2ZYVX

Crystal structure of mouse cytosolic sulfotransferase msult1d1 complex with paps/pap and p-nitrophenol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
289
structure length
289
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
publication title Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
pubmed doi rcsb
source organism Mus musculus
total genus 104
structure length 289
sequence length 289
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zyvX00
4QG7A 4B3CA 5CM9C 1TU4A 2QQ0A 4JLPA 2CCGA 1Z6XA 1HE1C 2VLIA 1P2VA 1ZC3A 2OZEA 2J87A 3D8BA 3LLMA 4G01B 1OT3A 2C77A 2GXSA 2VBCA 4DC9A 5EZ5A 2QSZA 2A3RA 1ANKA 5TDHA 1E0KA 3QPVA 3KDSE 5C46F 2CJWA 3WMGA 2IS4A 4R71A 2FFBA 2VO1A 2O8CA 3QJYA 4AG6A 1NG1A 1OSNA 3FKQA 2ZJAA 2CMKA 1VIAA 3I4LA 2ZIAA 4LV5B 4DDUA 1RKBA 3CRRA 5JS7A 1G41A 4ZDIA 2Q9CA 1XJCA 4RZUA 1NVVR 3VFDA 1ZD1A 1ELOA 4A8JB 3KQHA 1E1RD 1TX4B 1QG2A 3ZZ0A 1XD2B 2EW1A 3FHCB 1U8AA 2GXQA 4DLSA 2Q9AA 2IWRA 5KHOC 2GJAA 1GKYA 4IDHA 1NBMA 2BM0A 5J4HA 2CL6X 4MYTA 2VRWA 2ZPTX 2K5UA 3C41J 4M53A 5GVRA 2VP0A 2GF9A 1XRJA 5IF9A 3A1SA 4PPGA 4K46A 4Q01A 3HU2A 4QJ5A 3CX6A 2CEAA 4WZBE 1A7JA 4LYFA 3GLFA 5LD2B 4Q1AA 4XVUA 1WMSA 5H68A 4DLRA 2B21A 4UNRA 5LD2C 2D74A 2PX3A 2EFGA 3LFUA 5JWOA 1V43A 3NIBA 2Q3FA 4PC3A 1RRCA 2ZI7A 3QSYA 2IEYA 2WSMA 1BIFA 3Q5DA 4IDPA 4PAQA 1GZSA 4DLXA 4HAVA 1J7KA 1KKMA 1ZMXA 1SVLA 4O25A 1AS3A 1VG8A 3Q8XB 5EXSA 4D81A 1HT1E 3CRVA 1S2MA 3WP0A 1YJ5A 2X2EA 4KLNA 3O8BA 1Q57A 4BZPA 2F3TA 5FPTA 3AVOA 2V1XA 1NL3A 4KFTA 4A82A 5LB2A 4TSFA 4F92B 1JXMA 2FEOA 3M4YA 2WWFA 2XNDA 4CF7A 3EC1A 3QEJA 3CPHA 3HYTA 4TTRA 4XIGS 1XTKA 1NN0A 1AK2A 4JZKA 3U7GA 1E94E 2BMFA 2H17A 3BH7A 5CB8A 3ETLA 4W5WA 3AVVA 3R8FA 1FX0B 1YVDA 1SVKA 2XGJA 4BASA 3GLGB 3V00A 4DCVA 1G8HA 1ESNA 3DDCA 1UDWA 4ZV4A 3VAAA 2QA5A 4HZIA 2BWJA 1VG9B 2FZLA 3KXIA 3TUIC 3ZZUA 4BLOA 3ZVNA 1QHNA 1UEJA 4QXAA 3K0SA 5KSZA 2OHFA 3KQUA 2RCNA 1ZJ6A 4BLPA 3PUYA 4ASUA 3QE0A 3KL4A 3LD9A 1PZNA 4JBYA 3W9YA 3SEAA 3A6PC 4N0DA 1QHHB 1W44A 4YXWA 3VKGA 3VX4A 2VP9A 3RRZA 4BWYA 2ZRLA 4HDOB 4TMXA 5FOVA 5JS8A 5FL7D 1ZINA 2O5VA 1W47A 2ZUBA 3P1JA 1IY2A 1FUKA 2GJSA 1ZUIA 2FDCA 4B76A 1I4LD 3A58B 4QM6A 1NIPA 1NVXQ 5DE3A 2O8DA 4YDSA 5D3MA 3BXZA 4O2LA 3BH6A 4GMDA 3NH9A 4AKEA 5L3RA 3VR2A 1ZBDA 1XP8A 3PJRA 4D80A 4JLNA 4Q9KA 4MDEA 1VDZA 3RDPA 1OF1A 1N6IA 1OXUA 5KNDA 3EA5A 4G1UC 4P4TA 2QI9C 4MKHA 3IHWA 1E0SA 2WAYA 4WVFA 4B74A 4HB0A 1XJQA 1VPLA 1P9RA 1ZU4A 4E22A 2QROA 5F2EA 1MV5A 2AR7A 3BGWA 3FTQA 1DELA 2PZFA 4V03A 1W5SA 2ZSBA 5FTMA 4RFVA 2CVFA 1AZSC 5FI0B 4URYR 3AM1A 4OHVA 2HYDA 1J70A 5IRCD 4M9QA 1J8YF 3AV0B 4DUGA 1VMAA 1KI2A 5DHAA 1K5GA 2FA9A 8OHMA 1OW3B 2XZPA 2AWOA 3PG5A 5FBQB 5EP2A 4RSGA 1P2TA 1XF9A 4HLQB 3NBXX 5SZKB 3RHFA 2Q0HA 4KXFB 1IN5A 5F9FA 2PZEA 3U3JA 4V0OA 5FOTA 5C1BA 2VF7A 3KQLA 1GILA 2XITA 3AF4A 3CRW1 1XBTA 1Y3AA 3GJ3A 4EPVA 2ZRCA 3ZIAA 4KU4A 4W5JA 5BYJA 1HV8A 2PMKA 5BXQC 2XJ4A 3WMFA 1T6NA 1G9XA 2IEZA 4Q21A 4CEIB 3ZVLA 3CNNA 3TJZA 3RSLA 1XWIA 2HT6A 3SBEA 2KBFA 1SXJB 1L4YA 2FWRA 1IM2A 4ERNA 1B0UA 2B8WA 3I5YA 2D7CA 3WNCA 4KBFA 2OCYC 1NNEA 4EQ6B 1NN1A 2ZETA 1SXJC 1KGDA 1XEXB 4NTZA 4PTLA 1U9IA 2A7QA 2QMUA 1DG3A 4FCTA 4Q4JB 4F91B 4C0AC 3IEUA 4C2TA 2P3SA 2XTNA 2ZSEA 4DVGA 2O0JA 1UKEA 5JSZA 3THWA 3MMPA 3THYA 2EFDB 2J0UA 1TU3A 3WBKA 3RSOA 3GJ0A 5KO2A 4QGHA 4PC2A 5AUQA 3TW8B 1G6HA 4TZ0A 4CYMA 2D7DA 4GI7A 1XPRA 4MRNA 3WP1B 2VPPA 3A4MA 3P32A 3AKDA 1JBKA 3IO3A 2GHIA 2HCJB 1KJZA 1K8RA 1VHLA 4Q5IA 2ANCA 4M0LA 2PT5A 3B1XA 1N25A 1AKEA 1EX7A 2A5YB 2W6ID 3R20A 4X8OA 5HTKA 1DPFA 1E2GA 1X1SA 4GDFA 4ZI2A 4TYQA 5F9HA 1COWD 1SVMA 2ZS9A 2IHBA 3C4JA 1C1YA 3AP1A 1I2DA 3T12A 1KZGB 4C2UA 2HXYA 3SR0A 2PBRA 2LKCA 3GFOA 1XMSA 1LY1A 3GQBA 4FMDB 1FNMA 5SZJA 5E7MA 2KI5A 2QUZA 1HTWA 2QTHA 2GVDC 4I1OA 2QE7D 1N6HA 1OXSC 3SE0A 3KZ1E 4CT5A 3B2EA 1ZUHA 2ZE6A 2RGXA 1IBRA 4NBSA 5GJWC 4L16A 3VQTA 2VHCA 2GILA 3HU1A 4Q7KA 2ZQ5A 4MYCA 4WZAE 521PA 2CXXA 2Z6VA 4Q4AA 4IDQA 4Q1EA 2WJHA 4BLTA 1RJ9B 3RS4A 4ZI3A 1HEIA 3QF4A 2W2XA 2ZYUX 1WXQA 5FL7A 2H18A 5FPSA 1TF7A 2JA1A 2XSZA 5CDFE 4M1KA 4GOXA 2VIIA 2B7BA 1QVRA 2ZS8A 1F2UB 4QHYA 5AR1A 2J0QA 2CE2X 3I1FA 3BB4A 1W4BA 5L8VA 2XZLA 3FYHA 5J40A 5DYGA 1KK0A 3R9XA 2NZJA 4IHQA 2BMJA 2ZYTX 4X8HA 3HU3A 3BS4A 1R8SA 1OH8A 4QNRA 1NG9A 3VNVA 4DCSA 2F43A 1W36D 2OCBA 1D8TA 2QTVB 3AKYA 2ZE8A 5B58C 4OI1A 1MABB 3U4QA 4IEIA 4OQMA 5C2JB 5EP3A 2WSSD 2WOOA 4M9SA 2CNWD 1CR0A 2NPIA 4X8LA 1YE8A 3T1VA 1Q3TA 1WQ1R 4PQFA 3DZDA 3NHAA 3OHMA 2HJGA 1WRBA 4GOJA 3RRNA 3C15C 3CR7A 2R2AA 4DT1B 1KI3A 5DI9A 3GLFE 2ZRKA 4WZ6A 2JLUA 2QL6A 4W5HA 1A2BA 4GBMA 3U7HB 3AEZA 2BIFA 4LY6A 3AQ4A 1W4CA 4M8NE 4LYJA 4BLQA 3QQ5A 3SI7A 3THOA 1KJYA 2GBLC 3K9GA 5CK4A 4ESVA 3ND9A 4H1VA 2ONJA 4A1FA 3RWMB 1HA3A 1E96A 2OBNA 3QXCA 4TMWA 3SZRA 4BEJA 3QIAA 3AUYA 4B48A 3T5GA 2JLZA 4E09A 2DYKA 5BYKA 1QHGA 2GCNA 2H8KA 1N6KA 1JXOA 1TEVA 4Q00A 4ACAA 1XTQA 2D2EA 121PA 3LAWA 4PO8A 3V4RA 3E2IA 1M8PA 4U7DA 1QHHA 3GFPA 5EXTA 2QAGB 1AS0A 1DS6A 2OXRA 1RC8A 3OEHD 1D2MA 1P9NA 1Z47A 2G1JA 2ZRJA 4E5UA 1A2KC 5J4VA 1P5ZB 3U2QA 2VQSA 4B73A 2REBA 2VSFA 2ZUDA 1EWQA 