2ZZ1A

Snapshot of the reaction from 6-cn-ump to bmp catalyzed by orotidine monophosphate deacarboxylase from m. thermoautotrophicum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz1A00
1E51A 3QJAA 2YSWA 4LVBA 3CTLA 3A24A 3HG2A 5AHIA 3L2IA 3TDFA 3ABRA 4K38A 4OQVA 3A5FA 4KFOA 1FDYA 1OX6A 4PC8A 1G4PA 4JNMA 3DXIA 3BLIA 1I2OA 4JN6A 3MP5A 5L6UA 4XZ9A 3FS2A 1LM1A 4I7UA 2G95A 4P61A 4A2SA 1K7FA 2O7QA 3LTPA 3CQ0A 1QWGA 2VC6A 3KX6A 3RMJA 3OEXA 3L21A 1SW0A 3LXBA 4L4LA 1O94A 4KFNA 1XUZA 1JVNA 2ZCGA 3QH2A 1XL9A 3PBWA 1FWRA 2QDHA 5G2IA 1KM4A 3CWNA 1SW7A 4XWUA 1Q3NA 1I2PA 3MP4A 4BFAA 1UUMA 2NLIA 2ZZ3A 1GG1A 2A0NA 4M7TA 3THQA 5AHNA 3EX1A 5F2GA 3W1RA 1GVRA 1QPQA 1YTDA 4ALDA 4N9DA 2DU2A 1C9DA 1FBAA 2XN0A 1OVDA 4JTUA 1JQXA 2NXGA 2WNQA 2YXGA 1I8JA 4K7YA 1VHNA 1DL3A 1V5XA 2CLIA 3GXPA 1LOQA 5DCEA 2V82A 5FF2A 4O15A 1B3OA 1IXQA 4O4WA 1LRNA 3A9IA 4IOTA 2A6LA 4Y90A 1BKSA 2FDSA 3IIXA 1JCMP 3PBUA 4WZHA 2J27A 2C0AA 3MBFA 5CZJA 3JS3A 5CPMA 2PRLA 1B57A 4AWUA 4KWWA 3OA3A 5K4ZA 3W1NA 1DBTA 3QMSA 5AHMA 4GUFA 3NGJA 4HSOA 1W37A 3GR7A 4P2VA 2WSQA 1M6JA 3C8FA 3EWYA 4Y9AA 1XXXA 5C5YA 4MY9A 3LHTA 4FXSA 3UZ5A 4Q32A 3CHVA 2C16A 1CX9A 3GX9A 1Z48A 3A23A 3E96A 3ELFA 1RQBA 1YPFA 3F03K 4FHAA 3S5NA 4R53A 4QAIA 5F4XA 3HG3A 1JR1A 1Q6RA 3MO7A 2YYTA 2F7FA 2ZZ2A 4YMZA 4N4PA 2NX1A 3C2EA 2EKCA 1H7RA 1VPXA 3AO0A 3L65A 4NUWA 3UWQA 4IX2A 4OBTA 2OJPA 1XDLA 4RCXA 3TNOA 3R2GA 2GJNA 1W31A 4EVZA 3MMTA 1G69A 2DZSA 4NX5A 1SZNA 3LHVA 1OFAA 1K3UA 1TIMA 3HGJA 1H60A 4UTHA 1VHCA 1XBZA 1KBIA 5K4XA 3DFSA 2V81A 3UD6A 6TIMA 5AC6A 3C2VA 1ALDA 3MJYA 2X1RA 1YDOA 3W7RA 2Q8ZA 1RD5A 4TMBA 4ZQOA 2A2IA 4MLRA 4NVTA 4JR5A 3DFPA 3G0UA 3M1ZA 4IJBA 1SR9A 3ZFHA 2E5CA 1JQVA 2PCQA 4JX6A 2E6DA 4RX0A 1L9WA 4JTLA 5L9FA 1H61A 4JIPA 1P0KA 3ANYA 3INPA 1KFJA 3W73A 3TFXA 1YXYA 4O50A 2TRSA 5F2MA 3PC0A 5SWUA 4PFMA 3HMJG 1VZWA 5IBXA 1YDVA 1EP1A 3L9CA 3N3MA 3QW4B 2CLOA 3LCFA 1MXSA 4Y6GA 4NNAA 4AHPA 1NF7A 3G8EA 4HT3A 3LRLA 5AN7A 5E1QA 2QCCA 2FB3A 1GQNA 3W1XA 3PG8A 3UXDA 2VEPA 2FPYA 2QDGA 3QC3A 3NQDA 1H5YA 1O95A 4AXKA 4NJGA 1DORA 4IXXA 1THFD 4QNWA 3W7LA 1VYSX 4FO4A 1FXPA 2VFHA 4MFDA 1WOBA 2FPVA 3E9AA 1ZAIA 3G1XA 4AWSA 1LRQA 3P82A 3B0UX 4LS0A 5FI8A 4JYDA 2Y89A 2E5BA 3G22A 1EPXA 1YTEA 4LUJA 2VKZG 2VELA 1J4EA 1TQJA 1AL7A 3DZ1A 3LXCA 3HO8A 3NQEA 3NQVA 2QCEA 2B4GA 5IM51 5K3VA 3QSRA 4LVAA 3W2JA 2ZRWA 3GLCA 1JCNA 4H6KA 4UTTC 5LHFA 2B0MA 1SO3A 1KFKA 1JCLA 4MIMA 3EB2A 3NA8A 3TIMA 1GPWA 1QMLA 2X1TA 1OK6A 3JRKA 4KFPA 3LDVA 1KLYA 4NQ1A 2Y62A 4DBEA 3M5ZA 4UIOA 4WJEA 1XBYA 2JBMA 3MYPA 2DZTA 2HTMA 5FF3A 2W0UA 2C1HA 3NZ1A 2WPBA 4Q33A 1OX5A 3UWUA 3MI6A 4B5NA 4TX9A 1M7OA 3BV4A 3TA6A 2ABBA 2JKAA 3D0CA 3ZR4A 3W84A 3R5EA 2P10A 3GDKA 1TPVA 5HWMA 1NAL1 3NPUA 5D2YA 5D04C 4GNJA 3OHIA 2YW4A 3W2MA 2LLEA 1IIHA 2JKPA 4AH7A 3MW7A 3W7DA 4WUIA 1LORA 2R14A 5A8GA 4UNKA 3GAKA 4XKYB 3ZWTA 3EX4A 3WFAA 1RV8A 3DKLA 3W7JA 2V5LA 3EWUA 3PVFA 4R34A 1X8FA 3Q94A 1ICPA 3W1UA 3W2LA 1ME8A 3QF0A 3LV6A 3C6CA 3P60A 4N4QA 5U4NA 5C6MA 3BARA 3TH6A 1KFEA 2EGZA 2JK2A 4UC5A 2JKEA 3EWBX 3S1UA 1LBMA 4UXDA 4DF0A 1DJQA 1IGSA 1X6UA 3G3DA 4N6FA 3P84A 4QNEA 3R13A 2ZBTA 2JGQA 1FXQA 4TR9A 3TMLA 3NQGA 3W71A 4BI5A 8TIMA 1G4EA 1XFBA 3O6CA 3TAOA 3S1VA 4GC4A 4CCCA 1A5CA 1KM3A 1OFBA 1SUXA 3GKFA 3G24A 4PH6A 2YX0A 3STGA 2CFFA 1YADA 3GXTA 4LWWA 5TQLA 4MVAA 1IXNA 5LSMA 4POCA 3W74A 1ZFJA 4PL1A 2QCLA 2TYSA 1JULA 3ATZA 1EA0A 1SSGA 3SW6A 1A5AA 3MHUA 1G6CA 3QMTA 4H3DA 1TCDA 1FX6A 2NWRA 4JTHA 4DPQA 1BEUA 1N8FA 5HUOA 3PWAA 3DFQA 4A21A 3RF9A 4IPIA 4CLMA 5MHBA 3C2RA 3BPWA 1W3NA 3M7WA 2H3BA 2VEKA 4D2JA 1A53A 3PUOA 5G1YA 2A7RA 1AW5A 1TB3A 2X2GA 3S1WA 3N14A 4QSHA 4EWND 1WBJA 2B7NA 3E0IA 2WV8A 3S5OA 3WK1A 4IPJA 3B0VC 4JTEA 3O6YX 2YCEA 3LRKA 1PHWA 3KVJA 1F6PA 1H51A 2TSYA 5G2WA 3W1AA 3TCEA 3EKZA 3VKJA 3P81A 3CIWA 5BNKA 2NZLA 3V75A 2Y63A 4LUIA 3GNNA 5BOOA 3I7SA 4Y96A 3TMQA 4WOQA 3DFNA 2WNNA 3ABSA 1YYAA 1U5JA 1ZCOA 4CCDA 1AL8A 4KWVA 1FWWA 1EP2A 4CNOA 1EEPA 3W87A 1KV8A 4OWGA 3LERA 1IXOA 3IIPA 2YGYA 2WNZA 3P80A 4O0ZA 1AK5A 2NX3A 3DHDA 5FF4A 2JGYA 5KMYA 1NF0A 1LDCA 2W79A 3F4WA 2AGKA 5TIMA 5F4SA 2QUUA 3CIXA 3W7PA 4FEZA 3U2OA 4WQ6A 4JDYA 2P0OA 5CSRA 4LVGA 3GK0A 4H4IA 3L0NA 3FJ6A 3NO5A 1O60A 1DOSA 2H8ZA 4GWEA 2QKFA 3PBYA 1T0OA 2Y7FA 3LCLA 2CZ5A 1Z42A 3M16A 4I9AA 4HNUA 1JUEA 4M5PA 4NNBA 1EP3A 1ZAHA 3DENA 3QQ1A 3GVGA 1WYIA 4O57A 4O17A 2V30A 2GUUA 1HG3A 2J6XA 4MZ8A 4QIUA 4UR7A 2DZUA 4XTDA 5G1TA 5AC8A 2QCDB 1RVGA 1VJIA 3P5YA 4BF9A 3ABQA 3NL2A 5LNRA 1KFCA 1XM3A 2VFFA 5EBUA 4L4MA 4TO8A 4HN4A 4O1AA 4NZFA 1EWEA 2XFWA 2ZZ4A 5D2XA 4RZ6A 1IF2A 1LZOA 1OYCA 2J9XA 3MBDA 4NXKA 3LI1A 3S6DA 5HR6A 2Y70A 3G1HA 4LRTA 4NZJA 3S42A 1SQ7A 3ABOA 2CLLA 3I7QA 3W7HA 2G5WA 3JR2A 3CEPA 2VENA 3UQNA 4Z1BA 5D2WA 4EF9A 4N9BA 3O16A 3W7QA 3NPWA 4OGZA 4EF8A 4QM1A 3TKFA 4JTKA 5E93A 1MEWA 2C3ZA 1H63A 3I65A 1W54A 2CZDA 4JYEA 2WKJA 3G1YA 3BGJA 2ZA1A 4NX0A 1H1ZA 3EXTA 2ZZ1A 5D30A 2YZRA 3V1PA 1QR7A 2ZRUA 1RZMA 5C55A 3NEVA 2PRHA 4UTJA 4HKPA 3KHJA 4X2RA 5CPLA 4HNVA 4O12A 5KINA 3WJZA 2FPTA 4HNTA 1F6KA 4XTIA 4NJIA 3P5ZA 