVUA 1G9XA 5EUMA 4DLSA 3PEWA 3BRWD 2XSZA 2FV8A 4ITRC 1J8MF 2IYQA 1ELOA 1KO8A 1CJTC 1Z6GA 1TEVA 3KXKA 4JLKA 3K0FB 3U3JA 3MG9A 1G17A 2QAGC 2Q6TA 4PZYA 3K8YA 4FD2A 4BZPA 1JJ7A 3QNUA 1GL9B 1F5NA 1OH6A 1LW7A 1OYWA 2XXAB 2ZJZA 3H4MA 4YC7A 2FFBA 4HAUA 2VSOA 1SQ5A 1OIXA 4HAZA 4RZXA 1RJ9A 2OLJA 2QQEA 1RIFA 2J1LA 1E94E 3ZGXA 1Z83A 2EFGA 5E7MA 2J87A 2XJ9A 4BQSA 5FPYA 4F4IA 1KK2A 4R2HA 5HTKA 1RE0A 4JVSB 4A36A 3W34A 4G5SA 1H8ED 3U44B 3QG5A 3ADDA 2HJVA 2N42A 3PFIA 3I61A 2ODEA 4I1OA 3VU9A 3VHXA 1DOAA 1E2GA 4XSHA 2WMNB 4NHOA 1J7KA 4ACBA 2EFCB 4URYR 2P2LA 2NQ2C 1G8HA 4Q4LA 4CW7A 2Z43A 1D6JA 4PAMA 2CBZA 1FTSA 3DMDA 3QEOA 4LSGA 2GILA 4HUQB 1FPMA 3QXXA 2IW3A 1CJUC 4FCVA 2V55B 4LJ9A 3A1WA 1ODFA 3RANA 1F2UB 2CMKA 1NLYA 1B0UA 1KNXA 1G3UA 1KI2A 1EFCA 2HT1A 1D9XA 1KGDA 1E79D 2GJSA 4B2LA 2O8DB 3BBPA 1JNYA 1SKYE 2D3WA 1FL9A 3K70C 5B2ZA 2VL7A 4DJTA 2ZRNA 1S1CA 1BH2A 3SFVA 2HUPA 1DEKA 2YWFA 2BCGY 1ZUIA 1ETUA 1JR3E 4H1UA 2VPPA 2FOLA 2EWVA 3ECCA 4IXMA 4L16A 3U3MA 1A5TA 2AKYA 1W5SA 1D2MA 2AXPA 3WHKA 1U81A 3ZYCA 3SS8A 1P2SA 5CK5A 2A3RA 4E09A 1OW3B 1IJFA 1CIPA 2OAQ1 4HDOB 2C77A 2OBMA 2RGCA 3QKUA 3EAQA 4PAQA 1AIPA 2ZR0A 3T61A 2ZJ5A 1GITA 3PUYA 5C2JB 1NVUQ 2ZRAA 1S4QA 1N2CE 4YLGA 3KKQA 1US8B 3DM5A 4QBIA 3SOPA 2HJGA 4EQ6A 3ZVNA 2PCLA 4F7WA 2QMHA 5JEDA 4Q1BA 2J7PA 4PX9A 3DDCA 2ZXUA 1D5CA 2EYQA 2D62A 4KODA 2IYWA 4Y0AA 2GF0A 1YKSA 3NDPA 4ON9A 1GKIA 2QSYA 2XNDA 3Q5EA 3LFUA 4NZYA 4D4MA 4GBMA 4OHVA 1II9A 3QXJA 2GAAA 1VTKA 4IW3B 4MH0R 4E22A 3QSYA 4GRAA 2FN4A 2WWFA 3UATA 4BWYA 4BE7B 3TQFA 1LS1A 4P3YA 1PLKA 4C0SA 1G18A 4N0EA 3RS4A 5SZJA 2LWIA 2WJIA 4JLBA 1JPNA 3GLFA 3SJCA 3SZRA 2YYZA 1Z5ZA 3NG1A 2IF2A 3OAAD 1OT3A 4AKIA 3Q3JB 1G3RA 3U6BA 1E0SA 5K8LA 5JJIA 5G3ZA 3DOEA 3OIYA 3EX7C 1T9HA 4DLUA 2N1BA 4QGGA 2JEOA 3KKMA 2I4IA 1YU9A 3DZ8A 2P3SA 1Z0IA 1XD2B 3A37A 4BFWA 1MH1A 3QXCA 3X1WA 3BXZA 1ZBDA 1OPXA 4HAXA 4Z8XA 3KB1A 2ANBA 2R6GA 4UKDA 4B2IA 1T0JB 1E2QA 1JJVA 1F2TB 5FI1B 1OV4A 3BK7A 1XPOA 5JMTA 3LW8A 4DKXA 4IXNA 3DHWC 1VG1A 2D74A 2FPKA 3U7HB 3GJ7A 1II8A 4DIEA 4GP7A 3A1TA 2TMKA 3CNLA 5JWOA 1JXOA 3HU2A 1YZQA 1NF3A 3AGQA 1WBBA 4Q7JB 3K9HA 4PTLA 1K8RA 3J81k 3C5HA 4ZI2A 2GF9A 2ZVPX 3W90A 2WOOA 2WWGA 2WHXA 4OQNA 4XWAA 4OHZA 1RRCA 4EFMA 1W46A 4BLSA 4BZQA 5LB4A 1KK1A 4TZ0A 1N6KA 3NIBA 3REFA 3TUIC 3WNDA 1S9HA 2DB3A 1JBKA 1DVRA 4OL0A 2NO1A 1ZYUA 4BLPA 4RKEA 3ZQJA 2RHMA 1W7AA 2MMGA 5KO2A 2C5LA 1UPTA 1ZINA 2WWHA 4PC3A 4E03A 5DN6A 3IILA 1AS3A 3LWNA 4URWR 4Q4AA 3SHWA 5P21A 3TW8B 5IK2D 3C14C 3RS0A 2IK8A 3LLMA 1CULC 2ZPTX 2I3BA 3IEVA 3ND8A 4DSNA 4C0LA 4EDHA 2QT1A 4JJKA 4QNRA 2G83A 3M1IA 4LYHA 1X6VA 