3TUZC 4M4SA 3T35A 3PUZA 1OLOA 1EFRD 1N5LA 1S9DA 2A9KA 1GFIA 1JALA 1X8JA 1RZ3A 3FGNA 1S9HA 4DLWA 3L0SA 2QT0A 4R9UC 3ICQB 3LA6A 3NEYA 3C5HA 1ZW6A 3VR5A 3D3QA 2EFHB 4I1UA 2QNRA 3U5ZB 2ZREA 3NHBA 1BMFD 5KPDA 1L8QA 3NKVA 4Q1FA 5K8IA 1KNQA 4RVCA 4TMZA 4OK3A 2KE5A 4KITB 4KVAA 2AN9A 3L0OA 4BFVA 3K9LA 2NOAA 1P61B 1XXHB 2I4IA 4GOKA 3LNCA 1CRQA 3NWJA 4N0EA 3WYAA 1OHHD 2V8OA 1W0JA 2W6IA 1YKSA 4PC6A 1GNPA 1QHXA 2WHXA 2J7PD 3LVQE 2GKSA 2QBYA 1Z0KA 3W6PA 4BFZA 2B92A 1COWA 1N6PA 2NO7A 2IYQA 2O52A 3RS5A 5KUTA 1JR3D 1MOZA 4UKDA 1T3LA 1E0AA 4BFWA 1U8YA 4PSAA 2WM9B 3F0TA 3K0CC 4PZLA 4KO8A 2QE7A 4KODA 3H2YA 1US8A 4NHOA 2PJRA 3HP1A 4II7A 3X1ZA 1RW4A 3UXMA 2YKGA 3P4XA 2R6FA 1CTQA 2MSCB 3LBIA 2ZE7A 2BKEA 4MA4A 3LBHA 3FHTA 1JQLB 3QXSA 3UPUA 2NO1A 2ECKA 3A4NA 2OE2A 4B3BA 4C4PA 4ZDKA 4W7SA 3CH5A 3BERA 4S2EA 1R10A 2QRNA 5KNCA 3CF0A 1XEWX 2OT3B 1NLYA 4US1R 3O47A 4HAXA 3GJXC 1NMZA 3GFTA 1PUIA 2YNMA 1C9KA 3R7WB 1QF9A 5KOYA 3H1TA 3V9PA 4BFUA 2WMNB 5IDVA 4MGYR 1W2HA 3K0FA 1VG0B 1G291 5JJIA 1X6VA 5TB5A 3GJ5A 3UATA 1U99A 2WKRA 4IOKA 1KIMA 2GJ9A 3HR7A 4YLGA 4TTPA 1R0XA 2GNOA 4LJ6A 3Q7QA 4NYMQ 4Q4JA 4QNMA 2CLDX 3LXXA 4UNNA 3U44B 2G88A 2JJ1A 4Q19A 1FL9A 2L0XA 5FTNA 1NBMD 5TMPA 4UXIA 4JLOA 2CNWA 4OK5A 4V0NA 4Q03A 1HT2E 3B60A 3S1AB 3B1VA 4JL8A 4B43A 2YVUA 4C0JA 1JPNA 2EYUA 4EDHA 4TMVA 4L8GA 2IX3A 3K9HA 4NCHA 4R2IA 5CYPA 3IQXA 2N1BA 1G19A 4QBGB 2O8BA 2EU8A 4NYJQ 2QZ4A 4EFNA 1BO6A 3FVQA 5UKDA 4JLVA 3WRYC 1SQ5A 1BS1A 2RMKA 4G3XA 2C03A 2V4ZA 3EA0A 3ND8A 5DN6D 2WIBA 3W90A 1M7GA 3BFXA 1CU1A 2ZTSA 3KFXA 4XH9B 3B1WA 1A4RA 4US0R 1GL6A 2VSXA 4FWTA 1JI0A 3BD9A 1IHUA 5BN4A 3AVYA 1Q20A 3CNLA 3JVVA 1ZNZA 2R6CA 3EZFA 5C18A 2GETA 4MITA 3DEFA 4HEJA 1SVSA 4QBHA 3B5JA 2OCPA 3L0PA 1E2NA 1NVUQ 2ZITA 4TL8A 3Q85A 2OFXA 4JT2A 2ZI4A 5E7IA 5EE0A 1WB9A 1D6JA 4RD1A 1QHYA 2OO7A 2F9LA 4TSFD 2XJ9A 4FXPA 3UK6A 4A6XA 3CWZA 4UJ3A 1GWNA 3MLEA 3IKJA 3BJIC 3KTAB 3ZLJA 1XCGB 3GLHB 4M22A 1UDXA 1HY3A 4O2RA 1EFRA 2C2HA 1PLJA 3KKMA 1OH6A 1E9SA 5FOXA 4CRWB 5LBIA 2C98A 1Z0FA 2EFEB 3MSXA 1N6RA 4YQFA 4HSEA 5K8TA 1F3OA 1P2UA 4MKIA 1CJUC 1E98A 1JJVA 3KJGA 4V02A 3OZXA 2GAOA 4Q48A 1N5JA 2BJWA 3LY5A 3Q3JB 1Q21A 3LW8A 4G5RA 3I8XA 3K0EA 1GL9B 4ASUD 4OQXA 1E2DA 4G5GA 3AVWA 2GWHA 2OBLA 2P2LA 3Q72A 1Z0AA 1R5BA 2AX4A 3NDBB 3I5XA 1ZCBA 4M1MA 3PUXA 1E9FA 2R6DA 2GZDA 2AD1A 4G0NA 5JI2E 2NTYC 2GCOB 3X1DA 4PX9A 4NONA 1OHHA 4XTRA 4DB4A 1OFIA 1LS1A 1X8KA 1TADA 1ZNXA 3AF1A 4P4SB 3TH5A 1G7TA 3AGQA 1KO5A 2J7PA 1S96A 4FMBB 4LSGA 3T06B 4DWJA 3GJ6A 2C9YA 1TL7C 2J59A 3OIUA 4DSNA 3PEVA 2ORIA 1G17A 1JPJA 2E1RA 1L2TA 3K0AB 3DPUA 4XVQA 2XTZA 5GADl 2JATA 2D06A 2IYZA 2YOFA 2JJ8A 2ZRDA 4YMUA 1CIPA 1Q1BA 1UKVY 2WKPA 4D4KA 2BJVA 2LKDA 2QPAA 1MO4A 4TLBA 2ODWA 4TT3A 3ADCA 4TMTA 1VKJA 3OEED 1A82A 4IKEA 1SVOA 4CIDA 1G3RA 2QGZA 1R0ZA 2N42A 1BYIA 2FFAA 1Q0UA 3AP3A 2P65A 3GEEA 5C4MA 4D82A 3EX7C 1Z5ZA 2R6GA 3CBQA 3EZ6A 3BK7A 1AZTA 4FMDF 721PA 1EESA 1KTVA 1NKTA 1IAQA 5B30A 1LVGA 2A30A 4CEHB 1ZC4A 3RS7A 1RVDA 3ASZA 5DI3A 2YOGA 1ZVQA 5G3YA 1IONA 1N2CE 2ZI5A 2VH5R 1KI8A 1PLKA 3LX5A 1OXXK 2IUSA 4DUGD 4ZIRA 4LGMA 4ZCLA 4Q7MB 2ZUCA 4Z54A 2YV5A 5DHFA 4I99A 1U0JA 2ZJ8A 4A0HA 4CEJB 1G5RA 2RAPA 4C3ZA 2IC5A 3QVVA 1AA9A 1UKYA 2VF8A 2GRJA 1D2NA 1Z3IX 3TE6A 2IYXA 3IPXA 1UAAA 1VHTA 4KFSA 2AK3A 4ZO4A 2V54A 3X2SA 4A8JC 2RHMA 3PV0A 3EWSA 1HYQA 1Z6GA 3EZ9A 2ZRBA 1CJMA 5JHHB 4U5XA 1D2EA 3TRFA 4A2QA 3A1TA 4DBLC 4GMXA 3ZIAD 1KSFX 3K9NA 2V1UA 5DO9A 2HLDD 4TYYA 1OPXA 1E2LA 4NU0A 5JHGB 3KB1A 5FTKA 2UKDA 3A8TA 2WWGA 3PITA 2H16A 5BQ5A 2ZS7A 4Q1CA 2QM7A 5DN6A 5H1YA 2WWIA 4JIMA 2O8FB 3VKWA 1Z06A 1NY5A 1N0UA 2R44A 4MGZR 3SS8A 1YRBA 2OSBA 2PT7A 4URZR 1UKZA 3N5CA 5JRJA 2R8RA 3ADDA 3QPUA 3B9PA 1EWRA 3VNUA 4AG5A 1DARA 4HDQB 3NVAA 5B64A 2F1RA 3H86A 4TWZA 5FBVB 4NE2A 3OAAD 1B23P 2IHYA 2RGNC 2CCJA 1KAOA 5FBRB 1Q1ZA 4OHZA 3GLIB 5JZVA 2I1VB 3A1UA 2Q3MA 4I4LA 1R8QA 4B35A 1T8TA 2GJKA 5FPHA 2JCSA 3EIQA 3L82B 1GKUB 3VHLB 1ODFA 1W1WA 1ZIOA 4EPRA 5IK2A 4WXRA 4MRSA 5BN3A 4OKSA 3ADKA 2FX3A 3A4LA 3D31A 1MH1A 3B6EA 4LV8B 3AVXA 1II8B 3NTUA 4KV9A 1NI3A 5KDDA 2ZSDA 2GEVA 3CRMA 3QKSA 1WE2A 2XXAA 4ARZA 2JDID 5BWMA 3I73A 3EPHA 3MWJA 1KI6A 1F2TB 4IDNA 2QMHA 5DIFA 4BFXA 1JEDA 2CBZA 3SC3A 5HE9A 3VU9B 1HH4A 1KYIA 3DL0A 1BYUA 5EP1A 1M2OB 4P33A 3QUSA 5EUQB 4OBEA 4DEYA 5H70A 3UG6A 4D0NA 1DOAA 1XD9A 1Z08A 5KYKA 3TQCA 1T0HB 4PHTA 3S1AA 2AXPA 4GP7A 1Z8FA 1Z83A 1E2EA 1TQDA 5HCIA 2PJZA 2IA5A 2IYYA 4Q4HB 4YONB 3KQNA 3MJHA 3QKRA 1H8ED 4XD7D 4XWAA 3PCRB 4OQLA 2XSZD 5KSYA 3SHFA 1R0YA 1SKYE 3ICEA 5HPYB 4EUNA 1P73A 4URUR 4LRWA 3RYTC 2DWQA 1MRNA 2H5EA 4V0MA 3WYGA 4QHTA 3EPJA 4XVRA 2ZANA 1IJEA 1DO0A 4RD0A 3KKPA 3N2EA 1IN4A 5CYOA 3TVTA 4TTQA 2LWIA 2GEDA 1NRJB 1DAFA 4K8OA 4XSGA 2F6RA 1KZ7B 1E79A 1Q44A 3OEEA 3QG5A 3A37A 2QU8A 4HZUB 3VKHA 2VHJA 2HJVA 1SHZA 2ZE5A 1OFTA 3AGPA 1I2MA 4GRAA 4JKIA 1KMHA 1LW7A 2XX3A 2O8EB 1G3QA 2AFHE 1G3MA 3KFVA 3G5UA 4RD3A 4KFRA 1DADA 2BEJA 3AUXA 4AIIA 2ZRGA 4KYUA 4AWXA 4JL6A 2PZGA 4KSBA 4BQSA 1AN0A 2IWHA 2ZR9A 3SU8A 4Q9JA 1XX6A 2QP3A 4C7OA 3GLHA 4A0RA 1OXVA 2OM2A 1T3HA 2KJQA 3GJ7A 1RYHA 4DIDA 1BOFA 