4DF1A 2GQAA 1GZGA 3BLEA 4LU0A 4MLJA 3SY5A 2OT1A 4RZ4A 3A21A 2H6RA 4DPPA 5CSSA 4K39A 1XBXA 1RPXA 2C13A 3UPWA 4ZZ9A 4U4MA 3EWWA 3NOEA 5DCDA 3HOJA 4MPQA 4LY8A 1TTIA 1SZEA 2QAPA 3KFTA 2Z6JA 3B04A 3HG4A 1YXDA 2CLFA 1DHPA 3HPSA 3NM3A 5AC7A 1W3IA 2Y61A 3G1VA 3KVKA 4OU1A 4GE8A 1GVSA 2TPSA 3N9RA 3UWYA 3USBA 4E0CA 1GYLA 1C29A 3H55A 1C8VA 3QM3A 4AHOA 1O5KA 1PHQA 3LB0A 1ICSA 1FCBA 3TC6A 2B7QA 3NQFA 1DQWA 4O14A 3OVQA 1OG0A 4N9CA 3O15A 4K36A 5F4WA 4PL2A 4CQAA 4LS2A 3KRUA 4MYXA 3HPZA 4O13A 3A5VA 3M5XA 1XBVA 2CLMA 3LHUA 1UJPA 3CT7A 3O05A 4NXSA 4FX7A 3N2XA 5AB3A 5DY2A 3W83A 1F73A 4BWLA 1FCVA 1S3HA 2G97A 3W07A 3ATYA 3W23A 1SO5A 5FF0A 1VCGA 2V2DA 4HPXA 1QOQA 3PBVA 3PS7A 1OFEA 1UASA 1P0NA 3C2FA 3L5MA 5I3IA 2ZRVA 4DF2A 4GXMA 4UFLA 4LTSA 3N34A 3SJ3A 3DFTA 5U7SA 4CNNA 3O8AA 2J24A 4RXGA 4MYAA 2RDWA 2QF7A 4JS3A 4QJ1A 4DQWA 3E12A 2VFEA 1Q6LA 1KM2A 3PM6A 3EXSA 3QW3A 1FDJA 2WQPA 4N02A 1TYGA 3DFOA 3HQ1A 1FWNA 4QQ3A 1G7UA 1QCWA 3LTSA 1TQXA 3WJSA 2GVLA 3P67A 5D32A 4TIMA 1YXCA 1G4SA 4PTNA 4XBKA 1ZY9A 5HUPA 4HNNA 3B8DA 4XKYA 3OBKA 2NXIA 3SGZA 2CLEA 1FWTA 4BR1A 2QEZA 3C3NA 1UB3A 1VRDA 4IMDA 4UTWA 4LOCA 2IQTA 1J5TA 3VFLA 1QPNA 1EB3A 3NNTA 2FJKA 5DXYA 3TUUA 3M41A 1KTNA 3IIZA 4LVDA 3W1LA 1JRBA 1VS1A 2C6QA 4HSNA 5FEPA 3F1QA 4OT7A 1I2RA 4Z08A 1PCWA 3IIOA 1W5QA 3BK0A 2Y88A 1LROA 3L67A 2ZQ0A 4E38A 1HL2A 4PCFA 3UWWA 4ZMGA 1SPQA 1W8SA 3IGXA 3KVLA 4LS1A 3G0XA 4C1LA 1L2UA 4FX6M 1FQ0A 3DBPA 2BSLA 4ADUA 1OYAA 4AAJA 3NG3A 4ORIA 5HULA 1EUAA 1TPFA 4WOZA 3B4UA 1LP6A 5F1UA 4YLWA 3M43A 1DQXA 3U8GA 3IVUA 3W70A 3TQVA 4NJKA 1M5WA 4JD4A 1VLWA 4FNSA 3GXNA 5AYYA 5FEXA 2ZRYA 3UY7A 1OYBA 1W5OA 3Q37A 1OK4A 1A5SA 2OCZA 1UBSA 4RV8A 1TO3A 3M6YA 4JGDA 2PE4A 3W2NA 1IXPA 4WY0B 3GZ3A 1WX0A 1G67A 2FIQA 3LM7A 2DZXA 3FYPA 4S1FA 5TBOA 4DXVA 4PODA 1T99A 1JCXA 1YLVA 4LT9A 4ONVA 5CG7A 1Q6OA 1G7VA 4K8EA 5K7JA 4E2BA 1SO4A 3LX9A 2FQIA 3KVMA 5HQEA 3PG9A 2A7NA 5KITA 5LGXA 3NL5A 3BG5A 1SZGA 4IMEA 4DO4A 1H50A 1Z41A 1WAUA 3FOKA 4NNCA 1T96A 2ZA2A 5D02A 1GVOA 4FIQA 3Q2DA 3N19B 1S5TA 2C15A 2ALDA 4AWTA 5I3FA 4UTKA 2DZVA 5H2ZA 1MO0A 3BO9A 3BLFA 3MI3A 3LCGA 5LHEA 2A7PA 2WSRA 4GRSA 1GWJA 2E68A 5F1VA 4LV9A 3TJXA 2QCHA 2H8XA 4JYFA 2ZRXA 2PRMA 3TSDA 1UCWA 3W72A 1ZALA 2FB2A 2YW3A 4O4VA 1VYPX 1SW3A 1LLWA 3F4NA 3G3MA 4RLIA 3LCIA 2R94A 2ZTJA 4JEQA 3G18A 5HR7A 3S9YA 1GTEA 1TJRA 2J88A 3NR0A 2DORA 1OFRA 1Y0EA 3SGUA 4Z1CA 2VEMA 5FESA 2ZRZA 1ZHAA 1GEQA 1JCJA 3GAYA 3NAVA 2VFIA 4M6VA 3TV8A 3VE7A 3YPIA 4DEFA 3N73A 2Y6ZA 5F2IA 1L6YA 4FNPA 2VXNA 3B05A 4A2RA 1GG0A 1SZFA 5EA9A 2BWGA 3N2MA 5D03A 3LI0A 3O07A 2NWSA 4IMGA 2OT0A 4ZQMA 1P1XA 1W5NA 2CLKA 2QCDA 5E0KA 1TRDA 2E6AA 5LGZA 2I9EA 3GYEA 3LV5A 2GPTA 4DO5A 2Y7DA 2EHHA 4MY8A 1OX4B 2B7OA 2E5DA 2Z6IA 3PUDA 3TSMA 1EWDA 1WV2A 5D2VA 5D33A 1D3GA 4FNTA 3G0SA 3W7KA 5D37A 4C1KA 3BG9A 2QCFA 3HG5A 3KRSA 1LOSA 4Z0JA 4MJZA 4CQ9A 1F74A 5IBXC 1JJKA 1QPOA 4JTTA 1WA3A 3Q58A 2CW6A 1X7FA 2VOMA 4FNUA 4JTJA 4O1BA 3E02A 5D38A 1LLZA 4M6PA 4AHQA 4IUOA 1ZAJA 2H3DA 1LCOA 4CQ8A 3S5ZA 1ML1A 3DI0A 2W6RA 3T40A 2G96A 4UFKA 1TPEA 2QJGA 1H7WA 4M6QA 3C0JA 4GBUA 5LKYA 1YPIA 3RK8A 3N9SA 3EEGA 1W1ZA 3LGEA 6ALDA 2YDAA 3HIJA 1CI1A 1UUOA 3EX3A 1XI3A 5KTLA 1CW2A 3W7EA 4K8HA 4OV9A 3W1PA 3FKRA 5DY3A 3ZWSA 4ADTA 3G1DA 5I3JA 1KM5A 1PCKA 4PEKA 4R7JA 2RDTA 4UFHA 4IX0A 2VFDA 5EY5A 3PR2A 3OVPA 3QRHA 3RFAA 3U6WA 5K9DA 3GR8A 3TQKA 1I2NA 2HMCA 1W0MA 4NU7A 1EIXA 2ABAA 3L5AA 1M7PA 1LYXA 4KKXA 4JX4A 3FEMA 5BMXA 2UV8G 1OF6A 4UTUA 2A85A 3DU0A 1WDWA 3FA5A 3LHYA 2KZHA 1VH7A 1R30A 1OFDA 1I45A 1OABA 1TSIA 3PUEA 3M5YA 2QUTA 3GKAA 3CLMA 4ZVJA 1GOXA 5KZDA 2I1OA 1H1YA 3EXRA 4LVFA 1TMHA 3AJXA 1Q45A 1TPC1 5J5RA 5LNUA 2Z2UA 3P8IA 4UNLA 3CEUA 3CB8A 1H62A 4XBSA 3ZS4A 4O28A 2GVJA 4WXYA 4HHPA 3NQAA 3PF3A 5AOUA 3NYZA 2E6YA 4S2CA 4WD0A 3P74A 4NJJA 4A29A 4EIVA 4JY8A 1GVFA 2E6FA 5LNVA 2A21A 1B4EA 1OFPA 3KRZA 1WQ5A 2EPHA 4MUZA 1NSJA 1J2WA 2CLHA 3LOTA 2J9ZA 4IMCA 4NT0A 3IEBA 2BXVA 5KZMA 3W7CA 5C54A 1QAPA 4M7SA 4O19A 3A22A 1TV8A 3T55A 1VLIA 2TMDA 5HJLA 4O53A 3TE9A 3TXZA 4UTIA 1W56A 1AW2A 4IWWA 1GT8A 4GUJA 4NJHA 3E49A 1QDSA 4LW7A 1OFOA 1K02A 3HGSA 2C19A 3BW2A 3QYQA 4HIBA 2Y7GA 4UFJA 2ISVA 3NPVA 1DJNA 2RFGA 2YFNA 4ORMA 4O54A 1MZHA 1K7EA 4LC8A 3HB9A 2C14A 3DGRA 4YCOA 4BK9A 1LRTA 5LNWA 4IXHA 3OG3A 3QMRA 3W1TA 4E2DA 5BMWA 4A3UA 1MEIA 3BVJA 3W85A 4OV4A 3QZEA 1DV7A 3NDOA 1R46A 4MKNA 3WK3A 3MWAA 4O52A 1R2TA 4K6AA 3L0KA 5K9XA 3IVTA 4JTSA 3UWVA 3W3OA 1OJXA 5CZTA 3NQCA 3STFA 3IIVA 3S0CA 2ZDRA 4UFIA 4FNQA 1F2JA 1SSDA 4Z0SA 4X9SA 1H7NA 1HFBA 3H53A 2V2HA 1TTPA 1PVNA 3HJZA 3W7GA 2V8ZA 3R8RA 4AF0B 2GQ8A 1TPWA 3I6RA 3GIYA 4EOUA 4O11A 2DJXA 3EX6A 1TTJA 1F5ZA 3TXVA 4AMAA 1TV7A 1TPH1 2V0TA 5I3GA 2QR6A 1WXJA 4DELA 1VQTA 3PULA 3NQ7A 4N9EA 1GTHA 3P8JA 1A50A 4O1CA 1QOPA 2YR1A 2X1SA 3PSWA 3IRDA 1ME7A 2CU0A 3K30A 4AB4A 2E77A 1I4NA 2QUVA 4UTTA 4MZ1A 3NQMA 3DAQA 1OHLA 3L0GA 4ZQCA 2XN1A 4PA8A 3QEZA 3M9YA 3BGGA 5LNSA 3TJLA 3FJLA 5KSWA 3P62A 1QO2A 4UR8A 1VR6A 3LXAA 1BWKA 4LNYA 2RKXA 1K8YA 4J9JA 3TX9A 4GFSA 4IMFA 1TTQA 5CKSA 5AFDA 1KM1A 3NQ6A 1W3TA 2H90A 