1KYIA 3JZAA 4TQ9A 3GCGA 1G41A 3NKVA 5TXGA 4AYXA 1XEXA 2ZRIA 1E2HA 1KJWA 3GLIA 1XP8A 3GPLA 4LRWA 2P6NA 1KMHB 5FTNA 3WBJA 4QC2A 4LYFA 3AEZA 3I62A 1LTQA 3MGCA 4GMDA 2QNRA 3CX8A 2PT5A 2GETA 1FTNA 3CPEA 2YC2C 4A0HA 1S2MA 5FTJA 2ZI3A 2JATA 2Z83A 2X1VA 3W6OA 1VHLA 1P9RA 5B30A 4FXPA 1VKJA 2CCJA 2XNSA 3A4NA 4EUNA 1W36C 4BRUA 4HLQB 2OM2A 1E1RD 4I4LA 5C18A 4ASUD 1Z0JA 5AJXA 4C2TA 1PLJA 4O25A 1A2KC 2WJJA 3TIFA 4LK2A 2OHFA 1U99A 1U90A 1Z08A 4IJMA 3RS3A 2H5EA
chains in the Genus database with same CATH superfamily
4RV5A 5JS6A 1Z5OA 1GOTA 2C1EA 3CSSA 1E3SA 3BT7A 4NYIQ 3IIKA 1CQZA 5J63A 4K87A 3QW4B 5UKDA 1ZNYA 4NATA 4CIVA 1THTA 4QUDA 1MPXA 3TH5A 1KTIA 4EA9A 1ORRA 2ZWOA 4GPAA 4N39A 4WEQA 3WSWA 3Q5DA 4BEBA 5L7TA 3EMVA 5ELMA 2D1QA 3Q88A 2HI0A 5FADA 1NBIA 4ND3A 3RBVA 2XA9A 2QWXA 4PRZA 3WV5A 1ODSA 1P5FA 4UJ3A 1XFAA 4B7ZA 3LHFA 1NYRA 2E1PA 4DDWA 4D9EA 4RELA 4RTMA 3H1TA 4KO1S 2HHCA 4A5SA 1RI5A 2R6DA 3A9VA 1TU4A 3DOFA 4L0DA 1IOWA 3LECA 1XAJA 3RDPA 3BMCB 2IZ5A 2JARA 2B6NA 1SCBA 5CYPA 3LY7A 3WIUA 3R0QA 3BMOB 2BZSA 1UBSB 3B2EA 3UW3A 3MB8A 1UQRA 3KT8A 5AI4A 2EW8A 1OREA 4YPOA 5FUMA 1C1DB 4AG6A 2P9JA 4DHEA 3UUWA 3BFVA 3ZDDA 3KV1A 3OC0A 2PYZA 2HQ1A 4HLNA 4RLHA 4YMGA 5FNVA 4L5JA 1P81A 2OMKA 3ZV4A 1B73A 2ZANA 2CDRA 3OURA 5KNLA 1A50B 1JEQA 4OXXA 1C9YA 4Z53A 3HV0A 3NTRA 4IFBA 1U2SA 5DH9A 5EWJA 3ECSA 1EE9A 4IX1A 2QMEA 4HDKB 4YAOA 5DHPA 3GJTA 2OCDA 2KW5A 4YDRA 3SMVA 4LXIA 1U5AA 1BX1A 1X42A 3DMPA 3HUEA 2I2BA 3IBYA 1A9RA 3O4FA 3QBTA 4K05A 4X3CA 5JNUA 4OI0A 3PQ3A 2X9VA 5DBEX 4IO1A 3CONA 2K4MA 2W58A 3BJZA 3EULA 1PD1A 4PFKA 5ALXA 5B4TA 4OQEA 3DLHA 5MFPA 2QOEA 4V2UA 3CQ9A 4GI7A 1XHLA 2AN1A 2DBRA 3GARA 1XMPA 1JEEA 2H48A 1R4NB 1T1GA 1NC3A 2HRZA 2WAYA 3VX3A 3PC3A 2O0HA 2IHTA 2PX4A 3P97A 4JITA 2OD2A 4PSKA 3RSQA 4RETA 2HUNA 3UENA 4DLLA 1YVDA 3IMFA 3LKBA 4J1TC 4O4LA 3L0BA 2XRYA 3O9ZA 2VP2A 1FOEB 5CVVA 4YHBA 1WNTA 1M5RA 4DLTA 3KHTA 4KO4S 3WIVA 3ELUA 1ACMA 3U40A 3HC7A 1GPMA 2V5VA 2VJAA 4UUBA 3GAMA 2HHJA 1Z07A 1T4GA 4AO8A 4EF6A 4BFLA 3N7AA 1MVNA 2K2WA 2R6AA 4WN9B 4UNRA 1X7ZA 2FW9A 1E0KA 3AINA 1FSFA 4PR3A 4UUPA 4ZOAA 4BQEA 3ZN2A 1XC7A 3EW9A 4BECA 4NYMR 3GN1A 5JAOA 5IG2A 5EJEA 2M6RA 1BDJA 3VHRA 4FR0A 3W2FA 1ZMTA 4BFZA 3IJPA 1NONA 3LOPA 4MUAA 2J5XA 2QTCA 4EHAA 1BHJA 1HZZA 1Y8QA 1XWFA 1TD1A 1JB9A 1KSFX 4P36A 2V98A 1YB6A 3TLCA 2PQ2A 3L7AA 1I1OA 1NP6A 4DA7A 2V7WA 2XVXA 5COQA 1IUKA 1T15A 2V6GA 5HK8A 1M8PA 1N6NA 4LQ4A 5TPWB 3T9EA 2Q07A 4PVCA 4AIIA 3T9AA 3IX7A 4GWLA 4MQ4A 1Z33A 3MAAC 3FNEA 5JZ9A 1GPBA 1PHRA 3M33A 4ZI7F 1W35A 2B4QA 4I2NA 3VNAA 1VL2A 1J00A 3IVXA 3RSGA 5MN5A 4U00A 2AYYA 3DT9A 2YY5A 