4EJSB 3LLUA 4JYBA 4LI0A 4D4LA 4DCTA 4LBVA 3KJIA 3CH4B 1U8ZA 1OV4A 1EFCA 3UWOA 5JCPA 4EJSC 5EE5B 4Z8XA 3CLVA 3L2OB 1XTSA 2IK8A 5KSPA 1FQJA 2QP9X 2W2VA 2N46A 4HLDA 2J41A 4I1SA 1YZLA 4W9MC 4A15A 2J0VA 2RKOA 3JZMA 2D2FA 3JVUA 1VECA 2PEYA 4JLKA 3QVUA 5F3WB 2HLDA 5EUMA 3PR1A 3ZVRA 1E1QA 5P21A 3VX3A 4JLBA 4ON9A 1P7CA 1YZNA 1TQ6A 1DO2A 1G8YA 1LNZA 2Q21A 2J7KA 1VG1A 4JVLA 3UG7A 1UM8A 2DWOA 4J0QA 5B2ZA 3BB1A 4ITRC 2O0KA 4LX0A 2WJGA 2KBEA 2QGNA 5FTLA 3SJBA 4CGZA 4DCUA 2Q9BA 2KB0A 4P3YA 1NJGA 5E4FA 4GT1A 3T61A 1CRPA 1HURA 1V5WA 2EFCB 4UXJA 2XB4A 1R5OA 3AF0A 3GEHA 4NYIQ 3BB3A 1T91A 3OAAA 5FUXA 2ZSAA 1RIFA 4Q4LA 4BRWA 1YQTA 4TLCA 1ETUA 1GNRA 3H0KA 3X1WA 4TYNA 5CB6A 3E70C 4HAWA 3ZS9A 4B2LA 1Q1QA 5GJCA 2YINC 1DAGA 2QSYA 5KDLA 5HCNA 1UPTA 5B57C 2ORVA 3ZQ6A 5GVSA 2IXEA 2GA8A 5FUVA 1XEFA 4RFSB 4JSYA 2HF8A 1W0JD 1W36B 4FINA 1W5TA 5KU1A 4LJYA 3WBJA 2ZM5A 1OFHA 3HDTA 1NMXA 1W4RA 2JDIA 4PO1A 1ONBA 4QGAA 2PX0A 1FP7A 1KSGA 4MRPA 2RGEA 1FOEB 2A2ZA 2QENA 1JR3E 1IN8A 3DHWC 4HUQB 1E2HA 3B1YA 4OHWA 4A8JA 4QBFA 1G1MA 2IT1A 4PAOA 3T1QA 3T5DA 1N5IA 2QORA 4JLAA 3GPLA 1XD2A 4G5SA 2WVJA 3A1WA 1XTRA 3K53A 4DB2A 1EG7A 2R62A 4O0MA 3QKUA 1UBGA 2B8TA 2GXUA 4M2LA 4RKFA 4LBYA 3CW2A 3PUVA 3QBVA 1QVAA 1H8EA 1YRAA 2WMOB 4KYIB 4MDFA 4NH0A 4XD7A 4KAXA 4AK9A 3QXJA 3T1TA 4C30A 1FUUA 4EFMA 5E3HA 3MG9A 2V55B 2AD5A 5EE3A 4RKEA 1TEXA 4OHXA 4H9GA 1FFHA 2JLWA 1SXJD 1J8MF 1Z0IA 3MWYW 3K1JA 4DDTA 3CR8A 2BBWA 1T0JB 2DY1A 1W4AA 4A2WA 5FH9A 2RGNA 1QHSA 1OJLA 2Z5FA 3I8SA 1NN5A 1M7BA 4HLUC 1P72A 1U98A 4AY2A 1YHNA 3OIVA 3SFVA 2ZRHA 1EXMA 2JJ1D 4HAYA 3SYNA 3B7GA 4MRVA 2IYTA 4M1TA 1G8FA 2QQEA 5E7JA 3NC0C 1NBME 2ZJOA 4BRUA 3NBZC 5DH9A 3P20A 2HCBA 1I4DD 3KUDA 1ZUNB 4RZ3A 2MMCA 2NIPA 2R6AA 5G3ZA 2IYWA 3SDZA 4D0LB 5AWFC 2J9RA 1ZRHA 4WIAA 4RCYA 4WBSA 2BOVA 2HYIC 1OIXA 5J4KA 4O3MA 1SHKA 1FX0A 2QN6A 3GLGA 4PANA 3QY0A 2IUUA 3ADBA 5A0FA 1N6OA 3A36A 4RD6A 4AYTA 1YR8A 1SKQA 4QJ3A 2DHRA 4LCBA 4Q7LA 4YMTA 3EWAA 3W8NA 2YYZA 1XPUA 2UZIR 3U7FB 6Q21A 2WIAA 4MYHA 1TQ4A 2RGCA 5EE9A 1GSIA 1KDPA 2YWGA 3B85A 4QBIA 1H8HA 3E5HA 2VYFA 2A5GA 3IDQA 3U3RA 1KY3A 5M04A 4HAUA 3FFBA 2RGGA 4NMMA 2WJIA 4IXMA 4LYAA 1S8FA 3D6TB 2QAGC 4S35A 3ECCA 4D4MA 1UFQA 4Y0AA 3B9QA 2RGAA 1Z07A 1E2IA 4Q02A 5A5GA 2IW3A 1GP2A 2JGNA 3IBYA 4U02A 4EFLA 3W6OA 2H1LA 1LTQA 1UADA 2GESA 2IBMA 2BDTA 3H84A 3TSWA 1P2SA 2ZVPX 4L9SA 1ZCAA 1WBBA 5TY0A 2V7QA 3OIWA 3REGA 4PFSA 1DBSA 2IL1A 1VIYA 4PC7A 2WOJA 5HZHA 2O8CB 1G64A 2YZ2A 3F3YA 3WYFA 4E03A 1J90A 2DBYA 4ZKEA 5AJWA 4ZCIA 1CP2A 1FNNA 1IY0A 1AQUA 4NCKA 5EXXA 5JBQA 5K8UA 3NH6A 1G21E 1JECA 4HATA 2JLSA 1E3MA 2O8EA 1G8PA 3BIFA 1DAHA 3DM5A 3OE7A 1XMVA 4F4CA 1W0KA 5CIWA 2FNAA 2ANBA 2QT1A 2SHKA 2WV9A 2LCFA 2MSDB 2VEDA 4HLCA 1Z28A 1X1RA 3IPYA 1EX6A 1L4UA 1GOTA 3DOFA 5LDDC 5JJLA 4IFBA 3I61A 3CWQA 3FWYA 1XMJA 4I81A 5JMTA 1F6BA 3FMFA 3OESA 4NDZA 3AP2A 3TGPA 2J5XA 2Z4SA 1R2QA 4XWOA 2J0SA 1OIVA 3E1SA 3X1YA 4OQFA 2ZJYA 5AUOB 2Z4RA 3KJEA 3M1IA 2FH5B 3ZH9B 3GLFB 2CHQA 4IOMA 2PLFA 3QNUA 2XB2A 4TT3D 4LHYA 2ZXUA 4C9BA 4HB4A 3C5CA 4LHZA 4AI6A 1RRGA 3CPJB 4A9AA 1ZP6A 4UNPA 3TIFA 2GAAA 2BVNA 5FBLB 4CVNA 4NYMR 3D7MA 1CLUA 1E9DA 3DVLA 3NXSA 4PR0A 2F55A 1YZTA 2FGKA 3KKQA 1CS4C 5KTYA 2YC4C 1D5CA 5TXGA 5G53C 2GVZC 3U6BA 3FOZA 4CEIA 1H65A 2BV3A 3IIJA 1UBFA 4HYYA 1E99A 4K81B 4RZ2A 2NG1A 1SXJA 1GL7A 2C95A 1DVRA 3BC1A 3MAAC 3TLXA 1Z2CA 1XNJA 4NYJR 1KK3A 3U6KA 2C9CA 3PXGA 4EQ6A 2F1IA 3I92A 4ZDWA 4PAMA 1KKLA 2YHSA 2W0MA 1XEXA 3I72A 4B6FA 1EFTA 5K8LA 1DAEA 4MUAA 2B7CA 4IEEA 3BFVA 1YZKA 2BBOA 2DR3A 4FCWA 4A92A 3W3AA 1FP6A 1MR3F 1T5LA 1P4SA 3Q7PA 1GUAA 2IYSA 1DAMA 3AKEA 3TR0A 1UF9A 3ZQJA 3BBPA 1NP6A 1T8UA 2CCKA 4RJLA 3K70B 3AVPA 3NBFA 3UIEA 4KJZA 1L7VC 1JAIA 1NKSA 2F9MA 5ANRB 4BPBA 1DE0A 3ASYA 4IFEA 4NCIA 1CR1A 1WCV1 3CF6R 1LF0A 1Z29A 4FIDA 2WWWA 4JSTA 2ZI9A 4D6PA 3K70C 1KK2A 1M1YE 5LB4A 1UEIA 4B2PA 3UMSA 4HB2A 1JEEA 4EIWA 2OAP1 1KK1A 5CLLA 1FTNA 1HUQA 3GJ8A 3W6NA 3LW7A 3IHLA 4ILEA 1S4QA 2XOKA 5JWRA 2QAJA 1Z0DA 1T5IA 1VCMA 2FU5C 3QBTA 4MH0R 4P31A 2XNSA 1E2PA 1R4AA 3KUCA 4QHSA 1JJ7A 4IXNA 1P75A 3M0EA 2FSHA 4Q9LA 4R2HA 3EASA 2OXCA 2JLVA 5J47A 1HQYE 1GKIA 4M1SA 1OKKD 3WMEA 2OFOA 4C0LA 4JLMA 4A4DA 2CHGA 5L3SB 4GP6A 2Q6TA 4KVGA 1KDOA 1RJ9A 1NSTA 2CLSA 1P3JA 2R65A 5IK2D 4IVRA 4L5BA 2DFNA 2MMGA 2A78A 3IILA 3TNFA 1CBUA 5D3MB 1IJFA 2O8DB 2RHDA 1G4AE 2DFKB 3K09C 1XTJA 1N0VC 1MT0A 4D2IA 2CE7A 1E2KA 1F2UA 2AHOA 4IOJA 1NN3A 1WF3A 1QZXA 3LDAA 3CNOA 2EYQA 4G5QA 4LDJA 4HLUA 2BBSA 2PCJA 4DXAA 1TF5A 1FMLA 4RY2A 5KSOA 3QG1A 4BFSA 4HDCA 1S1MA 3KX2A 3J81k 2AKYA 3IQWA 4MRRA 4BZQA 1MABA 4DLUA 3PIRA 4KBGA 4L4UA 4DIEA 2WJJA 1O87A 4PXAA 3MWKA 1GTVA 4TQUS 2BCGY 4NKRA 1PUJA 5FUYA 4BLRA 5JI3E 4A2PA 3NDPA 5FL3A 2NZ8A 5FFMA 4ZDJA 3CM0A 4NL4H 4DSUA 4DT1A 4JS0A 3SJZA 2I1QA 3ZS8A 4IW3B 1ZM3A 2C04A 1OXTA 2GBLA 3DM9B 2WKQA 3CB4A 1XMIA 1CJVC 4DDVA 1FW6A 4AKGA 4GL2A 3PENA 4C0KA 3BAFA 1VYUA 1KI9A 4WW0A 2P67A 4MQBA 1F48A 3WXMA 1UBEA 2FF7A 3OFNA 4ABYA 2ZJ5A 4C0QC 3SBDA 1E0JA 4YC7A 5JRZA 1Z63A 4TZ6A 2DFTA 2E9SA 4RCZA 3RC8A 4ESHA 2RB4A 1Q3HA 1E79D 3MGCA 3H4MA 2ODEA 3RS0A 