1TV5A 4RXFA 4RJEA 1EUNA 4JTFA 4RK8A 1QO5A 1IIGA 5AHEA 5DBUA 1D3HA 1NFBA 3GB6A 4O1DA 1L6SA 3LCWA 4AVFA 4UMBA 3STCA 5CPOA 4JY9A 4GUHA 2WSYA 4WY0A 3SI9A 4QITA 3SECA 4BI7A 1H7OA 3W7OA 2YPIA 1O5XA 2ISSA 3C52A 3NVTA 4YCPA 5FEWA 3KOFA 4JDBA 1NVMA 2R8WA 3TQ0A 2EAWA 2AAMA 1KTCA 3IGUA 2QJHA 2HSAA 1K03A 2ISWA 4RR4A 3W2UA 3W7NA 1YTKA 4XUGA 3DI1A 3DH7A 3T44A 2GOUA 3G1SA 1LTDA 2C18A 4QISA 4I7VA 4WY0F 1O4UA 5AHLA 3RLUA 2HS6A 1KBJA 3NQ2A 3LRMA 4TU1A 2ZFAA 1V7YA 3DHFA 3CM4A 1TPB1 3R89A 5DCBA 4JIQA 5HMSA 1Q6QA 1RR2A 2NUXA 5FF7A 2GJLA 3BG3A 4LV4A 1LBFA 1GJPA 2A6NA 3R12A 1TJPA 2BX7A 3SFKA 3DKJA 3LBMA 2WOQA 3UPBA 1ONRA 1AG1O 3SSJA 1MEHA 3CWOX 3UZJA 2Q3RA 2A5HA 3CU2A 2DZWA 1H7XA 1XCFA 4LC6A 1G4TA 3VI2A 3PAJA 1PV8A 2FTPA 1SFJA 3QSTA 3UWZA 3OIXA 3B0PA 2DZPA 4U28A 1MSSA 4ZQRA 5K2ZA 2DJLA 4ADSA 4X3ZA 4FXRA 2ATSA 1R2SA 3QPZA 1TPDA 2X1UA 3NL6A 3IGSA 2D73A 3L66A 1W5PA 3O6DA 3B03A 5D09A 3PB2A 1B9BA 3FIGA 5EMUA 2E09A 2NV1A 2RHGA 3EWXA 1B4KA 3S8HA 3O06A 1K7XA 4UTMA 4ZQNA 1W5MA 5HWJA 3MYOA 1P4CA 3WK0A 3NQ8A 4K37A 1OX4A 4Q4KA 3O63A 1R47A 2Y85A 4DO6A 4GUGA 3M47A 3TU9A 5CPNA 3L5LA 5D2TA 3VNDA 3FFSA 2F84A 3W1MA 4CCEA 3TC7A 1FCUA 1ZJIA 3I68A 5HNRA 4TMCA 1I2QA 2QCNA 4FB7A 3LLFA 4M19A 2NUWA 1FWSA 4JTGA 3LHWA 3CC1A 1TPUA 1SU5A 3IV3A 3UXAA 1SFLA 4XQ6A 2ZTKA 1PS9A 1ZNNA 2CZFA 4YXGA 1WBHA 3G1FA 5G4EA 2E1DA 3C4UA 3T78A 1FCQA 4FNRA 1XC4A 1FDZA 1YDNA 4UTLA 3M0ZA 1KFBA 3EX2A 3TROA 1PE1A 4OHQA 3MHFA 1KLZA 4O16A 2NUYA 3MUXA 3MP3A 3LBCA 1QFEA 2ZA3A 1JUBA 5T26A 4O0KA 5DELA 3S1XA 1ZENA 5I3HA 3QFEA 3SIZA 2YFOA 1F7BA 4Z1DA 3TK7A 3T4CA 5DN1A 3UYCA 2BTMA 2FFCA 3HBLA 1S5WA 4IGHA 3H54A 3MHGA 1VCFA 1XDMA 2CZEA 4IQLA 4FIRA 3W86A 2CWNA 3HGRA 1JRCA 4OE7A 3TW7A 3G1AA 3WJWA 1R2RA 2Q3OA 4ICNA 4JTIA 1NEYA 1FY6A 3SR7A 1KV5A 1L6WA 1LOLA 4MOZA 5FEZA 2Z0IA 2ZYFA 4UCGA 2A1YA 3W9ZA 3W75A 5EKYA 1K8ZA 4BWLC 3PB0A 1KFLA 1OF8A 3P61A 1BWLA 3RU6A 4BI6A 3M44A 5J5DA 2BLEA 2QCMA 1XKYA 3BW3A 3C61A 2P1FA 2OX1A 4YWIA 1F76A 3I7RA 1HTIA 4ML9A 4Y8FA 3VE9A 2GVGA 1RQHA 2V5BA 5GVJA 3W2KA 1QNVA 4O18A 5HWNA 1QPRA 1A5BA 2A4AA 2QJIA 1LBLA 5A5WA 5ABTA 1T8XA 2PC4A 2WO5A 1RQEA 3LCXA 1VGAA 3RNDA 4N6EA 1HO1A 2X16A 3BW4A 5EPDA 2Q8LA 5K9CA 4CNPA 2GQ9A 3W22A 2YYUA 2PURA 3B06A 4FF7A 2DP3A 3C56A 1TREA 4UMAA 3MI2A 3GDMA 4MY1A 2QAFA 3W7IA 3CPRA 1KA9F 3WJXA 1KM6A 2FLIA 1OFQA 4UTWC 5HINA 2RDUA 3LHZA 3WJYA 2WJZA 4GJ1A 1JCYA 3KAOA 3NL3A 4JXCA 3W6YA 5AYXA 5H91A 3LTYA 5KZEA 3T7VA 4A22A 4S2BA 3GNDA 5EYWA 1DVJA 3EKLA 1BTMA 1N7KA 5I3KA 2OZ0A 3M5VA 5CGQA 1SO6A 4LRSA 3UNDA 4RZ5A 4O8RA 5G2HA 4ZQPA 2ZZ6A 5AHFA 1JUKA 1ADOA 4K7VA 5F2LA 3TSBA 4O10A 7TIMA 3HF3A 2ZZ7A 4HPJA 2HS8A 3OVRA 2V2CA 5BRBA 3NXFA 1K8XA 3W88A 1HO4A 3P7YA 5EL1A 3O1NA 3TW6A 3W1QA 1U83A 3C2OA 2RH9A 1VCVA 1H7PA 2ZZ5A 2NXHA 3GDTA 3TFCA 4AF0A 4WXZA 3NPXA 1FUYA 4Z1AA 1VC4A 3STEA 4AEOA 1F05A 3SZ8A 3HGOA 3TAKA 2Y7EA 2R91A 4X22A 3WK2A 5DXXA 4W9TA 2VEIA 1HUVA 2O7SA 4N2YA 4MZYA 5AYZA 5CZ0A 3THAA 3GDRA 1GVQA 3LLDA 1EX5A 1D9EA 5G5IA 4UFMA 1X1ZA 1PL9A 4GUIA 3TR2A 2V9DA 3HPXA 4MFEA 4YL2A 3QQ0A 3QPYA 3PY2A 1AW1A 2NX9A 3PSVA 2I14A 2J9YA 3S5YA 1WOAA 2BZNA 1AMKA 3W76A 1VYRA 1XUUA 2AQWA 3W7MA 4MJMA 3RLVA 2B7PA 1KTBA 1KW1A 4FX8A 3NM1A 4WX2A 2Z1BA 3FKKA 1ME9A 3EWZA 5DBTA 4RKAA 5CZSA 3G8RA 4G1KA 5D05A 2EF9A 3IVSA 3L68A 3FYOA 1P5BA 4UUIA 3VCRA 5BW6A 4R33A 3UY8A 5G4WA 1N55A 3KXQA 4I7WA 4JX5A 1GYNA 2X30A 4JICA 4ZL1A 1ICQA 1S5VA 5C2XA 4UMCA 1PIIA 1TRIA 5LZLA 2ATMA 3NZRA 1X1OA 5DLCA 3FLUA 2NV2A 3LCHA 2OMAA 1KM0A 1DKWA 3GDLA 4DBDA 2XN2A 2QCGA 2VFGA 1Z44A
chains in the Genus database with same CATH superfamily
1E51A 4IUGA 3CTLA 7REQA 3QLDA 3HG2A 5H8UA 4OQVA 4NAFA 4DWSA 1FDYA 1P7TB 3DCPA 1CLXA 1I2OA 1BKHA 4JN6A 4XZ9A 4GGBA 1PX3A 3U4FA 4I7UA 4P61A 2IQ0A 5BWFA 2O7QA 1P0EA 3LTPA 1Z8AA 1SW0A 3NJ3A 4MWAD 4L4LA 1O94A 4KFNA 3SM0A 2QMJA 3PBWA 4MTVA 2WSPA 2QDHA 1Z32X 4P7RA 3CWNA 1SW7A 3UWEA 3EGJA 1RA5A 3WQOA 1UUMA 4QR6A 4LAKA 2MANA 1TMQA 4S3BA 1XLEA 1PAMA 5AHNA 2D2JA 3W1RA 2PCEA 1E6ZA 1DQUA 2PB1A 4N9DA 1EOMA 4V33A 1FBAA 2YCLB 2I9UA 1A5NC 4JTUA 3VIJA 2OZ8A 2P76A 3EDKA 2WNQA 3ZR5A 1I8JA 3NDYA 4K68A 1NOWA 5HPCA 1LOQA 2VYOA 3U2EA 2V82A 5FF2A 3EMZA 1W1PA 5CSUA 5LXXA 1B3OA 4QCEA 4Y8EA 2GOKA 3PBUA 2JFEX 2XTKA 3IGHX 5CPMA 2ZE3A 2PP1A 2Z7GA 1FWIC 4J3XA 1E6NA 5K4ZA 2IPJA 1DBTA 5AHMA 5C7VA 1QNPA 5CBIA 3NGJA 2D2HA 2VR2A 3GR7A 2WSQA 4GD0A 3EOOA 1LWIA 1K9DA 4W86A 5FAGA 5GJPA 2YA1A 3ARRA 4PMZA 3QFWA 3WDRA 4FXSA 2Y24A 3CHVA 3RRXA 4KGLA 3GX9A 1CGXA 1RQBA 4EWJA 1DTNA 4FHAA 4R53A 3BXWA 1XFCA 3WD1A 3MO7A 3QY7A 4LAUA 2VVNA 4WIWA 2NX1A 1XIBA 4F8XA 4IX2A 4RUBA 3QKEA 1XDLA 3EDEA 3H24A 4N42A 1G69A 2DZSA 4NX5A 4ACZB 1SZNA 3LHVA 1K3UA 3LS9A 3F7JA 4B9YA 3HGJA 2POZA 3T0AA 3BAWA 4WDUA 2V81A 4JQAA 3UD6A 3QLLA 3R94A 1ALDA 2X1RA 1YDOA 1NFGA 4S3KA 4H8NA 1SJBA 4MLRA 4NVTA 3BUVA 3GVQA 2JQXA 1EF2A 4IJBA 2VRKA 3ZFHA 2ZE0A 3PTKA 2PCQA 1A0DA 3IV8A 1V0NA 1P0KA 3B0YA 3INPA 3CUHA 4MM1A 2GGEA 2X0YA 3V36A 3CL6A 1YXYA 2DIKA 3EDFA 3WDIA 2TRSA 5GNYA 1QNQA 2HE8A 3BURA 3L9CA 3N3MA 4DLMA 1MW1A 3A4JA 2BASA 4Y6GA 1EC8A 4HTBA 