1A2BA 3BC1A 4GI5A 4U4AA 5TGZA 3DOUA 3A0RB 2CJWB 2ZDQA 4F8EA 1P8JA 3EZ2A 4IH4A 1IG0A 1PFQA 1L7NA 1ZISA 4JJEA 1IBKB 2WJ6A 2Y05A 4TZ6A 3MS4A 5BY2A 2EZUA 1Z75A 4I1SA 1HM5A 3OLWA 4Q1FA 1IN4A 4C4OA 2QYOA 2VDOB 4OO3A 3L7YA 3GLFE 1UBOS 5JPCA 5ALUA 2UZ3A 3AF5A 3DZKA 4L57A 2WR8A 4TXLA 3PKIA 3GJ6A 1NJ6A 3N39C 3DTYA 4ARBA 1EVYA 2JKYA 1S2OA 5CGQB 1ZCBA 2ECQA 2H7XA 1N8KA 2FUEA 2GKGA 1U5BB 3ZH9B 3D4IA 3FTDA 1EJ0A 1IAVA 3LT0A 5AKJA 4PM4A 4QFBA 1UJ4A 5SZHB 3S1AB 1XCOA 4F72A 4KN5A 1RC0A 3OUZA 1U2RA 3QEMA 5B4VA 4CEIB 3R6DA 1E99A 4G0ZA 1ZEMA 3L4EA 1FTGA 2P9TA 4I55B 2C2KA 4Z0HO 4NH4A 2WW8A 1CR2A 4R1UA 4EYGA 1N6OA 1RM4A 1HZZC 1LVHA 1ZGBA 5JSYA 4M0KA 5FFNA 4JI4B 1OXUA 3IGFA 1VE7A 1YVEI 3LS2A 3DLIA 2HCBA 1GPH1 2G63A 4JLAA 3AEYA 4EFNA 3SNHA 4YCLA 3FTNA 1XRJA 3QYJA 3JQGB 5A9SB 1BXKA 4YIKA 5EWMB 4OB8A 3W8RA 2QL6A 2XOXA 2R8YA 1NYQA 1TK9A 1GQYA 4LBVA 5E7QA 4DQ0A 4W4TA 2C4TA 5FPPA 1N0WA 3PDJA 4RM2A 4MRMA 2HMSA 4OBBA 4LBYA 3S8EA 3L84A 4HGOA 2AMFA 1E6UA 2VT6A 3HJHA 5IZCA 4GI3A 1VKRA 4JJZA 4OU4A 5JRZA 1EK2A 3QBVA 1JLHA 3K6KA 4G97A 4D2IA 3BQNB 3NQ41 5HOEA 2UUBB 4AI6A 5FLEX 1OU4A 2DTDA 4ARVA 3DBRA 2QUZA 1YAHA 1QFXA 2WFAA 1RMTA 2A5YB 2I4OA 3H11A 4OIMA 4OKNA 1Y4AE 5D86A 2YDYA 5H70A 1CY2A 1RS0A 4RLQA 4V1CI 5JQGA 1H6AA 3BIXA 3CLKA 3A26A 4W5OA 2OHVA 2H06A 3L92A 1EBFA 4JLDA 5C8YA 4D26A 1BX0A 1ODLA 2PLFA 4P8RA 2HLDD 1BCRB 5FEUA 1TXGA 3I23A 2MCFA 2GN9A 3OLCX 1P33A 3DEIA 1OWLA 4FMBB 1G0OA 2GUWA 1OZAA 4O6VA 2JLCA 3F1LA 5K05A 2OY0A 3UWSA 2GUGA 4N65A 4DBLC 3GHYA 3KOZA 4YT5A 4CG2A 2ID8A 4FKMA 5D3QA 4CTMA 4Q4CA 1IPFA 2WJAA 2ZAIA 2VPQA 3U17A 1UM8A 2QQGA 3OPYB 4ND7A 1QV9A 3U7RA 4DXHA 2A5DA 1N2CB 2PWBA 3D31A 1Y3FE 3HKEA 4YASA 1NNUA 1KEZA 2FQQA 3LVFO 5JSZB 2QLJA 5EJAA 4KI7A 5KIAA 2XYQA 3MSXA 1IFXA 2VC2B 3KL2A 3ZWQA 3EZ9A 1UL1X 2V45A 3PL1A 5I5EA 4K6GA 1AN0A 2WHEA 1WKCA 2Q3FA 3A4VA 4HFNA 3HPRA 1G5IA 4HYYA 1XTTA 4EZBA 1UJMA 4FNGA 1MTZA 2GZSA 4IDBA 1DKQA 3AVXA 1RABA 1KEEA 1YQQA 4L9AA 1J33A 3TINA 4EFDA 2IUYA 4KWCA 5A4DA 2HHLA 2QLTA 3TR0A 3NFYA 1ZVQA 4CKCB 1BGXT 1CUVA 1SBZA 3F5FA 4I1YA 5EIHA 4LZJA 2OM6A 3KJXA 3EHDA 4HCJA 2JIBA 1DQZA 1RCUA 3ZW7A 1BDBA 4RHCA 4KVAA 5BWBA 3LQ2A 5BSWA 1IXZA 4DMKA 4Y9DA 2HAEA 3H0EA 1K8XB 2XDYA 3L0SA 4IMIB 3PX2A 5KI6A 621PA 4I3GA 3D6NB 4IQ0A 3HCFA 4CM1A 4UPVA 3EC7A 1WDMA 2H4WA 4ER3A 3VU0A 1EJ6A 1MW9X 3PNBA 3S2FA 3WXMA 3PIRA 4ROTA 3V1KA 4D5EA 5BSKA 1XCBA 1THGA 1N2BA 1GU1A 1W0KD 2RDMA 1H0RA 3OIWA 1IMJA 3CKLA 1VB3A 5JWRA 1LNQA 1YR1A 2Q6VA 2A8YA 5AVOA 3PJRA 1G7CA 1MX5A 1UBLS 2PY6A 3OIFA 4QYWA 2DSTA 2JFOA 3CH7A 3LW7A 1HTWA 3PXGA 5E8JA 4Z7JA 4N1AA 1JQEA 5CB4A 5DSTA 4B2PA 