1N6NA 4LOAA 5D3QA 4BUJA 5FTJA 5KDOA 3ZVMA 4LJ4A 2RGDA 3HR8A 2QAGA 4QC2A 4B75A 2GK7A 2VP2A 3M6AA 3TK1A 3BRWD 4ZKDA 3TVDA 2VHTA 1NF3A 1KAGA 2TMKA 3CPEA 3QI2A 3G0HA 2ZYWX 2DB3A 2IS6A 2OUKA 2JLQA 2W0SA 4KHZA 4D26A 1D9XA 4JBWA 3ZJYA 1LFDB 4KFUA 2CHVA 5JSZB 1G5TA 3BORA 3THWB 4EPXA 4TLDA 3NEJA 3THYB 2J0UB 1CXZA 2W58A 1XCMA 2NMVA 2PH1A 1U9IC 4BLSA 1ZD9A 3AH8A 1T3SA 3C8UA 4OQNA 3RANA 1TF2A 3GLGE 1J99A 5FOUA 5JEEA 4C0HA 1LB1B 5EQTA 2FSGA 3VR6A 2REOA 3SQWA 1HE8B 3SOPA 2WJYA 2J3EA 3CONA 1JNYA 5CDFA 1U90A 2AFIE 2WPDD 5CJ2A 3PEWA 3CF2A 2C78A 4Q66C 2X1VA 2GXAA 3GD7A 3HPRA 2EWWA 2Y8EA 1E2FA 1KO8A 2GTPA 3CX8A 3IBGA 3QEOA 2GEUA 3EPLA 1NIJA 1XXHA 1E9CA 1OB2A 1E1QD 4XSHA 5IHPA 3U7EB 3I32A 4L15A 2YWHA 2QP4A 2WZQA 5DGXA 3AB3A 1DG1G 3UANA 1OE0A 4PC1A 5FOSA 3VMFA 1XPOA 4NPHA 3K0CA 4L9WA 4B47A 3TSZA 4AKIA 1DAKA 3L8ZA 3GP8A 2J46A 4Q4AB 4XOIA 3KKOA 3PEUA 4R7ZA 2ZYVX 3REFA 4Z51A 3IUYA 1XDBA 1W7AA 1OYWA 3NG1A 4GPTA 3QF4B 4RZXA 1KHTA 1M6NA 2QEQA 5J4YA 1OKKA 3RRMA 3N2IA 3OIYA 4A0FA 1NVVQ 1E9EA 1YU9A 1KSHA 3FMIA 2OG2A 1SZPA 4EKDA 4Q1BA 2CLCX 1CKEA 3EW9A 2YWFA 5AUNB 3EARA 2NGRA 5JCZA 2ZI6A 5SZHB 5A4JA 3RVBA 1N0WA 1R6BX 5FPKA 1OH7A 4B3XA 4IOLA 2F43B 4HUTA 4DSTA 1SGWA 1QDEA 1ZM7A 4IVPA 4GSYA 3R7WA 4LV6A 3LRPA 1TUEA 3LBNA 3U4QB 2XEXA 2G3YA 2ZAMA 5GJVC 2GCPA 1KI1A 5LPNA 4GFDA 1XZQA 1NSFA 3L8YA 3ZZTA 2ZJBA 3BOSA 4TLEA 4FWIB 2C9OA 1M7HA 4URVR 4LPKA 2GF0A 3PQCA 3U44A 1QHIA 4U00A 2P0EA 3W8RA 2P5SA 3ZDQA 4B44A 2CL0X 3BFKA 4F7WA 2ZRAA 3P4YA 2AWNA 1ZD8A 2H57A 1U94A 1PLLA 4LBWA 1U0LA 2BM1A 1KMQA 3FDIA 1CR2A 4DJTA 4JLJA 5FUWA 2FPKA 2V6JA 3UMFA 4F4JA 3VR4A 3BE4A 2ASEA 3KXKA 1OFUX 1YR9A 2QRZA 2OEPA 3CRQA 3EG5A 4DRZA 4EPTA 3LH5A 5CM8B 1CJTC 2ZJZA 1XZPA 1DEKA 2BC9A 1SXJE 1OYYA 3FKSD 3W3ZB 5CLQA 1GNQA 3WHKA 3THXB 1XCPA 2EWVA 2C96A 5G40A 2Z83A 3SNHA 3AVQA 4CDGA 1KO7A 1G5PA 2XAUA 2W83A 3PUWA 621PA 4OYHA 4KSCA 2ZSFA 1G16A 5TARA 1G4UR 3P27A 4RD4A 3W5JA 5L3SA 1XJ0A 3K09A 4EPYA 4OL0A 3CZPA 5FI1B 3C16C 5CIQA 1RYFA 3EXAA 5E95A 2ZRMA 3ONWA 1E32A 4BGDA 5HR5A 2GDJA 2OESA 1W46A 1PV4A 1E4VA 4B33A 1ESMA 2IXGA 3KTAA 3GCGA 2BHRA 2VTKA 4H1UA 1Q12A 1JB1A 1QG4A 2F1JA 2QM8A 4TL7A 3A1VA 4LYHA 2P5TB 1S0UA 4P4UA 2IS1A 2FJUA 1E69A 2OLKA 4V0LA 3R8CA 4QJ4A 4OK6A 3T34A 3VR3A 1G18A 1QBKC 2FFQA 1M74A 2WAXA 1PJRA 3O8DA 1KI4A 4LC1A 4LJ7A 1SULA 1HQCA 2OAQ1 4LK2A 2QMEA 4NCJA 4AYXA 1DAIA 1ZU5A 2WPDA 1H8HD 2QBYB 3MUFA 2KSQA 1A1VA 2NO9A 1VCIA 1Y63A 3U61B 1JR6A 3EIHA 5JFGA 1ZM4A 5HZKA 4NYIR 3MRSA 4LHXA 2GCOA 2QMOA 3QKTA 1TTTA 4WA7A 4BEBA 1E9BA 3I62A 1FMJA 4BZXA 1GG2A 4A6PA 4NP6A 4P4SA 1E1RA 4C0BA 3KKNA 4JJKA 3RNLA 4DSOA 3TR5A 4BE7B 3KB2A 2WTUA 1US8B 5JWHA 3UKDA 3PEYA 4MGIR 3DMNA 3TBKA 2FN4A 4FD2A 1CEEA 1LF5A 2AK2A 1T4GA 3K0AA 2JASA 2ATVA 3N70A 1WA5A 3B8HA 3DZ8A 2V7QD 2X77A 4FN5A 2P6UA 4FI3C 5HKKD 3LVRE 2J1LA 4MGKR 1G3UA 5JECA 3MJRA 4B3DA 1SKYB 2XZOA 4DKXA 1SVWA 1ZAKA 1GRNA 2ZVQX 3SYLA 2GZAA 3PVSA 2H7VA 1R0WA 4TL9A 4JBXA 2ATXA 2ZRFA 1AS2A 5L3QB 1EFUA 3OF5A 1S3SA 2JLRA 3Q9LA 3OE7D 1YR7A 3K0FB 2ZU0C 1W0KD 2UZ3A 5CK5A 2FPLA 1I4TD 2MSEB 4TMKA 4UJ5A 4DZZA 1WDTA 2HXSA 3EAQA 4TLAA 4CEHA 5ELXA 3AKCA 4JJZA 4E07A 2ORWA 1SVIA 2B6HA 1VYTA 4M21A 4OI0A 1AM4D 1KDTA 1GIAA 2FG5A 1ZNWA 1Z2AA 1W36C 3EIEA 4KLZA 1A5TA 4AC9A 2PL3A 1XB2A 2ODNA 1YZUA 4CEJA 4QGGA 2ONKA 4OJQA 2OILA 3FMPB 2V3CC 2FOLA 4I1VA 2O8BB 1Z0JA 4LZZA 4YDHB 4ZCMA 4PQYA 4LHVA 3RWOA 2ZR7A 1N3BA 2OBMA 2BEKA 2WBLC 1Z22A 2CK3D 2YOHA 4D0GA 4IRUB 1AQYA 3WRXC 1X3SA 1IXRC 3TQFA 4M9ZA 2X2FA 5BW8A 1TNDA 1D9ZA 1VYVA 4YMSA 2FE4A 2ZI3A 4FCVA 4PPFA 2JJ2D 1PVOA 1VTKA 2C8VA 4JLDA 1P6XA 1K5DA 3TAHA 4Q9IA 1JAHA 4JVSB 3DKPA 1NY6A 3DOEA 1KY2A 3CO5A 1O3YA 5AJVB 4OI2A 2G9NA 1Q22A 3MD0A 5AJZA 2JLXA 2O8FA 5KPJA 3FKSA 4YMWA 5AJXA 4B3FX 4CZ2A 2F3RA 2A5DA 1GITA 3KJHA 3FPAA 2DFLA 3RS3A 1F5NA 3IIKA 3MCAA 3MFYA 2HT1A 3L43A 2WWXA 2DPXA 2C5LA 3FE2A 2FFHA 1OIWA 4FMCF 3CKLA 3AF2A 3RLFA 1OH5A 2HDNB 1FQKA 1R5NA 2EVWX 3SJCA 3P26A 821PA 3O8RA 3GLIA 1OB5A 2ZR0A 1NVWQ 1KO4A 5CITA 4DLVA 3RRYA 2NO6A 5TV2A 2FGJA 3LXRA 1AGRA 3IO5A 4RD2A 5AUPB 1XTIA 3G82C 4BFTA 1R7RA 3SN6A 4LJ5A 5FR2A 4IDOA 1XXHE 1II8A 2NO0A 2YWEA 3AF3A 3JZAA 4Q7JB 1ZYUA 4HAZA 4V0KA 1E9AA 1IY1A 3NC1C 2P6NA 1ZNYA 1GDDA 1IN7A 5DYIA 1KI7A 3LQRA 4TN1A 4DDWA 1RPZA 2ZEJA 2H92A 3AVUA 1F2TA 3B78A 4LJ8A 2QPTA 2XOKD 4B6EA 3Q5EA 2QY9A 2HF9A 2D62A 3U3KA 3VU9A 4PZZA 3FFAA 2G0NA 1X8LA 1J2JA 2X8AA 4PPQA 2G1KA 4OI4A 2BKUA 5DISB 1TAGA 2FMXA 2FSIA 2OV2A 3L0IB 1FPMA 5L3VA 4F38A 4MYUA 4N3NA 1E4YA 1XEWY 3DKVA 2ZJ2A 2F7SA 3HPQA 3LO5A 5DNYB 1KOFA 1GVNB 2W6JD 4URWR 3B13B 2QTFA 4GNKA 3TSOA 3KQKA 2PCLA 4Q4HA 4M1WA 4JKYA 3GMTA 1RFLA 2GK6A 1RRPA 2KWIA 1U0HC 3FB4A 5FPYA 3W34A 2HUPA 4PQRA 3T15A 5G41A 5TVKA 2IYRA 3HJNA 3LV8A 2FV8A 2JIZD 3BWDD 4LWZA 4Y0VA 2PEZA 5GJBA 2OCAA 3EZ2A 4MKGA 1KSJA 4IVQA 5SZIA 1Z6TA 3VHXA 2IF0A 3HWSA 1RE0A 3THXA 1E2MA 3FHOA 5J5CA 3B82A 1NJFA 1VCNA 5HKKA 2CJWB 1YR6A 4C0SA 1IOZA 1ZM2A 5FR1A 1P9WA 4HB3A 3IIMA 4LPSA 2EQBA 4HZUA 5EXPA 2WJVA 4AURA 3WY9A 2REXB 3TKLA 1KO1A 2C99A 5DI3B 3U3OA 1TQ2A 5KNBA 1G6OA 221PA 2FSFA 2IXFA 5BN5A 3WHLA 2BBTA 4ZIRB 