1NF7A 3G8EA 4HT3A 3WBYA 3TYEA 4AX6A 3R8HA 2WLZA 4TTUA 3HQNA 5A6MA 5E1QA 2QDDA 4F2TA 4J1OA 3BAYA 4HPHA 4X61A 2VEPA 3QPEA 5CJNA 3M0VA 2PLCA 4C7GA 4NJGA 1DORA 3MVIA 1HN1A 3GH7A 4HCHA 1WOBA 3E9AA 1MWOA 1J0ZA 1LRQA 3B0UX 3H2CA 2NQ5A 3WF3A 4GGHA 1EPXA 1YTEA 2VKZG 1E43A 2VELA 2GGJA 1E9LA 3HO8A 3NQEA 5HMEA 2QCEA 4Q7NA 1JYXA 3CK5A 4LVAA 4C6EA 3VGDA 4LPCA 2OEMA 4UTTC 2Y8UA 3RXZA 3JRKA 3PZNA 3VMOA 4YVPA 2VP8A 4NQ1A 4DBEA 2JBMA 4PTXA 1GW1A 2C1HA 3NZ1A 3UG8A 4FLRA 3ZT6A 4B5NA 1ISVA 1TPVA 2WC4A 1NAL1 1JPDX 3OO2A 3OHIA 2YW4A 3W2MA 3QKZA 2PF0A 1XRSA 2JKPA 4L6OA 3MW7A 3W7DA 1LORA 3ARXA 5A8GA 3R0DA 1V6XA 3F2CA 4A3RA 1H11A 1KBBA 1RV8A 3DKLA 5JMUA 3GH5A 1Q6EA 4R34A 7TAAA 3Q94A 1ME8A 1WDDA 3GVVA 3ITLA 3AIQA 3MV11 3S2MA 3NSNA 5XINA 1JYVA 3HM7A 4IM4A 3PJTA 3APYA 1KFEA 2JK2A 4GZ7A 2NQLA 1KGUA 3S1UA 1LBMA 4NRSA 4UXDA 3TN6A 5IRPA 1X6UA 3I3EA 3P84A 2XUCA 1OWQA 4I9JA 1NARA 3W71A 1G4EA 3TAOA 4PB5A 4CCCA 1DIDA 4NRRA 2W3ZA 5HDRA 2PWEA 4LWWA 1A5MC 1IXNA 1WB0A 3S2CA 4ZO7A 5IFTA 3MDUA 1JULA 3GRIA 1EA0A 2BOGX 3IACA 1Q63A 1V3KA 4IICA 3CASA 3VDHA 1PSCA 2QV4A 5H8MA 4AYSA 4KS0A 1N8FA 2WAGA 3PWAA 2PTXA 3QV9A 4XSMA 4A21A 4WLCA 2J66A 4IPIA 4ERAA 3BPWA 1W3NA 3M7WA 3REQA 3CQJA 4XB3A 1TB3A 1S3TC 3S1WA 2INZA 5FD0A 4AD1A 2FYMA 4QG6A 3S5OA 1E1EA 1XLIA 4JTEA 3B0VC 3KVJA 1XH2A 3MY9A 4OBSA 1OC5A 2C7FA 2CBVA 2CNCA 3V3WA 5A95A 4LXFA 3P81A 2YA0A 2BVYA 1JF6A 2ONEA 5H1WA 4MJ2A 3I7SA 2BXZA 1FOBA 3DFNA 4DJDA 2GDQA 4ATLA 3ABSA 4PRTA 1YBQA 2OVLA 1ZCOA 4JOMA 1AL8A 1EP2A 1REQA 1H09A 3R79A 2J78A 4U10A 3LERA 3POHA 1IXOA 4RDYA 3RRAA 1GOIA 3AIVA 5BXRA 1NF0A 2QGHA 2OYMA 4MGGA 3WZ0E 3W7PA 4FEZA 4WQ6A 3W4RA 3NDZA 3WLJA 5CSRA 3AUOA 2XFRA 4LVGA 2ZWYA 2E67A 1B3WA 3ANVA 1JGMA 3NO5A 3CB3A 1FWJC 1B31A 1VFHA 2O9TA 1BF6A 2CZ5A 1ZJBA 4HNUA 3FHQA 3FVMA 4NNBA 4IFRA 3U48A 2WHLA 3THUA 2GUUA 2XVLA 2J6XA 1C7TA 4UBPC 4AVNA 4QLLA 1BFNA 4XTDA 5G1TA 3SAZA 5AC8A 1TVLA 4BF9A 3ABQA 5LNRA 1KFCA 1XM3A 4LBUA 4TO8A 3VGEA 1TJ0A 5I03A 3N13A 1EWEA 4LGXA 4JIIX 5D2XA 1T7LA 3VTRA 1SR0A 3STPA 3MBDA 4NXKA 4WKAA 2Y70A 4NZJA 3N25A 1SQ7A 3S5SA 1P6BA 5A6TC 4B90A 3ABOA 2WJDA 1PX4A 1OEPA 3EDJA 3I7QA 2HK0A 2G5WA 4Z1BA 4P7QA 3BANA 1CLKA 2YL8A 4UOZA 1OCBA 4X60A 4EF8A 3A6OA 1MEWA 2C3ZA 2OYKA 1M01A 1W54A 2PFHA 4JYEA 2O9PA 3OQEA 2VR4A 4BF5A 2KX9A 4EXQA 3BGJA 4HYWA 1ZL1A 3CXOA 5D30A 1EJXC 4HA4A 1QR7A 1BSIA 2PRHA 4UTJA 3KHJA 3SURA 2EJAA 4KERA 2I16A 5KINA 3CYVA 4AIUA 4ERGA 1VPYA 3BAJA 4QEHA 1PZ1A 3TTYA 4IL0A 1F6KA 3UR5A 3B8UA 3P5ZA 3RUBL 2GQAA 1F3XA 3SY5A 1GCYA 1JDEA 2H6RA 3DDMA 3ORWA 5CSSA 1XBXA 2C13A 4PN2A 2PWHA 3BJFA 3OZOA 3NOEA 2GSHA 2CBUA 1TTIA 4FK9A 2D0GA 1SZEA 2HWGA 3PP7A 2QAPA 3KFTA 2VGFA 3B04A 4G1NA 1GQLA 3HPSA 2CPUA 4OU1A 3WF0A 4W7VA 3KBNA 1KO0A 3NURA 1Y5WA 4E0CA 1IEXA 3H55A 5LIXX 2CKRA 3LB0A 4HA0A 1YEYA 3TC6A 1E72M 2DSUA 4LANA 3O15A 4PL2A 4ROQA 2XIOA 1VBGA 2R1MA 3AFBA 2VOTA 4NILA 5FSEC 2Z1XA 1VBJA 4DUWA 3MDWA 3LHUA 3BTNA 3OZMA 3APGA 4P8XA 4NXSA 4DJFA 2ZUTA 2X09A 1F73A 4AU0A 1QI4A 1FCVA 1TIWA 2G97A 1J8VA 2V63A 3TN5A 1SO5A 5FF0A 5C9XA 4HPXA 2GUYA 3PS7A 4NZCA 1P0NA 1U1UA 2YB1A 3KCOA 3ZSSA 3N34A 4CNNA 2DQWA 3UFYA 2OR2A 3JZEA 1DXIA 3WD0A 4XAFA 2RDWA 1IWAA 1LL7A 2QF7A 3ABXA 3FX4A 4LEFA 2EJ1A 4JKLA 3ZXWA 1Q6LA 4MADA 2YB4A 1FDJA 2WQPA 4BKNA 3DFOA 1G7UA 1QCWA 1TQXA 1S2TA 1ZQ5A 3CZ8A 2ZVRA 1US3A 2WWCA 2XSXA 1G4SA 4XBKA 1ZY9A 1MNZA 1KKRA 4JTRA 2W61A 1GOQA 3C3NA 9XIMA 1QPNA 4W88A 3NNTA 2FJKA 1RK6A 5JH1A 3W1LA 1YQ2A 1NH6A 3ZLGA 4L1XA 2F8QA 2XHYA 2Y88A 3GFXA 3O6AA 1SPQA 1JZ4A 1IR2A 4C1LA 1L2UA 2PBGA 3LN3A 1XLCA 1FQ0A 5M1TA 4ADUA 5TNVA 4ORIA 4I5UA 5JBEA 1EUAA 1V02A 1TPFA 4WOZA 3GYCA 1JZ3A 3B4UA 1HVXA 4YLWA 3M43A 3CT2A 2VZVA 3GTFA 4NJKA 4C7FA 1VLWA 3RCNA 1HL8A 3GDBA 3UY7A 1NWUA 1T6MA 2OGJA 4E8GA 1UBSA 3ZVIA 4JNZA 4Z2HA 2PE4A 2PTWA 4WY0B 4QE1A 2XIQA 1ZRQA 1L2QA 3LM7A 2D2GA 4S1FA 4QGCA 5TBOA 1E4NA 3V4BA 4DXVA 5CG7A 3GQYA 4H6QA 1G7VA 4K8EA 4F48A 3LX9A 2FQIA 5HQEA 2ON3A 1Q6GA 1O1HA 1CXKA 1WZMA 1UKSA 4NNCA 3FOKA 3VDBA 1T96A 3D47A 4MKSA 3UJRA 1GVOA 5CPQA 2FZMA 1K9TA 3N19B 4ASTA 4B4FA 1S5TA 4BJHA 2C15A 1LG2A 2NLYA 4L56A 3LD5A 5I3FA 2GJXB 1MO0A 4PTVA 2O0TA 5CEWA 3MI3A 3LCGA 2WSRA 1UD5A 4PR4A 5CJ5A 5F1VA 1E71M 2P8BA 3T8QA 4E3TA 4JYFA 2ZRXA 2CBJA 4O4VA 3M0XA 1SW3A 4IT1A 2QVNA 3F4NA 3NZPA 4RLIA 3ZVHB 4JEQA 1ONWA 4DJEC 1CNVA 1TX0A 3QYSA 1CB2A 4L64A 1TJRA 4WRHA 3NR0A 1GOOA 4BQ5A 4P8UA 1Y0EA 4PMXA 3WEMA 1ZHAA 4V1YA 2VVSA 4HOZA 1UG6A 2VFIA 1CB7B 2V5CA 1HJXA 3IJIA 3YPIA 5DRIA 3B05A 3C86A 1MUMA 1GG0A 3IARA 1Z3NA 1R3WA 2A3AA 3G1RA 4IMGA 1P1XA 1W5NA 2A3EA 4J28A 3V0UA 4F0LA 2E6AA 1TA3A 1VBRA 2GPTA 4HHMA 4PFHA 2Y7DA 2EHHA 3ZZ1A 2E5DA 4Z2KA 3ONCA 1EWDA 1WV2A 3S83A 3BLOA 1D3GA 5RUBA 4FNTA 1LQAA 1XLMA 3LBOA 1NJJA 2V5DA 3HG5A 1WKEA 3KRSA 1LOSA 4PMUA 4Z0JA 2ACUA 4CN4A 1R87A 4O1BA 2GWGA 3N4FA 4M6PA 1LLOA 1LL6A 3UXIA 2IKJA 3DI0A 4QRNA 2YJQA 4ZODA 3T40A 2CESA 1DWJM 4UB9A 1TPEA 4H8HA 1MFVA 1YPIA 6ALDA 1R3SA 4AC1X 1CI1A 3N3TA 1DXEA 1BYCA 4RDWA 3SIMA 2EPNA 3W1PA 5DY3A 4ADTA 4CNSA 4XAPA 3SQSA 4UFHA 5EY5A 3RFAA 5K9DA 1KC7A 4HOXA 2VWTA 