4WK6A 3STHA 2OBXA 2NXCA 2OCBA 1U8FO 1XZ8A 1H0SA 2I2CA 4PLVA 4Y9TA 5IKPA 5J1SB 1RAFA 4DCCA 3UPTA 4EZIA 1WDKA 2CXUA 2D7JA 2B3TA 3L82B 3MAJA 3LZCA 3D43A 1GCOA 3CVUA 1D2EA 1ZAKA 2B99A 5CU7A 3IEUA 5LZ5A 4QU9A 2VK2A 4HTFA 5DBFA 5ECWA 2FW8A 1DIOB 3PRHA 3QVMA 4JEIA 2R6CA 4IZ6A 3W2IA 1EGMB 1P80A 2VF5X 3ROTA 3ZZ1A 1TEZA 3EPHA 2IYVA 4LDZA 2Q2WA 3JWHA 2VTBB 4ZO8A 1W1UA 4MYDA 5F76A 2Z4RA 1AOXA 2OD9A 3OLVA 1RXVA 1Z29A 3FCCA 1U1EA 1FFDA 1BHSA 1VMEA 3IUSA 5JIBA 3IKJA 2H5IA 1YTLA 2A9FA 1DHTA 2GF2A 2WYOA 1LNSA 5LOVF 4P81A 3CLHA 3SHOA 3N0VA 2DUNA 2Y1CA 2J3HA 3OMWA 3UB2A 1MJ5A 4UTRA 4PINA 2OTCA 4MO9A 5L6MB 3OQ1A 2I71A 4FCTA 3IQFA 3ZKWB 4AIRA 4C4RA 3OF2A 4G1CA 2YHIA 2W42A 1VHWA 2WM3A 5FIUA 2XDAA 2FZGA 3LC1O 4OPMA 1E3MA 5DNEA 5AW3A 2FAXA 4HQKA 4JX9A 3BE5A 1CQXA 1RHKA 2XKBA 4WESA 5EIEA 2XRFA 3G8BA 3NDIA 4X63A 2HA7A 3HKBB 4RFSB 3HA5A 1ODJA 4EGQA 2RJ3A 2AJDA 3MFYA 2E87A 1YRHA 3E48A 5ALHA 1M6VB 2ZYUX 2ABWA 2ZP1A 2QTLA 3GZJA 4JLNA 4PBRA 4PXYA 4M9ZA 1DWUA 3FVVA 2HQBA 4RPLA 2EBHX 4QU5A 3ZHOA 1ZGGA 4DNQA 3OESA 5L3SA 1GUDA 3P9SA 4OKSA 3D3NA 2HDWA 1FDVA 1JG1A 3S7ZA 3QENA 3VR6A 2D0DA 3ROXA 1DTWA 2B37A 2C95A 4JQCA 5CXSA 2GEDA 3OZBA 2PIAA 3B9RA 4JT9A 1ZZEA 4HDRB 5JAQA 4ECEA 4ZHQB 1UBEA 4PYRA 3V4SA 2A30A 3OZUA 5KKAA 3LC7O 1ATZA 1Q17A 4J76A 4L2IB 1BKYA 5DYWA 1E1RA 3L8DA 1XDGA 4LSWA 1S96A 2H7CA 1TVMA 2CLMB 2XGGA 3H8WA 4TM7A 5KJEA 1GPLA 1Y8RB 1A4UA 3PQ4A 1VHJA 1P7ZA 2J9RA 1L7RA 4KMRA 4HVCA 2E5FA 1NNEA 5LWQA 1RHUA 1GV0A 5BV7A 3KCNA 4OJQA 2X7XA 4XYBA 2FCRA 1T1JA 1U1CA 2R96A 2X23A 3HB0A 3KQYA 4KQ9A 4TKVB 3WO0A 2R5WA 3ZE2B 4AZ0A 5ALVA 2EP5A 2W00A 3OE1A 1NSTA 1UC9A 4D6YA 4IOMA 4F93B 2DKFA 3BFPA 4MQFB 3GBSA 3N8DA 5M3BA 1J8YF 1K66A 2OCLA 2V3CC 1JG2A 1IZYA 2GPBA 2VDUE 5LNK1 4KJZA 2Y0EA 3HB5X 2B69A 1ZWKA 1C80A 3MC1A 4WLVA 1FX1A 2GGSA 1UOPA 3AESB 1DTSA 1QJ4A 1KSHA 4M22A 4FFVA 2QPOA 5A5VA 2H8GA 4OGGA 2NSHA 4DBVO 5EE1A 3F78A 2PBZA 4LV6A 1S5PA 4YO7A 2WSLA 1M83A 3W2TA 2QW0X 1A95A 2C2GA 1SHLA 2VZEA 3C87A 2ZJOA 1AUOA 1BE8A 1U8ZA 4R7GA 4E6EA 1I7LA 1L4YA 1OLSB 1NVBA 3KQOA 6CHYA 1V25A 2QE6A 3DV0A 1M0SA 4ZJPA 3OT4A 3PIDA 5DTEA 4BMZA 3VPHA 3KT6A 1ZX1A 1C0EA 1KS9A 3AMVA 3VZSA 1FRZA 3ZI4A 3LY8A 1J0XO 1XPRA 3PBKA 4ALNA 5DTIA 2AOUA 1O1YA 2IWHA 1B8PA 3AJEA 3ZU5A 3STUA 2OEPA 2FFQA 3THYB 1TF7A 1WA5A 1TT7A 2IV7A 1WB4A 1I2MA 4PLTA 2IUFA 1FFSA 1QE0A 3PGLA 1DKLA 3TDKA 3X1XA 4CCAA 4BXOA 1R9MA 4JXKA 4UXHA 2I8CA 3EQ2A 5BNTA 1H8HD 4V3CA 4EHLA 2GDJA 3HCRA 2I3GA 1FSZA 1CY4A 3FWNA 4JFAA 5EHZA 4ZOCA 1BCSB 1EXWA 4FYMA 5IAOA 1M2WA 3BBLA 5FPKA 3F90A 3OU2A 3LPAA 1OLUB 4Z0NA 2ZBUA 2H3HA 2HBQA 4B81A 2XDQA 1IBMB 1IY2A 