1K6MA 2XTMA 2AKAB 2E87A 4M1YA 4AYWA 2ERYA 3ZD6A 4D25A 1N5KA 1XU4A 2ZRIA 2ERXA 1P60A 2JLYA 1YZGA 1FZQA 2RGBA 4ZPXA 2OLJA 5DLQC 3GJ4A 3F8TA 4EJSA 3MWLA 4US2R 1UJ2A 2DWPA 3SHWA 4UXHA 1G7RA 1YZQA 2PMDA 4V0ME 2ZROA 3CX7A 4ACBA 2GJ8A 3RS2A 1NLFA 2D3WA 4JMPA 4MUBA 4WOPA 3OFND 4WXPA 4Z1MD 4BECA 3GEIA 3ZYCA 1GM5A 1CJKC 3QXHA 4TYPA 3UMRA 4D4JA 1IQPA 2ZU6A 3IGFA 3U3MA 2WICA 3F5FA 2CK3A 4G5OA 1LV7A 2VL7A 2BMDA 4LJ9A 1II9A 5HE8A 1EFHA 1C4OA 1EGAA 2UVQA 3WNDA 2IYUA 4PHGA 3KXLA 1KNXA 2JJ2A 4JYCA 3SYKA 1II0A 5DSZA 1IXZA 5EE1A 4QRHA 1TMKA 3RAPR 4PSKA 2VP5A 2W2TA 2R9VA 3LWNA 2DCUA 3GLHE 4LBZA 4DLTA 2JEOA 4XTCS 2HV8A 1F60A 1AIPA 1M34E 3LX8A 3TUJC 3R9WA 4QKQA 2VHQA 3QF7A 1Z6YA 1W48A 3VTKA 1W2GA 5IT5A 3IEVA 2ZAOA 2G6BA 2RH5A 3NBYC 5JJKA 4CT4B 2VP4A 2G83A 3C14C 2FEMA 3K8YA 4OHYA 4JVNA 3AVTA 1CF4A 3RC3A 4UNQA 3QKSB 4B2IA 2XXAB 4ARZB 5L3QA 1XFAA 5AJYA 3TW4A 3I3SR 4LC0A 3T1OA 3HYRA 3FMOB 1MO3A 2ODBA 1KI6B 5FOWA 1X86B 3SJAA 3X1XA 4JL5A 4RFSA 2JAQA 4AKHA 1G8GA 2Z43A 3EC2A 1EK0A 1Z6AA 4CW7A 1GAJA 4NCNA 4OJKA 4QM7A 2Z0MA 2AXNA 4TQAA 3B1ZA 5AK0A 1GRRA 3SQXA 2QG6A 1XD8A 2QPOA 2WSSA 5JEDA 1MO5A 1ZIPA 1AKYA 2VP6A 3CUEF 4PSVA 3RABA 2WWHA 4Z8YA 4DHEA 1VCOA 1WP9A 4HUQA 2J45A 4KCGA 2Q3HA 3QKRB 3VR1A 4X8MA 1AJEA 1NLZA 2A5FA 5C4GB 4URXR 4F4IA 1Q1EA 1U81A 3C7KA 2GZHA 1E9RA 4QOSA 2F1HA 5EP4A 1FTSA 4HI0E 4P32A 1T9HA 4YMVA 4A36A 2AL7A 2CL7X 2W6JA 2VHUA 1G7CA 4Q9HA 1G3IA 4QGFA 3QXXA 1E2JA 1NMYA 1MO6A 3DMDA 4JVMA 4M9XA 4XJXA 2IF2A 4QFMA 2IYLD 2WWYA 4BFYA 1CR4A 4GZLA 2JIZA 2X19A 3CIOA 3LQQA 1RRFA 4JT4A 5EZ6B 1S3GA 4M1OA 4DLZA 4LUCA 2A5JA 1IN6A 4DEXA 1KJWA 1W49A 2BCJQ 4KI0A 5H8WA 4LHWA 1KMHB 1GRQA 4B3GA 3OEHA 4WAUA 2ZRPA 2O0HA 5FBWB 4GZMA 5EJEA 4PPNA 4MKFA 2OFWA 4PO9A 4NZYA 2P6RA 3U60B 2XNDD 1P62B 3DO6A 4PHFA 1MKYA 2FZ4A 4TQ9A 3UWKA 4Q18A 1BKDR 4DCNA 1TPZA 2ZRNA 4C7OB 1DTSA 3QPWA 1U2RA 1KDRA 4TYWA 3WNBA 4LJAA 3ZD7A 1LS6A 2G0TA 2HEIA 5JLJA 2VSOA 3K70D 1G20E 1G7SA 4UNSA 2I3BA 2IYVA 4FW9A 3V4FA 2CDNA 4FMCB 3EPKA 2IS2A 1BH2A 5CJPA 3QOFA 2NPFA 1QRAA 2G77B 2D4HA 4PZYA 1N6LA 3R9IA 3ZGXA 1E2QA 1S1CA 4Q47A 4B32A 1BMFA 2YC2C 1TUIA 4EAQA 3CZQA 4EPWA 2V9PA 4TL6A 1IXSB 3BH0A 4R98A 2CVHA 4XWKA 1UBCA 1MRSA 4YXWD 4Z1MA 2BMEA 1CULC 1WBDA 3SFZA 4POAA 4IJMA 3PFIA 2IUTA 2YJTD 4P0TA 1AGPA 4F93B 4PHHA 3W5IA 1ZM9A 4N1AA 4UQOA 4B71A 1E6CA 3GLIE 5F98A 2W00A 5J4LA 421PA 4A0GA 3QENA 2NQ2C 2FPMA 2VA8A 3O8CA 2V6IA 4AD8A 4DLYA 1JR3A 3EZ7A 1JQJC 3TAUA 2PLRA 3TMKA 4B34A 4Q1DA 4QL3A
chains in the Genus database with same CATH superfamily
2HPZA 4QG7A 4B3CA 1W76A 1N1DA 1TU4A 3QTTA 3HBFA 4YK7A 4D6YA 5DK6A 5LZ5A 1E1MA 2EL9A 2CCGA 2E85A 3QMPA 1JKJB 1Z6XA 2JAOA 4CKEA 1DKMA 1QYXA 3D6AA 5KCMA 2J87A 1IBKB 2PRIA 3MWEA 1QNLA 2C77A 4OAOA 4C20A 4EGFA 1CQWA 4OH1A 4DZTA 3N6RA 1ANKA 5A6VA 1JEOA 1O5OA 4FGLA 1XYGA 1GUBA 2DPYA 2XTAA 2NACA 2EFYA 4G0MA 3QPVA 4O63O 5J23A 3GRAA 4YA6A 2IS4A 4X94A 3KQWA 4RPGA 4DA7A 4R71A 3BRQA 5EIXA 2VO1A 3ENQA 1JQDA 3WB9A 3AI7A 1KVTA 1ZD5A 2WA2A 4HVTA 2REQA 5ECWA 5C8YA 1KXJA 1WKCA 2FY8A 3J81A 2JAXA 3PDHA 4U8HA 5KU7A 1E3QA 5EIAA 3FKQA 1JEYA 1OAOA 2P91A 2QRPA 3PGA1 3PXAA 1WTCA 4Q12A 4WESB 5JMOA 2Y67A 1LPBB 1NQTA 3P5SA 4BDSA 4DDUA 1ZL2A 5EZYB 4NBNA 1W29A 2OG1A 5E6UB 1J5EB 4PGFA 4LF8B 2FXIA 5AESA 3VFDA 2JI7A 3O31A 4LI3X 1PS9A 4B3RB 1C4XA 2R1VA 2WE8A 4OMUA 3QEBZ 1A76A 4ZQCB 2FR1A 2B99A 3JWPA 3MXOA 3O92A 3OX3A 1J25A 1ZH4A 1PJTA 2ISCA 2NSHA 2UVDA 1ULAA 1ZH6A 1U8AA 1ZMBA 2QGFA 2Q9AA 3FHCB 5EMJA 4DLSA 1I7SB 1GKYA 1W87A 2BM0A 2ORED 2G6TA 4OX9Y 2AMLA 4MYTA 2VRWA 3COVA 2IZOA 1H42A 3C41J 3JV7A 1FVOA 1CJBA 4M53A 4LGYA 5GVRA 5LC1A 1XRJA 3Q6IA 4MV9A 3ER8A 5B37A 2G76A 3A1SA 4R6XA 1KP9A 2C2OA 1RABA 3HU2A 5ARCA 4WZBE 1JIKA 1JILA 3GLFA 3AINA 2BH9A 4Q3AA 5JW6A 4QBTA 3UJCA 2WAOA 1XA4A 1J0EA 1YWGO 2B21A 4M46A 5M3BA 3VAYA 4DLRA 4XX0B 1YJQA 3FHLA 2PMEA 5HUQA 5FLEX 4EATA 2D74A 2AG8A 1W59A 2GZRA 4NPCA 3BG5A 2HMSA 1OLXB 3E23A 1W5FA 4J7CA 2LZ0A 4DQKA 4MQUA 2CNLA 1KBQA 3HJHA 1POXA 5DNCA 1T3TA 4B0PA 3G0BA 1UJ6A 3QU7A 2OGSA 1FSSA 2P9GA 3NGXA 1GSAA 2WHEA 2C2MA 5EQJB 4KN8A 4MIKA 4O25A 1AS3A 2P7IA 4N4AA 3Q8XB 4BVLA 4X24A 1CY4A 3T4UA 4D81A 3PFNA 4XYEA 3RC7A 3D0OA 4J1NA 4F84A 4A2CA 3RAEC 3O8BA 5JCJD 5BW5A 3R24A 4OU4A 4NJEB 3PQ6A 1UWVA 4BZPA 1H2ZA 5HCUA 4DM3A 1E0DA 5FPTA 3AVOA 1NL3A 1BKSB 1Z7GA 3FOCA 1QR2A 4RWZA 1JXMA 2O57A 1VJCA 2H5LA 3BXPA 1JLRA 1KJIA 3BMCB 1PK8A 2WWFA 3IVMA 3RUPA 2VHWA 3QEJA 3WMXA 2OV6A 3EMVA 2HF7A 3JWJA 4H1WA 5JATA 3QWHA 1XZEA 4KR6A 4KC0A 1XUOA 3UHFA 1KYVA 4X1KB 4HFRA 2AOUB 2BMFA 1N5MA 3DVSX 3O82A 1U3CA 4ZT2A 1TO2E 1A7UA 1MC8A 2XGJA 1SVKA 4P5EA 4PRLA 3VPFA 1OYOA 3DXXA 4MHOA 2WJ3A 1C1HA 3V00A 1SC9A 1FRZA 4EZIA 5LYYA 4Z9FA 4PE5B 4ZRNA 4ZV4A 3D4PA 5EJ5A 5AO9A 4RF3A 1M2NA 3FNBA 3HNOA 1VG9B 2YIJA 4BB5A 4C04A 2XT0A 3MTEA 4CQNA 2PWYA 4Z9BA 4H31A 2WSIA 4LC9A 3KUXA 1ORHA 2YZKA 1R6UA 1TD1A 1PZNA 3EFBA 3SEAA 5FRDA 4ZU6X 2HSDA 4WCFC 4BVBA 5B1DA 4DNXA 3R44A 3RG8A 3VKGA 2R00C 4BQNA 1GGNA 4UCQA 2WG1A 3WYBA 4BUZA 2VP9A 1VPDA 4NNJA 1NWHA 2XWSA 3LUDA 2ZJ6A 4FS8A 4TMXA 4F60A 4EI7A 4P0QB 1KJNA 4XCVA 2PSJA 1DXOA 4LK3A 3T38A 4EUFA 