4C1NA 1M7PA 4JX4A 2XGIA 4Z42C 3GD6A 4K1WA 1ZBCA 1RLCL 3VGHA 1VH7A 1UWUA 4H7CA 4LYKA 3PUEA 4MDPA 5E9XA 2XVPA 2WCAA 4IPNB 4TX8A 1MRQA 4ZVJA 1XLFA 2I1OA 4C6CA 2OWCA 4LVFA 3EEZA 1TPC1 1J5SA 5LNUA 3B8SA 3CEUA 3GVRA 4ZTYA 4M1BA 1H62A 4AZCB 3WL1A 4US5A 4XAGA 4O28A 1B90A 1C9WA 1Y5VA 2JE8A 4YYFA 2JF7A 4WXYA 2PODA 3H4XA 2E6YA 4S2CA 2JF6A 3P74A 5FKYA 3RMEA 3EB3A 3TYDA 2E6FA 4IMAA 5LNVA 3EPNA 2A21A 2R82A 4GIEA 3KRZA 4R85A 4RW5A 1WQ5A 1E0XA 4NT0A 1VRXA 3LOTA 2NSOA 3IEBA 1VKFA 1TJ2A 5C54A 1QAPA 1R9XA 4DAIA 4O19A 3A22A 4YWSA 1TV8A 1NQ6A 3TE9A 1AW2A 5DT7A 4NJHA 1OFOA 3HGSA 4JFUA 2C19A 5HNNA 1GQKA 3QYQA 3ARUA 3BCDA 2ISVA 3NPVA 1DJNA 2RFGA 1BYAA 3QZAA 1FFRA 2ALRA 3T2QA 2C14A 3DGRA 3RLGA 2FHFA 4BK9A 3TQPA 4RPPA 2V67A 1US2A 4W5ZA 3BVJA 1MZRA 1EKOA 5G4HC 3QZEA 4FXFA 4YTRA 1R46A 4MKNA 4HU3A 3WK3A 4O52A 2WKLA 5K9XA 2G3NA 2PMQA 4JIEA 4NP7A 5BU6A 1BG9A 3IIVA 4HZ6A 2J7DA 4UFIA 3RCYA 3R8GA 1SSDA 4Z0SA 4X9SA 2BVTA 1H7NA 2V2HA 1TTPA 4EE9A 2GQ8A 2XIIA 4HVXA 1XQLA 1F5ZA 3TXVA 1X96A 3M07A 1C7SA 2VEGA 4B2DA 5I3GA 2QR6A 1V6TA 3NSMA 1A5KC 4IFKB 3GR4A 1H1NA 1W1IE 3P8JA 1A50A 2VCBA 4O1CA 3R58A 1QOPA 3WKZA 1GOKA 2G3MA 1ME7A 3K30A 4AB4A 2NW0A 3BSGA 3DAQA 3CHDA 1W3JA 3PFRA 3MUAA 4JIHA 2XN1A 3OLDA 1FVPA 1NQKA 1XLAA 5KSWA 2UY5A 1QO2A 1VFSA 2WYSA 3P62A 4UR8A 1B3ZA 3B9OA 3ICJA 1K8YA 4GFSA 5CKSA 3TOPA 1KM1A 2Z00A 1TV5A 3VNJA 3CNYA 1IZJA 3KDOA 5CBBA 2Z28A 4RK8A 4KCWA 5AHEA 4LF1A 1D3HA 1UPPA 1L6SA 1NM9A 3STCA 5CPOA 4R5EA 4HJFA 1BSLA 4JY9A 1UWRA 1QNSA 3WQFA 3LMYA 4QITA 4BI7A 1A4MA 2YPIA 2FKPA 3AMDA 1NY1A 4ZBCA 2QLYA 4L5ZA 2EAWA 2AAMA 3IGUA 5I02A 3GHUA 1EJRC 1IEWA 1GKQA 7XIMA 2ISWA 3WLNA 3W7NA 2J4GA 4X0NA 2GOUA 1ONEA 2C18A 2Q02A 3RLUA 1KBJA 5BXPA 3T6CA 1DHKA 4TU1A 4Q4QA 4GLEA 4QJ4B 3URAA 3R89A 4AD2A 4QP0A 2WZHA 5A2BA 4XZWA 2HXTA 1FRBA 4NI8A 2EPLX 2GJLA 3BG3A 4A3QA 3SFKA 1R38A 4W85A 3UPBA 1ONRA 3SSJA 1MEHA 1PTGA 4PGLA 1XCFA 1PV8A 3QSTA 1OD8A 3OIXA 3GXMA 3S9ZA 4U28A 1TELA 1MSSA 2WMHA 3SUSA 4GI9A 1GJUA 3PTDA 4HHHA 2FFIA 4DVOA 2XH7A 1X38A 3K46A 1QPKA 1RBAA 1P0BA 4FXRA 3MT1A 1R2SA 3QPZA 2WCSA 1TPDA 2WJEA 3KHDA 2VX7A 2PLJA 1N8WA 3IGSA 4H6RA 3L66A 2ZOXA 3O6DA 1TR1A 5D09A 3PB2A 3BZGA 1B9BA 1ODZA 2IPFA 2Q09A 1E4MM 2BMBA 3QTGA 2VDGA 1A49A 2NV1A 1EEXA 2YDRA 3O06A 1RH9A 4UTMA 3KTSA 2FH8A 5HWJA 4GY1A 3WK0A 3NQ8A 1QNRA 2REQA 1YW1A 3AHXA 2Z26A 3M47A 1IE7C 5CPNA 3L5LA 3FFSA 2F84A 3V0TA 3W1MA 3CJPA 1DP0A 5HNRA 1RK5A 3DC0A 4M19A 2NUWA 1P48A 3IV3A 3HZ3A 5GQBA 4KETA 1JI2A 2F6UA 3G1FA 3CTTA 4MWAA 1EC7A 3C4UA 5IDZA 1KFBA 3EX2A 1ELSA 1C91A 4E3VA 3L2LA 3KDNA 7CGTA 1JGIA 1CEOA 1Q4WA 1XLLA 3MP3A 4I9TA 3LBCA 2VZOA 1QFEA 4DO7A 1FHDA 3ZT7A 5DELA 2PS2A 3W38A 5IHSA 3GG0A 1B9ZA 3TK7A 3GTXA 4PMDA 2BTMA 1F07A 2FFCA 4S3FA 2QGYA 4LUSB 3C0SA 3P0WA 3GC2A 1Q7ZA 2CWNA 2YA2A 3FNDA 2HBXA 3DHUA 3TW7A 5I24A 4IP7A 3G1AA 2Z2BA 1C8QA 1XGZA 1PJ9A 2OYLA 4XVDA 3SR7A 1KV5A 3N4AA 2XVGA 4WJXA 1UWQA 4MOZA 1UPMB 1EQCA 2Z0IA 3FA3A 2ZYFA 2XSAA 2A1YA 3V0SA 1XLKA 2HXUA 1JZ8A 3PB0A 3P61A 3ZO9A 4QE4A 1HKIA 2BLEA 2BHYA 2P1FA 2OX1A 1HF6A 1OGSA 4YWIA 3KW3A 4IG2B 1F76A 2WNWA 4TVUA 1BRLA 2WVVB 1GJWA 1FWDC 2V5BA 2XWDA 3H12A 4ZCWA 4QTGA 3TR9A 1MUWA 2NQJA 2A4AA 3H6OA 5A5WA 3LCXA 5FJPA 1HO1A 2X16A 3SEPA 5E0FA 5K9CA 4B16A 3T08A 3B06A 1TREA 3WF4A 5FOOA 4MY1A 3E0LA 1W9BM 3GIQA 4ZXLA 3R1ZA 3LHZA 3WJYA 1XCXA 3MA8A 1KFWA 3EA3A 3ME3A 3WNLA 2A3BA 3ES8A 3DC8A 2FVLA 3TEVA 5HK4A 3CO8A 1BTMA 2R1PA 1BVNP 1N7KA 3V18A 1R5YA 3WQGA 1UYQA 2VZTA 3BE7A 3WNKA 1A5LC 2XYLA 1IWPA 3T42A 2XWEA 4QAWA 3VYLA 3SGGA 2BGQA 4EPKA 3KL5A 1KBKA 1EJTC 3OGVA 4QG8A 4E2VA 1K8XA 1AQFA 3UJFA 1HKJA 3C2OA 3G6LA 4WVXA 2BDQA 5BYWA 2OKTA 2ZZ5A 2TODA 4AF0A 1H3GA 1V6YA 2QDEA 4QG9A 1OT2A 4AEOA 3LZ3A 4HYVA 2G37A 1GVIA 2ASHA 2R91A 3DERA 3LENA 1LT7A 4N2YA 3W53A 3TTEA 3MCMA 4NIRA 3VIIA 4IQJA 5BU9A 1KCZA 1TWSA 5A8QA 1XG4A 5G5IA 4XO7A 4GUIA 2V9DA 3HPXA 3RGTA 4TTGA 4YL2A 3QQ0A 4DM1A 4JBRA 1W1VA 3PY2A 3E0WA 3S5YA 1DJGA 4M24A 1WOAA 2V3DA 4GVFA 3W76A 3B8IA 1VYRA 2AQWA 3P0XA 4CVUA 3WMLA 3NM1A 4WX2A 3N29A 3EWZA 1LF1A 2EBNA 1NDYA 3IVSA 1D8WA 1F4AA 3L68A 2WVSA 1LUCA 3UY8A 3JU2A 1QRQA 3CAWA 1N55A 1X8CA 4I7WA 3O3RA 3DFHA 5AZ0A 5CBJA 2E28A 2X30A 1AD1A 1KKOA 4JICA 1ICQA 1J0HA 5C2XA 2ATMA 4KRTA 4OIFA 3NZRA 1X1OA 4IIGA 3FLUA 3SCVA 4D1IA 2NV2A 2YCJA 1P0DA 2O9RA 4BQ3A 3W7CA 3QJAA 2QUNA 3A24A 2GVYA 4Z2LA 1EIBA 2HEJA 5MKGB 1RA0A 3N04A 3VMNA 2Z2AA 4KWOA 2Z1KA 3DXIA 3BLIA 3ZYZA 4KPLA 3SRFA 4O1EA 2DUAA 4A2SA 1K7FA 1RCOB 4WK9A 4XD4A 3VD5A 3OEXA 3BLKA 4R9XA 1D3CA 1XUZA 3GG7A 4UQ9A 3K13A 1UR3M 3TONA 3BJSA 1FWRA 1KR1A 1W9XA 2DW6A 5G2IA 1OIFA 3ARQA 5ABFA 1KM4A 4JFSA 1RSCA 3OZPA 1TR9A 2ZZ3A 2Y8KA 4AZBA 2A0NA 4YHGA 4IJRA 3WEOA 5F2GA 3PTQA 1GVRA 1ZTVA 1W1TA 1C9DA 1OVDA 4GQGA 1JQXA 2YXOA 3KCJA 4NZ3A 2CLIA 3LG3A 3EMQA 3GXPA 3UJ2A 3CAKA 1MDLA 4B92A 3SN4A 3T09A 2YOCA 1E9YB 4O15A 3I6EA 3LEPA 1OB0A 2BFGA 6TAAA 3LA4A 1JCMP 4WDXA 5BRQA 1I1WA 4RNFA 4PB3A 2P0IA 5CZJA 4OBRA 3JS3A 1B57A 3PANA 1R86A 4LB3A 4AWUA 1X39A 4MNMA 3QMSA 3W1NA 4MSSA 1RJRA 3VZZA 2QZRA 4WF7A 4P2VA 4PMQA 4CNTA 1M6JA 2QW5A 