2YIDA 1U2TA 4QLOA 5AKYA 4F4DA 5BR7A 5HKKA 3CN9A 4M87A 4D3YA 3GUZA 4C4PA 2AQ8A 3Q3IA 3B52X 4ZYVA 3GLVA 2NVUA 3IAS6 1ST3A 2PZ8A 3STYA 5KYWA 1NJ8A 2JDIA 3B5EA 4YECA 2GD1O 5AXBA 5JPDA 2IYPA 1MC5A 2NSYA 2NXJA 1TFRA 1VYUA 2G7ZA 2CT8A 2Z3WA 4YCAA 4BFTA 1OILA 2HGZA 3HA7A 4YTEA 1TDJA 1J09A 4JLVA 3AILA 4B5KA 1DKNA 3P0IA 2WJGA 3U62A 4UUOA 3DT8A 4RMIA 3CSUA 1QNLA 4HGZA 1KK0A 3RT7A 2Y27A 3CPHA 3EVTA 3NYWA 3AI2A 3L43A 3KNZA 3WICA 4BNMA 5EMHA 1R0LA 3P9QA 2VLBA 2BISA 2Q5OA 3W4JA 1UFKA 1UXIA 3MRVA 1ONNA 5D3ZA 3BIWA 4YXWD 3DBIA 5DXAA 3CURA 1KJQA 5CDUA 5LC1A 1DRKA 1W76A 3OWXA 4D43A 4FX2A 2DQZA 3KVNA 4XOIA 5DXFA 4B75A 4CLXA 3VI3B 1L4KA 1E1CA 3KAKA 3NBZC 5EE9A 1F2DA 3FGZA 3PPWA 2DR2A 2G76A 1AURA 2CSXA 2IXEA 5REQA 4CETA 1XEWY 1IJBA 2SKCA 4NV3A 1AA9A 4LPKA 3CZRA 3UAVA 1DV1A 1YDGA 3RS9A 1UJNA 2I1LA 1KEVA 1FFCA 2PRKA 2WTXA 1V47A 2H00A 4LF9B 3AQ4A 2HSGA 3RV3A 1UOQA 2ZGVA 4JT4A 1ADBA 3C43A 3GLFB 4UM5A 3M4NA 3MMNA 3ZDXB 4LX8A 1AHNA 1V7CA 3HJCA 3M6IA 4GSLA 4B0PA 2QLMA 5BNZA 2P9EA 3JALB 3EPJA 1O6CA 3RUDA 1JI0A 2XGJA 1L2TA 4PIVA 3GRPA 3GT3A 3GR6A 1N4DA 2B4RO 4UPDA 3ERCA 2YX1A 2C8JA 3JR7A 3M6FA 2BFCA 1LVGA 4I08A 4MITA 4EG7A 3MWKA 2H4ZA 2WMOB 4JDUA 4INJA 1HYBA 1MAHA 5ALYA 1BO6A 3F6SA 5G1NA 4LQLA 2IHKA 1AGRA 4WXPA 2WD9A 2P8JA 2QZ9A 2XWPA 4B48A 3V3TA 2O2GA 3I3SR 1FDRA 1VCMA 4ZJZA 2GI4A 3QELB 1DEHA 3H4IA 3ZCUA 2J3QA 1DRUA 4H17A 4J07A 4O2AF 3RT1A 4OAPA 1H2FA 4Q24A 1MG0A 2PBFA 4QOHA 4XTCS 3UGQA 4RACA 3W0LB 4BVFA 5FWNA 1KWKA 3CYFA 2GTIA 4TMFA 4N5IX 1H9BA 1MEEA 4IGFA 1U2ZA 3H5AA 5IC6A 5JSKA 4I5IA 4DMUB 4NBTA 2IHNA 3O9MA 2VTEA 2YWHA 5HWSA 2BCEA 1SHJA 3GNTA 4K2HA 1I6LA 3ANMA 1Q7TA 3FDJA 3MTIA 4WV3A 2RI1A 2VP4A 4MW4A 4URZR 3IVCA 4OY3A 4E1BA 3GCWA 4TTSA 3OHSX 1K97A 3RM3A 2UXDB 2DAPA 1NM5C 4BBAA 2XGMA 3RG8A 3ER8A 1F5SA 4I8DA 4EEKA 1RKBA 3C70A 1VKZA 4ZQFA 4B3HA 4GT1A 2W6CX 3RRXA 3NXKA 1KJYA 3R20A 2P67A 1DARA 1KMNA 1SWWA 3RHZA 1HFWA 3KSDO 2WIJA 1E4EA 2PUFA 4YBRA 3L8HA 2BZ1A 1Z39A 3A1NA 3SQLA 5JYBA 2AH5A 1HV8A 4L78A 1R64A 2JCYA 2QRHA 3SXUA 4TWZA 1HQCA 4JP8A 4MLPA 2VQEB 1O97D 5A4FS 2IIPA 3QVGA 2GCEA 2Q3CA 5HQTA 5JSUA 2FJUA 4LSMA 4PLPA 1E9FA 4EL5A 5D6NA 3OTWA 4ZVTA 1AXEA 1CUXA 4IYRA 1OB2A 1YL7A 4RXUA 1LK0A 2UZ4A 1L4MA 2Q4OA 4FJ0A 1XTQA 3FGPA 1GL7A 4EITA 3BCHA 1RIIA 5AVZA 3R5HA 4MROA 1GL3A 1Z06A 3A3PA 1FFAA 1USGA 3HYCA 1PJZA 3DBVO 2G88A 2VWGA 3ZK9A 4EI2A 4U6QA 4F04A 1X38A 5DT9A 1R6BX 5TEWA 1FUEA 3GVPA 3D9QX 3K31A 5F9HA 2YV2A 5DOVA 5ESWA 2PZBA 3HZZA 1VJDA 1O96B 3ADCA 2BHTA 1SUBA 2JK1A 1IEQA 2J5QA 2JAXA 2WIGA 5EFZA 1OXSC 3IR5A 4NK4A 2ID4A 2MU1A 3PS9A 5FWXA 2IIQA 1WETA 2B78A 5CVEA 4UHFA 