4P7JA 1DKUA 3IIEA 2QTCA 4O4IB 3RTBA 2RK3A 2NNLD 3LCJA 4QYMA 3TB6A 1W47A 4CCSA 3DOCA 1IY2A 2Y4OA 4II2A 4RTJA 4P86A 3VZBA 3C43A 3IAS1 1BDJA 1CS0A 2DKFA 1Y6RA 3A58B 3FYDA 4ZK2A 3NVDA 1NIPA 1VL2A 4F3RA 2WQ7A 4QM6A 2ZIXA 3MTJA 3H0CA 5D3MA 4A8TA 4G1VA 1BXGA 1NXSA 1IEWA 1JHMA 2YYSA 3COPA 4OSEA 4GMDA 3T5CA 1JBQA 2AH5A 1J09A 2HI0A 5L3RA 3VR2A 4ETMA 3PJRA 2IZ6A 4HRXA 5J9FA 1RM5A 1H4QA 2EZ8A 4ZJZA 4PRYA 3NGMA 1K6JA 1VDZA 3RDPA 4FYWA 2ATIA 2VZEA 1OXUA 2FWIA 3H65A 3EA5A 4P4TA 5DMXA 5LXTA 2Y3IA 4ZZIA 5ALTA 4HB0A 2P77A 3G0DA 5ENZA 2QMQA 1GLVA 1BW9A 2QROA 4W99A 3BGWA 2IZ5A 2XMSA 1DELA 1ZESA 1F1JA 1ZI6A 4O8CA 4DYDA 1YQWA 2B69A 5BMVB 3PGMA 4RFVA 2CVFA 2D1RA 1QH1B 2AUNA 3SQMA 4HVCA 3A31A 5IRCD 1SUEA 2PFKA 4LSWA 3AV0B 4MGEA 3O2SB 4IIVA 3GG2A 2F1OA 1K5GA 1R6AA 2XZPA 1N4AA 3CBGA 1MFZA 1X0XA 1NATA 4P93A 3RIGA 2YDXA 2CJPA 1QIKA 3ZNPA 4F9TA 3NNNA 4QREA 1P2TA 1NT4A 4ZI7F 5SZKB 4UUAA 2M6SA 4PU0A 2Q0HA 3ZLUA 2IHUA 1AB6A 4D43A 3FI9A 4D7AA 4XDHA 5F9FA 1LJ8A 4UDYX 1CEXA 3AZPA 1SQSA 2D0OB 2PD6A 4V0OA 3WGMA 5IH7A 2XITA 4AS3A 1SUPA 1THGA 2C59A 3OA0A 4U8GA 3KHUA 3MCUA 4GLFA 4J16A 1RWXA 2WAAA 3N2GB 2DHEA 4TTVA 5E2AA 5FORA 1E7WA 4E2XA 3VJRA 1PTJC 1TT5B 2IXTA 3R7AA 3VSBA 2GEKA 4DAOA 5JYDA 4B81A 1HV8A 3E2PA 3KL2A 5CIYA 1M8FA 2BJHA 2IY8A 1VE6A 2IRWA 2Z5LA 5JADA 1G9XA 1O9BA 1OX4B 2B4TO 2XCQA 4MDYA 4CEIB 3CNNA 4DOMA 7ADHA 5CD1A 1AZWA 3NIGB 5EYPB 3BIOA 4X84A 3SBEA 2BAGA 2EZTA 1KDZA 1RAEA 3GH3A 3VOBA 1IM2A 4ZOCA 5C34B 3WFIA 1BDHA 3M4NA 2IZ1A 4ERNA 1V1MA 4FOTA 5D84A 2D7CA 2VWHA 2YNMC 4BIIA 2JFZA 4D8UA 2ZETA 5EFZA 2I1WA 5CFNA 1R8YA 3AKZA 3S5UA 4GM1A 4BVEA 4LY0A 4Q4JB 2A7QA 2ZT8A 4LYGA 2C5SA 4BNWA 1R5JA 1E7MA 5KEIA 1R27A 3JZFA 4DVGA 1UKEA 2FR0A 1YRYE 2EFDB 2J0UA 3WBKA 3RUIA 2NU8A 3GJ0A 3UFXA 5KYXB 5JVDF 4PC2A 1KVSA 5HJ7A 3CLKA 1LSOA 3MUEA 2Y1EA 4CHGA 4QDKA 2YY5A 1XPRA 1NVAA 3P9CA 2IBTA 3UBTA 3P32A 2E4ZA 4ZYLA 1UH5A 4HFMA 1JBKA 4J0JA 2GHIA 2HCJB 3EOAI 3GMIA 3PWZA 4HMOA 5DYNA 5EZSA 2ANCA 4Q7EA 4IIGA 4CJXA 5KWIA 2ONYA 2PT5A 2OYSA 2PRYA 4M7WA 4QYSA 1P0MA 1AKEA 4H0CA 5ALSA 3R20A 3SAJA 4C1NA 1ARZA 2Z58A 1DPFA 1K88A 1X1SA 4AMYA 5L7WA 4ZI2A 4TYQA 2LGJA 5ED0A 1E64A 3PC7A 4JNKA 4O0LA 5H83A 3W0LB 2BEVB 4E30A 4B7CA 2HXYA 2PBRA 2BI4A 2FWBA 2LKCA 2Y71A 2K2WA 4EF5A 5FIUA 5MGNA 1SD2A 5TGTA 1D7AA 1Q17A 3RTAA 1G2IA 5BNTA 4GDMA 2EKQA 3JARA 3CQ9A 1LBEA 2ZE6A 1ECBA 4LKOA 4FHDA 4I66A 4F9FA 1U2QA 3ANNA 5JNWA 3HYNA 4E1VA 1ZBQA 1YC5A 4LVUA 521PA 5BO5A 4WK4B 2I4RA 2Y92A 4IUCS 2Z6VA 5HF9A 3V3KA 4HRVA 4Q1EA 1DINA 4XWTA 4MV8A 4YAJA 2R87A 1XVIA 4TS1A 1AQ6A 1YE5A 1RJ9B 4BFCA 5KWVA 1GFWA 3TZBA 3RS4A 3DVAA 4E4RA 4UU1A 3CRNA 5SY4A 1WXQA 1YJ8A 3IESA 1QIJA 2JIOA 4EBFA 4YCJA 1L5GB 3GEDA 3HKBB 2PUWA 4DMKA 5JNTA 4IAOA 3QFHA 1TF7A 2JA1A 2XSZA 5CDFE 4M1KA 3IQIX 1B16A 1O95A 2QTBA 1HNXB 4FVTA 2VIIA 3AONB 2I22A 2B7BA 1ECGA 4TPKA 5TC4A 5AR1A 2J0QA 3A2LA 1W4BA 3HYLA 4OEHA 5EINA 3UOGA 5COBA 1NNUA 5KI6A 5H3CA 16PKA 1QJCA 3UWSA 1V3VA 4F56A 1OH8A 4OUDA 3S2YA 3HU3A 3BS4A 1B8PA 3ONDA 4IIYA 4QNRA 4YMLA 3VNVA 4WERA 2PX8A 1W36D 4N3AA 4RM3A 2FAXA 4MIYA 4E31A 1D8TA 3KU4A 3ELUA 4P35A 3QYAA 1MABB 4OI1A 1DX9A 1RLOA 1V25A 1MB4A 5C2JB 4PBSA 2VBFA 1JAYA 3DLHA 2TS1A 3M2PA 4F9GA 3I30X 3N8IA 1AF4A 4M9SA 3RW9A 4O4LA 3OOJA 1BHSA 4AICA 1Q3TA 1WQ1R 3N8GA 4KIWA 2P9EA 1TTQB 4MS1A 3W4IA 2HJGA 4JB3A 4AF8A 4CMEA 1WRBA 2HA3A 1G8SA 1N8SA 3C15C 3E84A 4DA6A 1EGQA 1V35A 4O4HA 3I9LA 4D44A 1MX5A 1U2TA 5DI9A 1XV5A 1EU1A 4L5YA 1I80A 4GBMA 4L0QA 1J9ZA 3RUCA 1HK7A 1CDEA 3HLKA 1QF6A 3AEZA 3WIVA 1LW6E 1PG0A 3ZWDA 1W4CA 3RCBA 5CB4F 4MPJA 1KAHA 3JVIA 5IDQA 2CV0A 3R76A 3TX2A 4U1RA 1RD4A 1E89A 3ZK8A 4XR9A 3K6RA 1G6KA 1IWOA 1RHQA 1T34A 3DKIA 3I34X 4JUAA 4TMWA 3V8NA 4BEJA 1I30A 3ADPA 2D59A 3QIAA 4FIZA 3T5GA 4RX1A 1GU7A 2ASVA 3U39A 3WKCA 4ALIA 5LQJA 2QMZA 3QFCA 3T9EA 1YXMA 1CUDA 1J0CA 1N2JA 1U7XA 1E3IA 2WM3A 2ETVA 4LEIA 5DLPA 1XTQA 1Q84A 1X0VA 3CEMA 4MS3A 1C9DB 5JCOC 1AV6A 1HGXA 3GFPA 4KWHA 5EG5A 3S7ZA 4JH0A 2OXRA 1NW6A 3R7BA 5EGNA 5A02A 1NRIA 1Z47A 1P18A 1WPGA 3CW8X 3OD5A 1VZ2A 2GYWA 3FXAA 3VDMA 5C35A 1SFRA 2B3TA 1CUGA 1WDKA 4PW0A 2NZWA 5J4VA 3BM5A 1JS1X 2VQSA 1AUPA 3MCWA 2HMAA 3N2NA 4S1PA 4TXHA 3MQ4A 3TLAA 2ZUDA 1FNSA 1FS5A 2HMVA 4UW9A 3FDFA 4B6GA 1U0SY 4DS3A 2O1SA 1CZOA 2R84A 1EFRD 2HA0A 1QXSA 2A9KA 4HDRA 4HGPA 1HYHA 4OHMA 4INAA 3ROPA 5HVNA 1S9HA 1ZVMA 3V8QA 4QPDA 1JIXA 4WNAA 4E5VA 3LWDA 4L57A 3NEYA 2DQZA 3EZYA 4CG2A 4YMHA 3E81A 4YUWA 5F1KA 4H6XA 4ZARA 2V3WA 2C00A 3D3QA 5AW6A 2Q7OE 2QS9A 3PDIA 2WFAA 1XZNA 4JJ4A 2VPYA 3NHBA 1BMFD 3Q87B 3UUEA 1KRWA 1L8QA 6PFKA 4PINA 1YB7A 1ZO8A 4RVCA 2KLHA 3F7OA 3L1KA 1LD3A 4RS3A 4HYTA 1J20A 3LC2O 3BSSA 1UFKA 4OPMA 4W8GA 3GOHA 4RL6A 2JK0A 2PH7A 1JPUA 1N8NA 4AULA 2XGOA 3ZJ5A 2NOAA 3OP1A 4OJTA 1E59A 4YRKA 3DE0X 3IH5A 1IOWA 1TZMA 4EFKA 1FFYA 1FYEA 2AJBA 4CIBA 4F3TA 3DAFA 1T8WA 5TT1A 5A9SB 2WHXA 2J7PD 3LVQE 4B4DA 1D7OA 1Z0KA 5JH7B 1XLTA 1N6PA 4CI9A 2IYQA 2O52A 1Y9EA 3QPBA 4DCJA 4UU0A 2ZAGA 3HB0A 4FBLA 4UKDA 1BHQ1 1T3LA 1E3JA 2NZXA 4BFWA 3BL6A 1U8YA 4NK4A 2WM9B 4RK4A 4PZLA 1BOOA 3EDRA 4HNVA 1Z6PA 3VR6H 3H2YA 2X4DA 2BFOA 3D6FA 