4W7UA 3EWYA 4AZIA 1KRBC 5DT5A 3VNIA 1J0JA 2C71A 4Y9AA 1NWTA 1XXXA 4K2SA 1IZKA 4XKMA 3UG5A 3GY1A 3EAUA 4YTUA 1Z48A 4FPSA 4R7OA 2NT0A 3WNMA 3F03K 3S5NA 2RDXA 5F4XA 2YYTA 2ICSA 1IR1A 1P6WA 3LQGA 1QVBA 3C2EA 4RW3A 2EKCA 1H7RA 1H0IA 3AO0A 3L65A 3AMGA 4WDTA 2OJPA 2BVWA 2GJNA 1W31A 4EVZA 1RPKA 3AI0A 3W01A 2G3JA 5FJOA 1ODUA 1OINA 1QW7A 1OFAA 4NASA 4GQ0A 1VHCA 1JYNA 3GU9A 5K4XA 2Z24A 3VAVA 3AXMA 3KUMA 5AC6A 3C2VA 3I4EA 3W7RA 4TMBA 3U5UA 2GUBA 1HJQA 1JPMA 1JQVA 2E6DA 2BOFX 5A8OA 1CT5A 5A2AA 3B8TA 3TFXA 3FEQA 1HXJA 3G77A 3MKVA 3K4WA 5IBXA 4DHGA 2CLOA 3LCFA 3LGGA 4WHBA 4DB7A 4DUOA 6CGTA 2E1WA 1PKYA 3AHZA 4G2DA 5AN7A 1JXJA 1MQQA 2PGWA 5CQ1A 1F9CA 2IPGA 3D5HA 1IYXA 2DV0A 3UXDA 2FPYA 3LNPA 2YCKX 3DHPA 4IFOA 3S47A 3CQIA 4QNWA 3VD4A 2VR5A 4Z1YA 4FO4A 1JZ7A 4PTMA 3Q67A 1PEZA 1IHIA 2IXVA 3ZJKA 3UGVA 3TYBA 3QBUA 3ECQA 3EPOA 1QI2A 2E5BA 1XWYA 3H21A 2G3IA 4LUJA 3GUWA 2AQVA 1TQJA 4YTSA 2OLAA 1AL7A 5A2CA 3LXCA 2ZDSA 2B4GA 1HW6A 5IM51 1CYGA 3KL3A 2X7VA 1GUVA 1HKKA 2GDUA 3CMFA 2ZRWA 1JCNA 3AZSA 1SO3A 1KFKA 4B5VA 4MIMA 3TIMA 3N18A 1FA2A 1K77A 4UTFA 3CZLA 5HQLA 2ZWZA 4I3GA 3M5ZA 2ZX8A 4WJEA 2O4QA 1XBYA 4Q8OA 2YLAA 2DZTA 2HTMA 5I2UA 3A47A 3UCDA 4E5TA 4PUWA 3MI6A 3DG3A 1M7OA 2JKAA 3D0CA 3ZR4A 4J3WA 4UZSA 1VD6A 4NAEA 4M1RA 1SJCA 4GJIA 5D2YA 4J3VA 1VP5A 4GNJA 1ZCCA 3GFYA 4FOKA 5I07A 4PMYA 2LLEA 1IIHA 3AUJA 4AH7A 1D8CA 3GNXA 3XINA 2QYGA 4WUIA 2R14A 1X6LA 3T05A 4UNKA 3GAKA 4XKYB 1S1PA 5EMJA 1U1HA 4HSHA 4H9ZA 3W7JA 3NZQA 4ZXOA 2V5LA 3EWUA 3AYRA 1YNYA 1EJ7L 4JQ4A 3W1UA 5AC4A 5JVLA 3QF0A 5REQA 1FHVA 3AS1A 4E2OA 1EDQA 3H8AA 1IEQA 4GVIA 1M04A 3HFTA 4W84A 5C6MA 4MAVA 3BARA 5FAJA 2EGZA 3F2DA 4M81A 3EWBX 4DF0A 5JU6A 1DJQA 4N6FA 4HMDA 4UCFA 2ZBTA 2JGQA 1XFBA 4GC4A 1GPFA 2QJMA 3S46A 4GYKA 1K4GA 1KM3A 1DJWA 3UU0A 3GKFA 3G24A 1UR9A 4GX8A 3STGA 1XLBA 3GXTA 4W7WA 3GIPA 5HJYA 5HNTA 3W74A 4G7EB 5BXTA 4PL1A 2TYSA 3ATZA 1GVYA 1SSGA 1K9FA 4ZO6A 1G6CA 3UCQA 1TCDA 2WMIB 2POTA 3OTRA 2EG7A 4JTHA 1BEUA 2VQTA 2PA6A 5HUOA 2GZXA 3IUIA 4CLMA 1XIJA 4Y9OA 3C2RA 4U2YA 2VEKA 4D2JA 1A53A 4QHRA 2OB3A 1P7TA 2DT3A 2X2GA 1DWIM 3MSYA 2Y8VA 4CD4A 2WZTA 4JTDA 1Q7QA 2B7NA 1QBBA 1PKMA 2CXEA 4HU8A 3BGAA 2I5GA 3LRKA 3RITA 5E9AA 1EGZA 3VNLA 5HAOA 5G2WA 3TCEA 4IPPA 1OC6A 2W63A 1E0UA 3M0IA 3TMQA 4WOQA 2ACSA 2DVUA 2V68A 1E0WA 4D71A 2WMJA 3E3HA 2CITA 4CCDA 4KWVA 4AD3A 1FWWA 5C9WA 1EEPA 1JZ5A 1MXDA 4OWGA 2YCLA 4B3KA 3IIPA 3P80A 4O0ZA 3SY8A 1NOFA 3DHDA 5FF4A 9CGTA 4GK8A 1LDCA 4XD5A 4HK7A 1GZ1A 1O1ZA 1O7AA 5TIMA 2ZUWA 2P88A 4ML4A 3HA1A 2R1NA 1LWJA 2ISFA 3OLEA 3L0NA 4DYJA 1KCLA 4YYCA 1O60A 1DOSA 2H8ZA 3TOYA 2QKFA 2VWSA 4RV3A 3PBYA 3LCLA 1Z42A 2XISA 1IQ8A 3N9KA 2I5IA 1K6WA 3DENA 3GVGA 2NVDA 1Q7MA 2V30A 1NDVA 3QGKC 1XG3A 3OP2A 4QQUA 2WM0A 2DZUA 1YX1A 3RJYA 2QCDB 1RVGA 5TF0A 5I3DA 3MU7A 4ZSUA 2VHLA 4HN4A 3SCTA 3CMJA 3SFWA 3Q45A 4NZFA 3TZFA 3BLPX 4MB1A 4MB3A 5A8MA 4Q7IA 2CHOA 2HBVA 1JEZA 1LZOA 1OYCA 2Q01A 2J9XA 1T41A 3S6DA 3G1HA 4LRTA 4B5UA 1Q6CA 4TVDA 4A8RA 2VENA 3FJ4A 3V35A 4EF9A 3BL3A 3O16A 3W7QA 3SQMA 3MTWA 3LMZA 3KBJA 1ZS2A 3M6DA 3VXGA 1RUSA 4JTKA 4LCSA 4ACZA 1H63A 1ZGDA 1VBUA 1GW9A 4CD8A 4D72A 1HKVA 4XD3A 3AS3A 3S6OA 2GLKA 2ZA1A 1DJIA 3AWOA 1H1ZA 1OCQA 4F0KA 1WXZA 3URQA 3PHAA 2ZRUA 3KOWA 1RZMA 4HKPA 3J7HA 4A8LA 3CPGA 4HNVA 2FPTA 4DBWA 4HNTA 4P7LA 1AVAA 2YL5A 4DLFA 4XTIA 1C90A 5D8WA 1HJWA 3K8KA 4AZ7A 3RX2A 2OT1A 1TWZA 4Q4MA 2YXXA 1TV2A 4K39A 1XD1A 3WF2A 3G2GA 6REQB 4W89A 5IDIA 3WUBA 2WVUA 4GO9A 3ZJ6A 4ZEPA 4YNGA 3UP8A 3TC3A 3PJXA 4CKQA 3HG4A 1YXDA 3NM3A 5AC7A 3G1VA 3TYAA 2ZX9A 4MUPA 4GE8A 1GVSA 3N9RA 3U3HA 1UMYA 1UWSA 2ZXBA 2WJFA 3C0QA 4GI6A 1C29A 4HA1A 1PWLA 1C8VA 3RU8X 4Z17A 1PHQA 3PBGA 3D46A 4PMJA 3NQFA 1R0MA 1DQWA 1S2UA 1Q2RA 1LT8A 1GVEA 5F4WA 4CQAA 4LS2A 3OOQA 3KRUA 3PZIA 3WLHA 3HPZA 2ACQA 3M5XA 5BZAA 5E0CA 3OODA 4CEUC 4IIHA 1D7FA 1VFMA 4C7DA 4CN1A 1XIGA 4RNHA 4FX7A 3TZNA 3T8LA 3W83A 2J79A 4B5SA 2BODX 3N15A 1VCGA 2V2DA 1IEIA 2XINA 1QOQA 1OFEA 3DOPA 1UASA 1UA3A 4YHEA 5I3IA 3PWIA 4GXMA 4IIDA 3DFTA 5B7YA 3LK6A 3M0MA 3HQOA 2DW7A 1CXIA 3O8AA 4XISA 4H7VA 1DWHM 4EXAA 4QJ1A 3PM6A 3EXSA 3QW3A 3PPFA 4UWMA 4NHVA 1TYGA 3CAVA 1PUDA 3HQ1A 1FWNA 1BD0A 4GACA 4GVGA 3KWXA 4GYPC 3MWCA 5C9ZA 4C90A 4PTNA 4HNNA 3W29A 5JIWA 3BICA 4NKCA 3SGZA 4J2MA 3FA4A 2IQTA 1J5TA 3O0FA 1GYMA 5DXYA 1O68A 4LALA 3IIZA 4DIAA 3KOYA 2XIMA 1F3EA 5A8NA 3TNBA 5FEPA 3H2AA 4Z08A 1AJ0A 4DWSC 5C70A 3XIMA 3BK0A 1LROA 2ZQ0A 5EMKA 4PMRA 4ZMGA 4FF5A 3RO6A 1ECEA 3BV7A 5C2GA 3W6LA 1V6VA 3MMDA 5AYBA 4FX6M 3VIOA 3DBPA 3AOFA 1XGEA 2BSLA 3NG3A 3OZYA 4O1FA 5HULA 2E4TA 1HP4A 3GUGA 1LP6A 5F1UA 4PUDA 1KXVA 5AVNA 3U8GA 1ESWA 3W70A 1XPYA 3ARZA 4QBXA 4JD4A 1OYBA 1W5OA 1VEPA 3C8NA 3Q37A 4RV8A 3VDCA 2EPKX 3M6YA 3W2NA 3GZ3A 4XZLX 3MKKA 1WX0A 4ES4A 1JAKA 4PSPA 3FYPA 3MUCA 5TAOA 4YVVA 1T99A 1JCXA 2PD9A 3IUHA 1Q6OA 2P53A 5K7JA 1RJQA 1UP0A 4AG0A 1PPIA 3AMLA 3BG5A 1H50A 4NZ4A 1Z41A 1WAUA 2WANA 3N4EA 3Q2DA 4R88A 2YL9A 1WDSA 4AWTA 4UTKA 1CECA 1V79A 2PDMA 5AY7A 1TG7A 5I09A 3S2NA 2F38A 2QPUA 3VOFA 2A7PA 2UWFA 3QV8A 3AALA 2E68A 4UOJA 3B3DA 