3L7JA 2QM3A 4NJOA 3QJ5A 5HMMA 1B8UA 1HT2E 1C41A 1CRQA 3IHWA 3RW9A 2BJWA 2ZW9A 3I9NA 3S27A 4B3XA 2F1RA 1Z0ZA 2HA0A 4I50B 3ISVA 5F2NA 4P9NA 1SQGA 2PX3A 4AKSA 4LYDA 4Q4DA 2QRUA 3ZDAA 2FEXA 4BAGA 1JKMA 4LHVA 3LFHA 4PAOA 4ALIA 1IOZA 2Z8YM 1QK3A 5H3HA 2PXAA 1M2EA 3AJAA 5ESDA 2C7BA 3AIKA 4DT1B 3K1ZA 3NZEA 1U4OA 3RU7A 3DDNA 4U1RA 3WWZA 1NDQA 1Z6PA 4Q1EA 2FWMX 4MRNA 4POAA 4PEVA 5CFOA 6NULA 5LYJB 3L6CA 3BM5A 3QZUA 5THQA 3S5UA 3EOAI 1EDOA 1X86B 3BL6A 3WKAA 4UAJA 5LKRA 2LZ0A 2YINC 2XTJA 4EKGA 5A06A 4DCOA 1GZUA 4AYWA 5KAMA 4J16A 1L5LA 2IITA 4KQEA 2V4ZA 1N2OA 1P0CA 3A9UA 4UVHA 4HC4A 2BEVB 3QU7A 5B1IA 3TE6A 4BVLA 4E1AA 5LUBA 2ZU6A 3G13A 3H0CA 3LDFA 1CQJB 2X1HA 4QTUB 4Q5IA 3QY0A 5I6DA 2AC7A 4D42A 1XNHA 1IYZA 4EEXA 1V16A 1U8EA 3VAYA 1JDSA 2C96A 1K8YB 2VPZA 3CT6A 3S2UA 1LEHA 3KQPA 3LNTA 1EIZA 1ECLA 2QUIA 2V9CA 3A1SA 3OOJA 2OLEA 3EW7A 1FLAA 5TF4A 4C0XA 5C32A 2V1UA 1R0WA 1ULUA 2JGIA 3I39X 3IDFA 3IURA 1ZMOA 4ADSG 1XNGA 4EM6A 2C8VA 3CNEA 1NLZA 1UUFA 4XB6B 3QNMA 2OXEA 2JIMA 4EECA 3UG7A 2G1AA 1KZ9A 3T5MA 4CZ2A 1KMMA 2PX8A 2PK3A 4BRZA 3NRBA 2MMCA 4TLEA 1I2AA 5GINE 1EI9A 2KB0A 4QO7A 1VDMA 4XARA 821PA 2X0JA 2FPSA 1LW6E 1VGRA 3IT1A 4U0JA 3DO8A 1XCLA 2DRIA 2HKIA 2QV7A 5IC4A 2K5UA 1ZMBA 2VJMB 4D0RA 4FGZA 1JEAA 5B58C 4C0WA 1V26A 1ESZA 1TJPB 4FXOA 1O5TA 1ANKA 1T9ZA 3R0JA 1IQUA 1G2OA 4RENA 5FKJA 3NLLA 2PJZA 3C2QA 2YMQA 1KP2A 3ZBUA 4I5GA 4D81A 2ZSUA 4BPBA 1VPEA 3PFBA 2IDKA 4RHYA 2P4UA 3U37A 3WLRA 5KTMA 1NUSA 1VLHA 2QX9A 3BIFA 4G37A 4J16C 4GX2A 1AQ6A 3AR2A 4RF3A 3R7DA 1IRXA 3MQ2A 3AUXA 3CF4A 4D9BA 4HVAA 1L8OA 5FH9A 4BO0A 1ZRSA 1R0XA 4FZ3A 3PX3A 1D7AA 3Q7SA 4CV1A 1M1UA 2NTJA 1Z9BA 1Z6AA 4LVNA 2ZSHA 4NL4H 1Z63A 5ENVA 3KEOA 3VUFA 3IAHA 4GAEA 4KV7A 4CKBB 4YMLA 4RCYA 3RRZA 1GJRA 1FUKA 2Z9BA 2FR8A 4Q3BA 4R6XA 2HMVA 2GYVA 3CW9A 1QH8A 2ATVA 4FDVA 2BYTA 2EWMA 1CCWA 4EJMA 2Y71A 3I2KA 2RGYA 3LUGA 1X19A 5FA6A 1ZO8A 3Q9NA 2PGXA 5A6SB 4FD3A 3URMA 1IE3A 2XB2A 3RTCA 2LCIA 2VDKB 4PU0A 4BNGA 5IFLA 4F6LA 1ZXBA 1M2VB 2EBWA 3MTEA 4UTVA 4ZDWA 4UU0A 1L5KA 1SRRA 3RAJA 3T1YB 4V3BA 1UPFA 3LUDA 2CJPA 4HNSA 4RVOA 1X0VA 2DKNA 2W9XA 1VRWA 2J59A 5ALWA 1PS9A 3AEUA 4IHJB 2RB4A 3MSCA 4YVFA 2OC9A 3CEAA 4PHTA 4ETMA 3TVYA 2X6QA 5HUHA 1TQ8A 1LWOA 2J9FB 4YWHA 1P4RA 4G81A 3G82C 4C6TA 1J7JA 1I2DA 4AMBA 4MSUA 3PLNA 3B6KA 5JJLA 4PW0A 2XBUA 2JGKA 1YFKA 3BZWA 2HCJB 2FUNB 4F9FA 2VT3A 2M32A 4O59O 5JMPA 3R7SA 1A9QA 2ISCA 2R7KA 3AB8A 4Q4HA 4EF4A 2XX3A 1KZ6A 3H2SA 4YALA 1CVLA 1VKOA 5HG0A 5EE5B 5KX5B 4LZWA 1XZFA 5B1YA 1DEOA 5K3CA 3IVGA 1OUMA 1P5JA 4IDHA 3E4CA 4LTNA 4O1HA 4JI2B 1RQGA 3TW4A 4DS3A 1AZLA 2F43A 1H42A 1HT1E 