1US8A 5HF8A 1U0EA 3GW8A 3O8QA 4II7A 3V1KA 1Q1NA 4I9FA 2YWBA 1W9MA 2R6FA 1PGPA 5DRYA 3KLMX 3S81A 4BKPA 3PIDA 3LBHA 4MA4A 4IM7A 4L5IA 2NO1A 2GBPA 4E88A 3CCFA 4B3BA 1GHTA 1IHYA 3WDMA 1AF7A 1T4CA 1R10A 2BGTA 4QQKA 2OT3B 4BN4A 3RUEA 3O47A 3JQ9C 4EG8A 4M89A 3V5NA 2IKSA 3GNLA 1WO8A 2RK6A 4C08A 5GIOE 5KOYA 3V9PA 4BFUA 4KE6A 2WMNB 5I4BA 2G04A 3KOWA 4KO3S 3E5NA 3E9MA 3JW8A 5CTJA 1W2HA 3K0FA 3TLKA 3WQSB 5AW7A 1VG0B 3AW9A 5A5DA 5BT8A 4YJDA 5TB5A 2DULA 2R79A 5C31A 3UATA 5HBRA 1NF8A 4KWEA 4JUDX 2GJ9A 3KCNA 5JDCA 5KCZA 1QFJA 4YLGA 1Z8HA 4TTPA 2GNOA 1SUAA 4NYMQ 3ZGVA 1FFXB 3LI2A 5B3JC 1X7WA 4UNNA 2XAAA 4NDAA 4Z9YA 2CMFA 3ZE1B 5B4UA 4EHIA 5LWQA 2AQIA 4NVRA 1FL9A 5JDIC 5EWJA 1XZGA 2L0XA 1NBMD 3G7NA 4UXIA 5FTNA 3SF8B 4V1CB 5TMPA 2NUTB 4OK5A 4V0NA 1I3KA 1IG3A 4PN3A 5IYZB 3B1VA 4W5NA 4WOJA 4JX8A 4AY4A 1GPNA 2AG1A 4JCCA 1PZMA 4NF2A 4PGGA 1VYHA 2EU8A 3M6UA 3P96A 1GXSB 3F6CA 1BO6A 2HJRA 3FVQA 2BR5A 4J43A 4JCOA 4JLVA 3P9XA 3WRYC 1SQ5A 1NJ2A 1NC1A 2RMKA 1OZFA 2EIXA 3RRFA 2V4ZA 2RHLA 2ZUSA 4M0EA 5DN6D 3IVAA 1HDCA 1M7GA 1T13A 2QI9F 4RYLA 3LDHA 4RGYA 1CU1A 4JGGA 2EBHX 1DJMA 4K1XA 3KFXA 2J6BA 5D01A 3EVFA 3SZLA 4CKBA 4KN5A 4E5YA 3O74A 4JB8A 2YMLA 4NNOA 1DAPA 4O02B 2PXXA 2N47A 3IKTA 2NP7A 3NCTA 1DBQA 1IHUA 3BD9A 1YBMA 3ET4A 3OZ7A 4YJGA 3X44A 1HX7A 3EVDA 3EZFA 3QTLA 2XNJA 3ZKWB 3KQTA 2WU1A 2GETA 2QTNA 1M2GA 3PDJA 4MO9A 3DEFA 1KDYA 4YUYA 3FWKA 2C4TA 3R5XA 1E2NA 4DILA 3HV0A 4IH9A 5EE0A 5DASA 2X23A 3P9RA 4EI9A 4K1LA 5DT9A 3PYXA 4TSFD 1C0LA 1AUVA 4Y9UA 4Z3DA 4RHUA 1Z5GA 2RIRA 1KE1A 5KYWA 1L6RA 5AI8A 5BWCA 1IXKA 3BJIC 4BKOA 8ATCA 2OQIA 5HK9A 4M22A 4ZGBA 2JFQA 2BL4A 1CT9A 2C2HA 1ORVA 3ZI0A 4OLBA 3HFGA 1AHNA 1JVBA 2F8LA 1NMEA 1G1AA 1NI4B 1P1KA 2P9HA 3O90A 5AHXA 5KQGA 1YRHA 4ZMRA 1JKIA 1OH6A 2W71A 5LBIA 1NW7A 1PV1A 3EZXA 3UQZA 1E3WB 2C98A 4FT4A 1EI9A 4YCBA 3UHJA 4GXNA 4HSEA 4ARSA 3LNTA 1P74A 1P2UA 3BIJA 1JJVA 1B8UA 1BCSA 1NZDA 2ODPA 2PKWA 3DFUA 3FNEA 2GAOA 4HAOA 4JJAA 1WWKA 2QYHA 4MR9B 4Q48A 5DP1A 5IVDA 3LY5A 2FQWA 3NAGA 2BM8A 3K0EA 1GL9B 4JFRA 1WJGA 1PEAA 3L7MA 1RADA 2UZ1B 4ASUD 4FUTA 5K0BA 4G5GA 4IV8A 2C7QA 1QQAA 3GJZA 1WB5A 4MYSA 3EOZA 2CXNA 2W8ZA 3TMYA 1NVGA 5HM6A 1Z4IA 3QYFA 3NDBB 1OI2A 2J3IA 1EQAA 1RYYA 4OHBA 5TJHA 5TIIA 1X1AA 1LC3A 4G0NA 2C7OA 3SMVA 1PGQA 4PNEA 3L0ZA 5T41A 1TVCA 2HDOA 1E4OA 4NONA 4D3YA 2Q6KA 3L6UA 2NUBA 4LX8A 1X8KA 4B46A 3AF1A 4ZVVA 3TH5A 4LVNA 1LH0A 1K63A 3VYUB 4JB0A 3T3HA 4FT2A 1SC6A 1OVMA 3FJ1A 3T06B 3BE5A 1Z0ZA 4QU0A 4KTTE 3ELBA 4BWGA 4DSNA 1SBTA 3PEVA 2ORIA 4MR8B 4XFKA 5ILQA 1JPJA 3SICE 1AC5A 5GWXA 4GW3A 3W6ZA 1RJWA 2ZKIA 3MMZA 3FRHA 5ALXA 1JDSA 2ZRDA 1X14A 1CIPA 2Q1YA 2WKPA 4X1KA 1MEJA 3VR0A 2QM0A 4D4KA 1E4EA 2PL5A 2O9JA 1H5QA 2RBGA 2WPNA 3FUTA 3O7WA 2F3PA 4TMTA 1DGQA 1LDYA 3OEED 2PVCA 1DXHA 3K0BA 4L07A 4UPVA 5TQ2B 4E3WA 3ZK7A 4CIDA 5AM2A 4IDCA 3E9NA 1LWNA 3HCWA 1PIWA 2OHOA 3PZRA 3WK4A 1Z7BA 3D3EA 3WTCA 5JY6A 5K6AC 4H7EA 5TQ0A 1FP2A 3AP3A 3CNBA 2P65A 4C4XA 5C4MA 1UBLS 1Z5ZA 3EZ6A 4A92A 3MA0A 2A94A 4QU9A 3KIPA 4MQMA 4XFDA 5EXDA 2PNJA 2GN8A 1DKNA 4I4TF 3T94A 1RVDA 4C22A 2Z2XA 3AR9A 5BWLA 3FUWA 4L50A 1QDLB 2JBHA 2ZWVA 3LQ2A 1IONA 1WBJB 2BISA 1PLKA 2JNWA 2C9ZA 2F17A 3TDNA 3FN4A 1BU8A 8MHTA 2IUSA 4DUGD 3OUUA 4LGMA 2RG1A 5JAQA 2POCA 2EGHA 2ZUCA 3EXEA 4Q7MB 3UJ8A 5EMHA 2NO5A 2YV5A 2CGEA 5DHFA 4I99A 2YICA 1U0JA 2MIIA 4RV9A 2YXPX 4X64B 4FFNA 4M8IA 3DE6X 4CUKA 3R3VA 1H2RS 1YQGA 2GF2A 3HDYA 1AHIA 1RR6A 2ACWA 2VH1A 3TE6A 3WIOA 3NPAA 4FYMA 4KFSA 2AK3A 2V54A 3DV9A 3X2SA 1SCDA 4A8JC 3NASA 5K3FB 2I6XA 4MWCA 4KQWA 1HYQA 3BJEA 1BHJA 1CJMA 1G20B 1QOQB 1EA5A 1L4BA 2WRZA 3B6MA 3SE7A 1D2EA 4MWZA 4DBLC 5LUAA 2W90A 3IVCA 3TZLA 5CT5A 5IVKA 1J6UA 3AERA 3A10A 4MQ6A 5AW8A 2G82A 5JHGB 3UT6A 5LNK1 2PKQP 1SU6A 1QLWA 2A7XA 3M49A 3O83A 3HCOA 1NDHA 2WF8A 3HV2A 1N33B 1FSZA 2XKAA 3PITA 5HKOA 3RUAA 1XRMA 3P5BA 3VHQA 4ZTUB 5JSKA 2QM7A 1YVPA 5H1YA 3LCUA 2X5XA 3VKWA 1I9CA 1A4IA 5EPOA 4WFQA 3I37X 1M6WA 1EGHA 1JG3A 1FCJA 2WA1A 3N5CA 3C3AA 2QTZA 5LBTA 1ZMTA 1UFOA 3WK7A 3S7TA 3QPUA 2QTMA 2Q3BA 3VNUA 3D64A 1DARA 4HDQB 4AZ0A 1O1YA 5B64A 3MHTA 2QJWA 2X7HA 3FCXA 2H63A 2RGNC 4OHZA 1KAOA 1U7ZA 2XHZA 1L5FA 1ZX1A 2QD2A 3G2OA 5FWXA 5EJ6A 4R9SA 1R8QA 2ZDGA 5DM1A 5FPHA 2JCSA 1YQUA 3MBOA 2AZTA 5LP6F 4PCUA 1GKUB 3I9MA 1WMDA 3VHLB 5LQAA 1ODFA 1ZIOA 1VE3A 5HOEA 2ZT6A 4RGBA 1IEXA 3DFMA 4ZI7A 1QNFA 2HFJA 2FX3A 2ZYHA 3A4LA 3GARA 3W7AA 3NTUA 4HBGA 3O8OA 1ES9A 2ZSDA 1F9EA 2X9QA 3CRMA 3H0EA 2V5VA 4ZVQA 1VHWA 4FB5A 3LIPA 4M36A 1KFCB 1QAMA 4OHRA 4ZA2A 3U0BA 3CLSD 2JDID 3R5KA 5AK4A 4ARZA 2MYPA 2IH4A 2GFQA 1KI6A 2QYOA 3L8CA 2WTNA 3NV7A 4IDNA 2WLTA 5DIFA 2CBZA 1G63A 1J8FA 2HRRA 3VU9B 4Z4GA 2XQFA 1HH4A 1WUHS 3DL0A 3EYAA 5EIFA 1DCTA 4HMPA 3ZDBA 1M6VB 1YVRA 3JQAD 4BX8A 2W6MA 4JU8A 3ESCA 5EUQB 2HQOA 5JV5A 4DEYA 3VVCA 4HWTA 1ADYA 5H70A 5M2QA 3GGSA 1DOAA 3WXBA 5JXHA 5K03A 2RAVA 3TL3A 5SYNA 2PBZA 1N2CB 2X14A 3S1AA 4GP7A 4W9NA 3MEQA 1E2EA 5IU6A 3G8YA 3FCAA 3M6WA 4L3VA 3SOZA 3KQNA 5JAMA 3EYWA 4DLNA 1E9VA 4O2AB 3NXKA 2IIQA 5IBPA 4XD7D 5K2MA 1HZZC 3O4GA 3T52A 4MWDA 3ZIDA 1A95A 4XWAA 3N0RA 1RQXA 4XQ9A 1VPWA 