4TXEA 2VMFA 2QCHA 1B54A 3HV8A 4UQAA 4S3EA 4LUYA 1UCWA 1ZALA 4PZVA 2X42A 3ARPA 1VYPX 4HMEA 5E5CA 3G3MA 1XR2A 3VIMA 3G18A 5HR7A 1AJZA 2DSWA 2DDXA 3WDQA 2J88A 2HVOA 1KQZA 1XH0A 2XVKA 1OFRA 1W3KA 3CL7A 2VEMA 5FESA 2ZRZA 4GCXA 2AMGA 4KMQA 3GAYA 3NAVA 1UR1A 3VE7A 4XIAA 3N73A 3ALGA 2Z1VA 1L6YA 4FNPA 2VXNA 4YPJA 1XC6A 1SZFA 2BWGA 3N2MA 2UZ9A 1UJQA 2DIEA 1WNOA 2OT0A 3RPDA 4ZQMA 2CLKA 3ITOA 3MKCA 3IJDA 1NELA 2XM2A 5LGZA 4DO5A 1WKDA 2AQOA 3ZLFA 3PUDA 1G9HA 4H9YA 1EO5A 2OWWA 2CXGA 3R25A 3G0SA 2XZ9A 3W7KA 4MNKA 2PWVA 2QCFA 4QDMA 4EXBA 1UW9A 4MJZA 4CQ9A 1UZDA 4H8UA 2CW6A 2VOMA 4WSKA 2J8TA 1RY8A 1LLZA 1ZAJA 2H3DA 1LCOA 4LY4A 2PBOA 2VC9A 2W6RA 1EF3A 4UFKA 1SM9A 4A3HA 3UF9A 3KTXA 4JPGA 2VNCA 4KIEA 2V5JA 4GBUA 5LKYA 5BCAA 3LGEA 1W1ZA 1NP2A 4L4PA 3HIJA 3WMSA 1UUOA 2J47A 1EDGA 5KTLA 4K8HA 3LSCA 1NIUA 2WMFA 4DUXA 4KEVA 1RY0A 3BSMA 3ZWSA 3G1DA 3WD2A 3WYZA 1KM5A 2GWNA 2DY3A 4IX0A 3U6WA 4OUIA 1E9IA 3QY8A 1W0MA 1LYXA 2UV8G 3W28A 4D6DA 3RLHA 3VIHA 3DU0A 4WCJA 1WDWA 2KZHA 1I45A 1GHRA 1TZ7A 1VFFA 4NZ1A 2D3LA 1ZBKA 3GKAA 4C91A 3CLMA 4M0XA 2OODA 1R3QA 3F2BA 3XISA 3EXRA 3CUXA 1TMHA 2I5QA 3CB8A 2VUNA 1YIXA 4PUNA 3ZS4A 2Y5JA 4MKVA 3PF3A 1PZ0A 5AOUA 2YDSA 4A29A 4JY8A 1GVFA 1W6TA 3SCOA 3VGBA 1B4EA 4TUFA 2PP3A 2UY4A 2EPHA 1Z7AA 4AD0A 4JTCA 4DZHA 2J9ZA 1DE6A 1M3UA 4M7SA 2HJPA 3T55A 2TMDA 3MUY1 1O5RA 3E49A 1QDSA 3DX5A 1K02A 1TUXA 1B0IA 4UFJA 2VZUA 3OB8A 3FCPA 4FS9A 1DE5A 1MZHA 4LC8A 4DUVA 4YCOA 1LRTA 2E7FA 4IXHA 3W1TA 2Z29A 5BMWA 4A3UA 4AW7A 3N6HA 1YPXA 1YNQA 1E15A 5FL0A 2GJPA 3L0KA 3UG4A 3NQCA 2QIWA 3CH9A 5I23A 1V4YA 4FALA 1CTNA 3WUEA 3W7GA 3R8RA 4ZB2A 1DIOA 3GIYA 3RN6A 3HJEA 4HCDA 4LAOA 1EFZA 4GISA 2PAJA 1TV7A 3MMUA 2Z4GA 5A3HA 3W0KA 3A3XA 4OOZA 4N9EA 1GTHA 5J04A 3OPSA 4RL3A 3I3BA 1Q85A 3L4ZA 2E77A 2QUVA 4MZ1A 1TKKA 4E6MA 4GBDA 3M9YA 4XSLA 4H8VA 3VKAA 3KP0A 3IS4A 4RDVA 3LXAA 3JUGA 1BWKA 4LNYA 4J9JA 2EXOA 3MCOA 2NV9A 5AFDA 3NQ6A 3QZ6A 4IP5A 1EZ2A 2E25A 3QOMA 4RJEA 3PBMA 2ZC8A 1V7AA 4MDOA 3PN8A 4DJDC 1L6FA 2ZXQA 3HQPA 1NFBA 1ZPTA 3RG6A 1HQTA 4XAZA 1ZBWA 2P3EA 4IZGA 2ZUMA 1BYDA 1BXBA 4GUHA 2WSYA 4WY0A 1JZ6A 2AAAA 1M65A 3AIEA 3SECA 1S46A 2F2HA 4XV0A 2DH3A 3W7OA 2ISSA 3VNKA 4YCPA 1ENUA 1XDJA 1NVMA 2R8WA 3RHGA 4CU6A 2Q71A 5C7HA 4RR4A 1YTKA 1OGBA 3DH7A 4H41A 3T44A 3AQUA 1K6AA 5AHLA 3TYUA 1JCTA 1W9VA 3WCZA 1ISYA 1WKYA 3NQ2A 3AIBA 4LBRA 1V7YA 1B30A 1TPB1 3N2BA 3QY6A 2GJXA 2WCGA 1RR2A 3VGGA 3TLLA 5A94A 1Y5XA 4AY8A 4H6EA 5HQMA 1GJPA 4JCLA 2A6NA 5XIAA 2BX7A 1HX0A 2WOQA 4HPNA 3GC4A 3A4XA 1AG1O 4GNKB 3CWOX 3UZJA 2L5HA 3ITTA 3C5QA 2QULA 2A5HA 2DZWA 4AQLA 4I5XA 2O56A 5DFAA 2DZPA 4DI9A 1TJ1A 1UD8A 3T81A 3ZVHA 3ZMRA 1VIWA 2G41A 1XD0A 2DJLA 2PWFA 2HRWA 2ATSA 1EQPA 1AJ2A 5A6AA 3BMWA 1XIEA 3VOCA 2DSKA 1M9HA 3RYSA 1UD4A 1KWKA 3WNPA 2XFFA 1E1CB 3QGVA 3A3WA 1K7XA 3E2VA 2Y4SA 5CAHA 4QLKA 1W5MA 2PDJA 4IIEA 3WSUA 3O63A 3H2EA 1A3HA 3TU9A 3LU2A 1NP0A 3SRKA 4IQDA 3TC7A 3C2YA 1ZJIA 3I68A 4FB7A 1I0BA 3CQKA 1AZ2A 1FWSA 3LHWA 3CC1A 1TPUA 3AYTA 5D9MA 2D0FA 2FZBA 2ZTKA 1WBHA 3T78A 1NTHA 4J40A 2CC0A 3MHFA 2NT1A 2RUSA 4R27A 4D8ZA 3FK4A 4O0KA 4PTDA 1BVWA 1W9DM 1MVYA 1L8PA 4A8NA 3UR8A 4L7ZA 3PAOA 3GTHA 3T4CA 5DN1A 2QMKA 3IANA 1Z6KA 4IIFA 3ARVA 4YIWA 4GQQA 3HBLA 4JEJA 3ZLHA 2HNEA 3T0TA 3MHGA 4IQLA 1C92A 4LNCA 1JRCA 2I57A 4QROA 3WJWA 3UZYA 4JL1A 1B2YA 9XIAA 2G8ZA 4ICCX 4ATWA 5FEZA 2OSYA 4DWDA 1RP9A 4DJFC 4S3GA 1RJPA 5CG0A 2IPWA 1OF8A 4A35A 1E73M 1BWLA 2Q6ZA 3AC0A 1UMLA 4BI6A 1PXGA 2VX4A 3DIPA 1XKYA 4AZCA 1DIKA 3T0CA 2ZX6A 4ML9A 2BGSA 1FHLA 1DYSA 1UR2A 4NSBA 3MS8A 2OXNA 2SFPA 5HWNA 2HK1A 2OX4A 1VAHA 2QJIA 1DJXA 1T8XA 3FY1A 1E6XM 4N6EA 4GH1A 4AUBA 3BW4A 2BVDA 4CNPA 2W91A 3UYIA 2YYUA 2PURA 4FF7A 1RCQA 2PDFA 1QTWA 1YKWA 3GDMA 4F40A 1VJSA 8RUCA 2XGBA 4MNLA 3SN0A 2XJ7A 3FN9A 3BH4A 2WJZA 1BYBA 5JBFA 1JCYA 4BEQA 4Q4RA 4JXCA 3W6YA 2ADAA 1S1RA 3LTYA 3T7VA 3GNDA 3WD3A 5I3KA 1E55A 3M5VA 5EMYA 3KRBA 2D24A 5G2HA 2ZZ6A 3QHNA 5CXPA 1JUKA 2WMGA 4KF1A 3SCUA 3DN5A 3RM4A 4ZB0A 4HPJA 3THDA 3OVRA 2GDVA 3MPGA 3P3BA 3K1GA 3L2MA 2F9RA 1HO4A 2AL1A 3TW6A 1U83A 4XX6A 3BQ5A 4Y9NA 2RH9A 4REQB 1H7PA 4ZB5A 4K3ZA 3GDTA 3TFCA 1Y7VA 1FUYA 4Z1AA 1VC4A 3OGSA 3VA8A 3HGOA 4UQCA 3E2SA 2CETA 2VGIA 3AXHA 5D9OA 5JQ9A 4ZTXA 2VEIA 4IFKA 5AYZA 5CZ0A 3UZXA 3NIYA 1GVQA 5CGMA 1M68A 1K9EA 1S5NA 3AIRA 3LSBA 2QXWA 1EX5A 4ILSA 3VCNA 4GG9A 2FGLA 4PMVA 4UFMA 4YU1A 5FCZA 1W9PA 5HOSA 2CERA 3TJIA 4U3CA 4IH3A 2J7GA 2F6XA 1AMKA 4KT2A 3W7MA 2PI6A 4FX8A 1KW1A 2FH6A 2X7WA 4FAMA 2Z1BA 5DBTA 4RKAA 4LJ3A 1F8MA 6PTDA 2X41A 1EPVA 4G1KA 2EF9A 5I0DA 2VX6A 2WZMA 4JTQA 3D3FA 4R33A 4KESA 2QQ6A 4OVXA 4PBEA 2HQAA 2QJNA 3MV01 4GMEA 2RGMA 2X40A 2Z1WA 5CC7A 3EOLA 4UMCA 1W3HA 3M7SA 2VO5A 5DLCA 1X6NA 8XIAA 1XISA 4ZO9A 2NQZA 4DBDA 1OD0A 4WEVX 4LVBA 5XIMA 1G01A 3H26A 4UQDA 3EYPA 5IHRA 3L2IA 4I9MA 3TDFA 3NO3A 1G4PA 3RDKA 5I06A 3GNOA 4O0QA 1GNXA 2G95A 2VRQA 4J5NA 3L7RA 2WKGA 4NL1A 5DEZA 3CQ0A 1HZYA 2D20A 1XIFA 3AISA 3A3HA 3QR0A 2ZCGA 4WSJA 3QH2A 1XL9A 3PZVA 2F61A 2QPSA 1NDZA 3BDKA 4XWUA 3A12A 3MP4A 2NLIA 1NU5A 4M7TA 3THQA 2PLMA 3H2NA 4ALDA 5A6SA 