2XUHA 2XZLA 2CWDA 4JD5A 2AEEA 5IN4A 4KR7A 5DM0A 1JAHA 3S2ZA 1K68A 5J3JA 2FEAA 2GNPA 4GL2A 4TYWA 1C1XA 1YIAA 1F17A 2PZJA 3PR1A 3THXB 4UEOA 1W8IA 3OJLA 3KXIA 5IYZF 1CZLA 5J23A 2GBCA 2GN4A 2NU7A 3IIIA 3VX4A 4L6AA 3WA6A 1D2NA 1GKYA 2K87A 4QKQA 2H29A 1A2QA 2H5JA 4PLYA 1Z3IX 2ESRA 3BSFA 4YMIA 4D4KA 3AR3A 3DAFA 3GL9A 2M9MA 4AZTA 4GRDA 4A6PA 3FVWA 5DNWA 5I9NA 2CXOA 3UK6A 1FCJA 2X77A 2UVPA 1KDPA 2HADA 1OT5A 3VQTA 2Q0XA 5I4KA 4GP9A 5FX2A 1QFYA 1VSBA 3QGMA 1JDJA 2HRRA 3TLJA 2J07A 3U19A 1QIDA 4GPEA 1A5BB 2IBMA 4IHAA 2DFDA 1P44A 2CVOA 1J23A 4R4JA 3K53A 1I36A 4LE1A 3AR8A 1GU7A 1ZU4A 4KKVA 4QYIA 2WA1A 2JAUA 2QSUA 3G0GA 2ECFA 3L5OA 1G2PA 1NSFA 3MERA 4X7BA 5GZ6A 5C34B 2Y0CA 1R2QA 1KU6A 2IDMA 4AUEA 1XTPA 3LQFA 3NYQA 3B9BA 4DEXA 1C7JA 1N32B 2YZ7A 3OZVA 4JBGA 1C9MA 1X2BA 4PX2A 4MK4A 3O2SB 1T24A 1I80A 2GD0A 3G9TA 3STTA 1QO0A 2NZ2A 1P45A 3CV3A 1H2YA 3BG5A 2BEWB 3N28A 4RHUA 2GAFA 4N7JA 3U4GA 3S8YA 2QG6A 4LBWA 3EVAA 3R3JA 2POQX 3AH8A 4L51A 2FMXA 3TEJA 4BE9A 3FUUA 4GQBA 4CIXA 2YNMD 3O8QA 3FJYA 3R4VA 5JDCA 1JLSA 1JN0A 4MR9B 1CERA 4WADA 3IQXA 3VO2A 4WCFA 2B2CA 1UBTS 1DELA 4XWKA 4JMPA 4UFOA 1I6WA 1N1MA 4RUKA 3DM9B 3EISA 3S2SA 2BKXA 4C1NA 2UXBB 3CVXA 2G09A 4XCVA 3GZNB 3HYTA 4DUGA 2GWHA 4MMXB 2SKEA 1Y81A 3PXBA 2MYPA 3O8OA 3WGJA 1MB2A 4ARUA 3RAFC 2ZU0C 2HCFA 4OQDA 1NJ5A 2B8WA 4HUTA 4ND2A 1WUKS 4MA0A 4RW0A 2NOAA 2XMCA 3DMRA 3CUVA 2O3UA 4BX8A 4LYEA 1VBMA 3MWJA 3TSZA 3THWB 5J9FA 5AKZA 2J5KA 3C3YA 3E9RA 3GN2A 3L6RA 1QHXA 3E5NA 4FKZA 5DOZA 1OPRA 3EXAA 3OD5A 4FYWA 2FFRA 3BL8A 2SECE 4EW2A 3EIWA 1SU6A 1GPWB 3C7CB 1C3LA 3WYAA 1DKUA 1RHQA 1ZRHA 2O3TA 2Q2VA 4GGPA 5THKA 3CNNA 1QB8A 2AX4A 1O0SA 4FLMA 1GAQA 3LCRA 1IHOA 5CPFA 4UATA 5LYYA 3JZDA 1DWQA 2CL7X 2FKNA 3OTGA 4N5HX 1N92A 5EVCA 2W6OA 1FJ2A 2DMRA 3H6GA 4G2TA 1V41E 1WU7A 1Z0UA 3K0EA 4RNCA 2G4VA 2EP8A 1YR8A 5FAXA 3FUWA 3THSA 3WLNA 1LKZA 2H59A 2O07A 2FVXA 4B3SB 4JXXA 3TZ6A 3U3ZA 1GTJ1 2R86A 3NCHA 3HLYA 4EH1A 4NCXA 5AK4A 4C7XA 5BMOA 3EOBI 1KARA 3H7IA 3SYRA 5HYVA 2W98A 2QLFA 4BVHA 4WCFC 2RAVA 4LI0A 4XFKA 4DC1A 1XZDA 1COWD 1D9ZA 5TT0A 4X64B 3WRXA 3F5SA 1HMYA 3VR3A 3FPAA 5CFMA 1DIGA 2GR9A 3TI7A 1T1EA 4MA4A 4MGYR 2WZCA 2YV4A 4Z9XA 3U80A 2QRJA 2YRFA 3IIEA 3NHWA 4EATA 1GRNA 1JDPA 1SK8A 4HWPA 1B16A 4TVKA 1Q50A 5E4JA 4OJKA 4OFBA 1M76A 1ZRNA 2G6TA 3PCXA 4YMHA 4AP9A 2UYHA 4DV4B 1W94A 2JFHA 5JJCA 5FD8A 3RTDA 2G1JA 2RCYA 3ESXA 3UMYA 4ZVVA 5K01A 1UXOA 2BJHA 2OO5A 2WYUA 3QLVA 3AR6A 1XTRA 2XMRA 4JIGA 1JFRA 4YN3A 3ILSA 5CBPB 1DS6A 5ALZA 3CNHA 4LJLA 1VSVA 2FSIA 2MWMA 4YJGA 5CK4A 1E64A 1JEDA 1HGXA 2NZUG 4Q3NA 3UXMA 3BB4A 1RLTA 3RFCA 1JAIA 4XDGA 