3PCRB 4OQLA 2VDVE 5AHOA 3SHFA 3BTUA 1R0YA 2IYAA 2I4TA 3FSRA 5JVDA 5HPYB 4LRWA 2IHKA 3ROXA 4BC1A 1MVOA 1QUEA 2B35A 1SA0A 4EMUA 3ZWXA 1XCLA 4RD0A 4GMGA 3FYSA 3N2EA 3ND7A 3TO5A 2QF7A 4NOJA 4R31A 2PLNA 4QYXA 4GPAA 2GEDA 4FQ7A 4XGKA 4YJFA 5J1SB 3GGJA 4K8OA 4XSGA 5H02A 4CF4A 3JWIA 2IYPA 1NXQA 4DANA 3HH8A 1WXIA 3TM4A 4F3CA 5LMZA 3FLAA 1YFJA 2ZZNA 4UVGA 1ZGZA 1W1IA 5CJJA 1EXDA 4OXYA 4B8WA 2HJVA 3CLRD 3UAVA 3ZJ4A 3G2QA 3IQZA 3CISA 1QIEA 1NXWA 3EZGA 2M9MA 1G3QA 3DZKA 1S2IA 1TAHA 2GZ1A 1U4SA 1SPXA 4RORA 4EL5A 4LF7B 3PLRA 3JVEA 4E33A 2BEJA 4D92A 3V1TC 3PJEA 1X7YB 4O2BF 4J1TC 3BKXA 1YL6A 4BB0A 4BQSA 2B5OA 1UQTA 4Q9JA 4N65A 1ODSA 4UFOA 4HPXB 5DWDA 1J06A 5DTIA 3EVAA 3ZZ1A 3AM3A 1LPPA 3D6VA 3GLUA 2WUWE 3HEAA 5A0VA 1T3HA 2KJQA 1XR3A 3GJ7A 5D7NA 3W8FA 5K3CA 3DOHA 4JYBA 3OZCA 4LI0A 3IB6A 3B89A 4H3KB 4LBVA 4XUEA 4WLVA 3KJIA 3FVTA 1H3EA 4CUZA 1M0WA 1H2BA 5JCPA 3HU5A 4IHJB 4DWOA 5DOVA 3VV3A 4Z8XA 1RRMA 1SO8A 4RK7A 4QDOA 3RGGA 4LISA 2XB9A 5CGQB 4BL5A 1C4KA 4R9NA 5CPFA 1FQJA 1XVVA 1HE2A 3OPNA 4EY5A 3WYNA 4MUNA 4OFZA 3ZD9A 3MOSA 3E7XA 3VHRA 6REQA 3LLSA 3GXOA 4PLFA 4NZZA 4YYZA 1ODKA 5LVAA 4YRPA 4JLKA 5CH5A 5CAEB 5F3WB 2PA3A 1J00A 3U4AA 1TVKB 3L46A 3UCEA 1E1QA 2DH5A 3DB1A 2XDYA 2IPAB 2I9PA 3WIBA 4JVLA 4WSOA 2CV2A 3B2QA 1LNZA 4EHJA 2J7KA 1OLSB 3PEFA 5KB3A 2J9ZB 1UM8A 2NAFA 4FDVA 4XI9A 1F3LA 4YTEA 4ZEXA 4CF5A 4C4ZA 3UWPA 1PNTA 3ABOB 3B1KA 4JD5A 4LX0A 5CH3A 4EO9A 2Q7DA 3GRUA 2KBEA 5A1TA 2C58A 2GKOA 4BV8A 5E4FA 1Z5VA 3PC8C 4GT1A 3T61A 1CRPA 1OBFO 1DLIA 2O0LA 4UXJA 3G1UA 3UENA 2XE4A 5DFAA 1LRLA 1R5OA 2PKRA 3S2UA 3OAAA 1Q77A 2ZFUA 5CDTA 5FUXA 5EJ8A 4UUOA 5CB4A 5C32A 4RO0A 4AF6A 4Z4QA 1WU7A 3OWHA 1YDFA 2CXQA 4L2IA 3ZS9A 3NBUA 1Q1QA 5FA6A 1UC4B 5JMWA 1TC1A 2YINC 4B5KA 1S2GA 5CXSA 5KDLA 4MEJA 4R4JA 2MOKA 3ZQ6A 5TGDA 2IXEA 2YCLA 5K0TA 1JG6A 2PZAA 3WV4A 3L77A 4ATNA 1AKUA 2XLCA 4RTNA 3ESAA 1DT3A 3YASA 4YJHB 4AJ4A 4UTOA 2ZM5A 4A26A 4W1RA 5C8YF 5B53A 1TLFA 3EUFA 2VBGA 2AXQA 1A0OA 3WFZA 1KSGA 3NUGA 2QW1A 2PSSA 3JCZA 2OGWA 4MA5A 5IKPA 2R7KA 1E2HA 1I14A 1I8TA 1P5JA 3A0RB 3B1YA 4G8DA 4EUHA 4GMHA 1HKUA 1PU2A 1ZITA 2Z08A 2QORA 2IELA 5C3UA 1XD2A 3SYTA 2X1HA 1XTRA 3ZEAA 4ZAYA 2O2JA 4XCXA 4Z4FA 1SD1A 5K0GA 1W75A 2D00A 4O0MA 1RM4A 5TNXA 3TNLA 3S8MA 3BQ9A 4FNMA 5E9JA 1BCRB 2GXUA 2JFPA 4MKXA 2OHGA 1XVLA 2CXOA 4RKFA 1FQWA 1UP7A 2ZJ1A 4JSRA 5ADUS 1GLGA 4YDQA 1LX7A 4PVCA 3RVOA 1EXNA 4CLRB 3H05A 1A3CA 2JANA 2OHJA 4U0JA 3SIPA 4DPKA 1FUUA 2Z9BA 4UTXA 3Q8WA 4NRDA 2P9QA 4RTOA 1U0BB 4UE3S 4FMPA 4RKEA 3N8NA 4AP9A 3U5TA 3W1WA 1SUIA 3WLAA 4IX9A 2P0YA 2F00A 3VNQA 3M3DA 4TRMA 1SXJD 4DDTA 3T7RA 3E9CA 3V1YA 4UCWA 3CR8A 4P3PA 1IVSA 1PJAA 2BBWA 1T0JB 4HPJB 3SZUA 2DY1A 1JSLA 5FH9A 5CNJA 4ITVA 4RZSA 4PIVA 2JGAA 2ZYDA 1AKWA 4A10A 2QZJA 4RVHA 1M7BA 5BUSA 2COEA 1U98A 1NGSA 1Q2XA 4OGLA 1JYSA 1TI7A 3MMSA 2ZXEA 4LNUA 2XEDA 4RF4A 2OAEA 1ECPA 4P38A 1X70A 2IYTA 3W1EA 4Q24A 5E7JA 3NC0C 5T6MA 4CU2A 1PYDA 2HCBA 4CNBA 1VIMA 4WT7A 5NULA 1CUHA 3KUDA 1ZUNB 2PD3A 4K9RA 5NLLA 3UZUA 2RHWA 5G3ZA 3SEFA 3FUCA 3CU5A 2ZYRA 1UBHS 4P5DA 4DNOA 3AV3A 3GUVA 1TPYA 2QRLA 4ZRDA 3SX2A 4ED9A 4B6JA 1M72A 3LKDA 2ZWPA 3A9TA 3BCHA 3DZFA 1XRLA 2HYIC 1QOZA 4A73A 4YR7A 3D5TA 5IKMA 3U7JA 5J4KA 4O3MA 2FCAA 2Z3VA 2UYYA 3GLGA 4PANA 4MWSA 1AU9A 5A0FA 3ADBA 4PYNA 3MM4A 1B6RA 3L40A 4LCBA 4YMTA 1J8DA 5HDQA 2YYZA 3BMXA 3H1FA 4HH0A 3U7FB 1Q1AA 4GQAA 4AUEA 3F4LA 4WK2B 4DCOA 2ZRQA 1C3XA 2AFIA 3T8YA 2F4VB 5EE9A 4F4DA 1UK7A 1T2FA 2VJPA 2RDMA 2R7AA 3E5HA 2HK6A 3M89A 1Y80A 2A5GA 2CHEA 3IDQA 1LCIA 1KY3A 3FPCA 1FNDA 4M37A 4BO8A 1EDBA 4IR7A 4QOIA 4HAUA 1GGFA 2AI3A 3JAMA 1F0NA 2GFIA 4RTQA 4I5IA 3KOXA 3O9MA 1MIHA 2QAGC 1XZKA 3JQFC 4F4FA 3RSSA 4CLDA 3SEQA 3ZE6A 3RIYA 2H2IA 3B9QA 1E2IA 2IW3A 2JGNA 2XCUA 1GKKA 3GBVA 1Z2DA 4EFLA 1TLLA 4IMJB 4LY3A 3D8HA 1PKEA 2CFRA 2W4MA 1P2SA 3LT2A 2C94A 4QNNA 2PGLA 3OCYA 2ZVPX 3UAOA 1L5QA 4F0JA 1PRYA 1O94A 5CB0A 3JQ7A 5FBHA 2EIHA 1WAMA 2AMJA 2AF3C 3NATA 5TY0A 2WT9A 2QMYA 3OIWA 4FQ5A 4UARA 3F3SA 3C3XA 2BY4A 3A9CA 5JPCA 4GL4A 4CKYA 1PEKE 4PC7A 3BK1A 2P9JA 4FYVA 2PGDA 2O8CB 1XELA 4L08A 1UPFA 2P68A 1V5IA 4PG5A 1TRHA 2DBYA 2PY6A 2ZGVA 3OKPA 3OM1A 4Y2SA 2I76A 3BILA 5E4TA 1XAIA 1VI2A 5G2OA 4J75A 1ADJA 4L0MA 1YU6A 3OOEA 1H85A 2R6R1 5K8UA 3BXFA 3NH6A 3WLOA 4HATA 2SECE 3L04A 3NWEA 2CDCA 3BIFA 3OE7A 4JOBA 1W0KA 3NP7A 1T43A 2DECA 2I4MA 2QT1A 2R6HA 2MSDB 1G8KA 1CY1A 1ISPA 1DPGA 1V8ZA 1GQ2A 1X1RA 2IIBA 3FJOA 1EX6A 4HG2A 5A2GA 1C0PA 1XDUA 5BSVA 3R7LA 3CWQA 3AY3A 3FWYA 3OX1A 2G1UA 4I81A 3R75A 5I9IA 5LYJB 3EEBA 1E7SA 5BQ3A 5F7JA 1DLJA 1HNZB 3TOZA 1RXEA 3IOYA 3TGPA 3LKZA 4CCWA 4NCXA 2Z4SA 3FGOA 1H4SA 1YDWA 1E6KA 4XWOA 5IG2A 2NSYA 2J0SA 1OIVA 3GUCA 3PHHA 3OO0A 1ZJ4A 3JWHA 2QXTA 2UYHA 4OBWA 3D0RA 2PLFA 2XB2A 2WIDA 3ZR4B 1SUSA 4KH0A 5AOVA 1KH3A 2ZXUA 2J9XB 3C5CA 3CKYA 4AI6A 3HL4A 1I9GA 1L9XA 3E9ZA 4A9AA 3SDBA 1ZP6A 4D79A 2IV2X 1Q16A 1M2VB 4HN4B 2GAAA 2I8CA 3WWDA 5INTA 1Y4SA 2VUSA 2Z1MA 2DKOA 1U8XX 3W5VA 2FGKA 2JVIA 4OBXA 3LUFA 2IY9A 1IAVA 5TXGA 5G53C 1QRUA 1F1BA 2SICE 4HQFA 2FSPA 1H65A 3ROTA 2P4SA 3IIJA 3WLKX 3MJ4A 2NG1A 3QJGA 2WTBA 4KMMA 3H83A