2WZEA 2DU2A 2XN0A 2X0SA 4UOQA 4DZAA 1WAWA 4K7YA 1VHNA 1DL3A 3DYMA 2OWXA 5DCEA 3AMCA 4E4PA 3WL0A 2VT0A 4KCUA 3N11A 2PDXA 3UGRA 3B9DA 2A6LA 5AKQA 3AAMA 2FDSA 2VUYA 2HISA 3OA5A 3IIXA 4WZHA 2J27A 2PWGA 4C6NA 3MBFA 1OZMA 2PRLA 3AXIA 4MG4A 3LPOA 4GKTA 3OA3A 4W87A 4GUFA 4G6CA 1GKPA 3GHSA 4HSOA 1WDPA 1QU4A 1W37A 2DVXA 4IGMA 2AL2B 1ECQA 1PDZA 3C8FA 3CYJA 3LHTA 3UZ5A 4Q32A 6A3HA 1UOZA 3A23A 2VCAA 4J3TA 3WH8A 1MFUA 1EYWA 4DY1A 5CAKA 3HG3A 1B3VA 4PEEA 1Q6RA 1QI5A 2F7FA 1XYLA 2ZZ2A 4IPLA 4N4PA 1VPXA 3CO4A 4P5UA 3WLOA 2FVKA 4RCXA 1GEHA 2O92A 4QCFA 3SADA 3R2GA 3UXKA 4JCMA 1EBGA 5ABHA 3MMTA 3GH4A 1TIMA 1XBZA 4GZEA 2CHRA 5CPSA 4LUSA 3I10A 1KBIA 3DFSA 3WLKX 1TVNA 2J7EA 3BSHA 3MJYA 1PIFA 2Q8ZA 1RD5A 1Q8JA 3TA9A 1R3YA 5A8PA 3MC5A 4ZQOA 2AKZA 4JR5A 4RZBA 1QW9A 4XBJA 1SMAA 1SR9A 2E5CA 2VTFA 3CIVA 4JX6A 4IGNA 1L9WA 4JTLA 5L9FA 1H61A 1KFJA 3KL0A 4GCAA 4C5YA 4O50A 2PDYA 4H19A 5F2MA 5SWUA 3IPWA 4PFMA 4DX3A 3CV6A 3HMJG 4L65A 1VZWA 1EP1A 5HPOA 3QW4B 3VKDA 1RXOB 3RX4A 1MXSA 4IG2A 1PB0A 5DX7A 4AHPA 1I9CB 3UXLA 3R11A 2WVVA 4RPQA 1YMYA 2INEA 2YL6A 4JHOA 1UWTA 4GZJA 3WENA 1D2KA 4EAYA 5DRCA 2QCCA 3SCWA 1GQNA 3W1XA 1WKFA 1I75A 2P5NA 3PG8A 2QDGA 3NQDA 3H70A 1ZSXA 4BY3A 1O95A 4AXKA 3PZUA 1THFD 3KZSA 3W7LA 2WSKA 1VYSX 1QW8A 4LEQA 3VFCA 2VFHA 5T91A 4GOAA 1ZAIA 2GJRA 4AWSA 2XIBA 3P82A 2R1KA 4LS0A 3K8MA 1R3TA 5FI8A 1PIGA 4JYDA 4ACYA 2Y89A 3TWAA 3G22A 3S6TA 4GQRA 2WWDA 2XVNA 5JIPA 2ZUNA 4S3AA 5M3WA 5K3VA 3QSRA 1SJAA 4AD4A 3WD4A 3GLCA 5LHFA 2PTZA 3NA8A 1GPWA 1QMLA 2CYGA 2X1TA 1OK6A 2Y5SA 4KFPA 4H2HA 3LDVA 4LQ1A 1J0IA 1U5HA 2Y62A 2WPGA 3O2LA 2ZXAA 3MYPA 4WGHA 4HP5A 3FYYA 5FF3A 2W0UA 3APTA 5GNZA 2WPBA 4Q33A 1OX5A 3UWUA 4Q3MA 4TX9A 5LIUX 3VZYA 3BV4A 1TE1A 1OCJA 3R5EA 2PDGA 4GIYA 4INFA 2VGGA 5HWMA 1U22A 1UQZA 3NPUA 4JKKA 4MB4A 3B8WA 1EJUC 1XRTA 1JPKA 3GU2A 2ISDA 3FAXA 3WLMA 2VGBA 4P8VA 3PVFA 4JQ2A 3U7VA 2C1IA 4J3SA 1V51A 1EHAA 1ICPA 3VIGA 3W2LA 3C6CA 1WDRA 2EKGA 1TWWA 5C9UA 3P60A 3KBWA 1O66A 1F61A 3D6NA 4ZSTA 4N4QA 3TH6A 2UY3A 3VDGA 1EA9C 4BS0A 3V5OA 3U4AA 2I17A 4IHCA 1B1YA 4E8DA 1SJDA 4C6FA 4TR9A 4BI5A 1FXQA 8TIMA 2HVMA 1UIOA 3S1VA 1YDYA 1XYAA 1EJSC 1SUXA 3WQPA 4YTQA 3WQDA 4J7RA 2CFFA 1YADA 3N6QA 4XG1A 5TQLA 4MVAA 2PP0A 4JHMA 2TAAA 1ZFJA 2R1LA 1E0VA 2QCLA 1SMDA 3B9EA 3MHUA 4GIAA 4H3DA 3BAKA 3F5JA 1XIMA 4HNLA 2BHZA 1FX6A 1F8IA 2NWRA 4DPQA 1EYEA 5MKGA 4J3ZA 2OLSA 1RLDA 3DFQA 3RF9A 3UZWA 3BAXA 1UH2A 3OU8A 3PUOA 5G1YA 1AW5A 4GI8A 3CZJA 3N14A 2W66A 4EWND 4I90A 2Z25A 2O9OA 1BXNA 2WV8A 4M6UA 2AGTA 3BOLA 3O6YX 5FJJA 1UR4A 1FWGC 4WDWA 1H51A 4FZIA 2DT2A 2VJXA 4CVWA 3VDAA 4DJED 3H4WA 3EKZA 2G0WA 2ZXDA 3VKJA 2W27A 1UZHA 3BWWA 3CIWA 3V75A 2Y63A 5BOOA 4Y96A 1VB9A 3AZRA 2FVMA 2J8FA 2WNNA 3VD3A 8CGTA 1YYAA 2VD9A 3ARYA 4AYGA 1RP8A 2V6AA 1KV8A 3GWQA 1UKPA 2YGYA 4MWAC 2NX3A 4GVHA 4NZ5A 4HMNA 2OO6A 2QIIA 2W79A 4JNYA 2ZADA 2CIPA 5BXSA 2AGKA 2QUUA 3EA1A 4V2XA 4JDYA 2QS8A 4DYKA 2EG8A 4H4IA 3CWHA 3FJ6A 4GWEA 3ALFA 1MUCA 2HCVA 2Y7FA 4GXWA 2FTYA 1ZP3A 1JUEA 4M5PA 1JIBA 3QQ1A 4O17A 4Q6JA 4QIUA 1VBHA 1KBLA 1W1A1 3P5YA 1FP8A 2EG6A 3OLIA 5EBUA 3PPHA 2P3ZA 1S5MA 3VUSA 3MZ2A 5CZKA 4QJ5B 2GK1B 4FOUA 2V3GA 5I7GA 1S38A 1US0A 4P7OA 4RZ6A 3L4TA 2DGAA 1FTXA 2WZIA 5HR6A 4TQTA 3S42A 4A05A 1DJYA 3VU2A 3W7HA 5D2WA 1XLJA 2DT0A 3IAQA 3HTWA 4OGZA 4F9DA 4QM1A 3TKFA 5E93A 1EJWC 2FGBA 3I65A 2CZDA 5DANA 2ZX5A 3VUPA 1ADSA 3VC5A 4LYQA 3G1YA 3C3UA 3FSUA 2WBKA 2OEJA 4NY2A 1BVZA 2I7GA 3NUKA 4NX0A 2ZZ1A 1Q6FA 3V1PA 4Q8NA 5C55A 4C6MA 4TOQA 4X2RA 2FZDA 3NCOA 2BY2A 3WJZA 3QR3A 4OZOA 5C0QA 4J2PA 2OLHA 3BLEA 2OO0A 3GSMA 3NZGA 4RZ4A 3KLKA 1RPXA 3UPWA 3ZM8A 4F4RA 4U4MA 5PTDA 4HA3A 2DT1A 4H2CA 3UA4A 1WO2A 4MPQA 3KLLA 1FWHC 4LY8A 3VIPA 4H9VA 1CPUA 5H8PA 1XJBA 4IQEA 2Z6JA 2FMOA 3RR4A 3BOFA 4L61A 2BBFA 2Y61A 1UH4A 3KVKA 1XPGA 4FI4A 2TPSA 1A47A 3UWYA 1GYLA 3H7UA 3RPMA 4B4HA 4D6HA 3QM3A 1F4HA 1O5KA 2QF8A 3R0KA 1UC5A 1ICSA 1OT1A 3M64A 2B7QA 3OVQA 3N17A 2DZBA 4MYXA 2W5FA 2WC3A 4U2ZA 4O13A 1WDQA 8XIMA 4XK2A 3VZXA 1XBVA 1QXLA 2C79A 3SJNA 2CLMA 1KNWA 5DF0A 3W37A 1S2VA 3BLLA 1UJPA 1S2WA 3E0FA 4V27A 1YNPA 3N2XA 5AB3A 5DY2A 1A4LA 2VD8A 4BWLA 3KWSA 1S3HA 4D1JA 3TTQA 4EPDC 2PGRA 3H2FA 3WUFA 3W23A 4ZE5A 1XH1A 3PBVA 1JAEA 1ZUAX 2DSZA 5G1MA 2J6VA 3LZ5A 2ZRVA 2PZNA 4DF2A 2XH2A 3SJ3A 4F79A 1P43A 1DIEA 2J24A 4KQNA 3MCNA 1B3YA 2XH4A 1KXTA 1QBAA 3WBWA 3E12A 2VFEA 4N02A 1UUQA 3L4UA 3LTSA 4GH3A 2W92A 4G7FA 3WJSA 3ARWA 5D32A 4TIMA 5HUPA 4JKMA 3B8DA 1GORA 4XKYA 2NXIA 4QJ3B 2QEZA 1UB3A 4IMDA 4UTWA 4LOCA 3KS5A 2J7HA 1XS2A 2B81A 2OFJA 3GC5A 1FH9A 1LG1A 1VS1A 2C6QA 1WZAA 4OT7A 3QV7A 4D6EA 4L4OA 1PCWA 1BGAA 1W5QA 3L67A 1DTUA 1HL2A 3VX1A 1W8SA 3IGXA 3SCNA 1ZJHA 4AZHA 2WM1A 3HV9A 1VFTA 3URBA 4OUEA 2J25A 1OYAA 1FH7A 4GYJA 3NFUA 1A3XA 2X05A 1C93A 4G7EA 1DQXA 2WLYA 3TQVA 5ENLA 3B0XA 2YIHA 4DN1A 1Z69A 3WF1A 5AYYA 3MANA 2ZRYA 5MF5A 4QS5A 3WLLA 3H7RA 3VM7A 2EO7A 5D9NA 2WMIA 4C60A 3EA2A 5C9RA 1OK4A 1A5SA 3IK2A 5DMNA 1TO3A 3VGFA 1CXLA 2QHAA 1XQKA 1IXPA 4ZGYA 1KGXA 1W17A 3TYCA 2FIQA 1BQCA 2CHNA 4LAMA 3H23A 4PODA 1Q66A 1YLVA 4LT9A