4HYEA 1ZESA 3GT7A 3RFTA 1QLHA 3NR2A 3N87A 2PEZA 4Q9KA 4V0ME 4N0QA 5CDFA 5EZYA 2C29D 3OKFA 4WBNB 1OLOA 3IDOA 1RWMA 4REQB 1A3CA 3EF3A 4UCWA 3WDMA 4L3VA 2WTBA 4L02A 2X5KO 3CJRA 2CLFB 3BGSA 4BEVA 3DLBA 3IUJA 2VF7A 1LRLA 1SCDA 1FBTA 3CRZA 1WU8A 4IZHA 4NDNE 2ZJ2A 1G21A 3QJYA 3SF8A 1F9EA 4M8IA 4JB2A 3ROZA 1VE9A 2FRDA 2C3OA 4Z5XA 2PO7A 2M6KA 4Y2XA 3WLOA 3P9RA 1HK7A 2CF6A 4TN1A 1FU4A 1K7SN 3M34A 3KR2A 4YRRA 3ZU4A 5K0SA 3ONVA 1GKKA 1PWXA 3GFTA 4W99A 4QVGA 2X8JB 3OP1A 2Q8QA 5IM5A 1UXGA 4C4SA 1M2NA 3DCNA 3BH0A 2X2OA 4CODB 5JAMA 2QZ4A 1UXHA 3DDSA 3GNSA 3ICVA 1I13A 3JZIA 2HHAA 1ECJA 4MWSA 3T15A 3BF7A 4S1WA 3KYIB 4KE6A 2IXBA 1E3LA 1Q6ZA 1ECCA 1YC5A 2DFVA 2W5UA 1B8VA 4XYMA 1WNFA 3CLUD 2XKKA 4CM8A 3ZNOA 2OO5C 3I72A 4KQ6A 1NI4B 1U0SY 3KO8A 1OZ0A 4HPWA 2ZATA 1J5PA 1XO1A 4K8RB 5DN9A 3M1AA 1W2GA 3DXYA 4HR7A 2DQKA 1QGED 4NYJR 4Y30A 2CK3A 4OGWA 3WK6A 3WZMA 5A5FA 3AR9A 2IZOA 1JZTA 3KFXA 3QTBA 2QYTA 3W04A 5IBCA 4OHWA 4PLZA 3L1VA 1R6DA 1J2TA 1QORA 2BRUA 2AD5A 5ISMA 1WXFA 4X0EA 4MPDA 3K30A 4G0VA 3RRYA 4PPGA 3M9WA 1HT3A 2JA2A 3IOYA 4UQPA 5D7NA 3G6KA 5EEHA 1QHFA 1FW8A 3H2JA 5FL3A 1GDDA 2Q21A 3WWPA 3KJQA 3KT3A 2YZMA 3O94A 3O8NA 2FFJA 5EWLB 1QH9A 3D6HA 3BFJA 1Z13A 4TV8F 1G8FA 2CUKA 5DFAA 1BHO1 3AU9A 1D09A 2A78A 2OO3A 3IBGA 4JLOA 2FRDC 2GM3A 2Z2YA 3FCAA 4GWKA 4RMGA 4ZO9A 5FWDA 3ROGA 4NXNB 3SZ3A 4QD3A 5ERGB 2O3SA 2ZI6A 4N7MA 4OXRA 5ICFA 1K9SA 2X41A 5E6UA 3ZY2A 5EPOA 1HKUA 2XODA 3OG9A 4CIBA 4XIJA 1VKNA 4PG4A 4FMCF 1FJXA 4TT3D 4QPZA 2BSXA 2F9FA 5HFAA 3TR6A 3D1LA 4KR6A 1Z36A 1AK2A 2IHBA 4IMRA 4KQFA 3QF4A 3QKSB 3ZWVA 2VPXA 4L73A 1AO0A 4RK6A 4AF7A 3A36A 2GJ8A 2PX5A 3EGXA 2C9ZA 2P2SA 3MF4A 4Q03A 4N5NA 5FCDA 1IWPB 2RB5A 2VUSA 3TKAA 3DCIA 3U61B 1O54A 2R68A 3Q0TA 1L7OA 2D5CA 1N9GA 2WSSD 4LIPD 2JFZA 1Z7WA 3SLGA 3RUEA 2FRVA 5KC8A 5LNK6 1D4AA 3SYKA 9LDTA 4IDAA 3NEYA 5I51A 5J4YA 2HSEA 3KPJA 1YE8A 3AP3A 1B14A 3IIMA 4O4JB 1F4LA 5ALQA 1BWSA 2VUIB 3X1KA 2DP4E 4FZRA 5CJPA 4L5CA 4UXJA 2BRUC 3RAGA 5E8RA 1K88A 3PUWA 3JYLA 5G1PA 2J9ZB 4M76B 5SY9A 1YZVA 2BLNA 2ERCA 2X19A 4R6WA 5K3FA 3WK4A 3V8PA 4IILA 3IIJA 4M2LA 3L8YA 3GI1A 2X3YA 3IEIA 4FWIB 3IMEA 2ZJAA 2XVZA 1UDBA 2JFUA 3I04A 4L1KA 1NN1A 4FFSA 3PQFA 1GNTA 1L3BA 2XEXA 3GJ4A 1DJPA 4WXEA 4TWAA 2VWHA 3TCNA 4DAEA 4M8SA 1F2VA 1G6Q1 1WO8A 1WDLA 2WJ4A 3HY6A 5IW8A 2WZBA 1XCJA 2LUOA 2MSNA 4GM4A 5GTDA 1UBRS 3HXMA 2GRAA 3MT9A 3MMPA 2PKQP 2ZDGA 3H9CA 4LRYA 4UHJA 4B35A 1QR6A 2R47A 4D9NA 5IWAB 2QMZA 4A26A 4MEAA 1XRSB 1M6HA 2PRSA 1N75A 2XTNA 1L9KA 1SUEA 2IVFA 1K08A 2C9DA 3FYDA 4RABA 4KXNA 1GP2A 3QBDA 4L5YA 3GD7A 2E2WA 3VJMA 2J0SA 2LKCA 4U7HA 2OWEA 1OHH