2ZZ1A

Snapshot of the reaction from 6-cn-ump to bmp catalyzed by orotidine monophosphate deacarboxylase from m. thermoautotrophicum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz1A00
3HG5A 6TIMA 3KXQA 3IIZA 4G1KA 4UXDA 2VC6A 1ADOA 2V2CA 4HNUA 3WJWA 1XM3A 1OF6A 3HF3A 3INPA 2YW4A 3MYOA 1AL7A 1DBTA 2HS8A 4WY0B 5LNSA 4C1KA 5EKYA 3G1FA 2JBMA 5AHNA 4XBKA 3U6WA 3LCFA 2E1DA 3LCLA 5G1YA 3E12A 3TSDA 2NXGA 3W84A 2CZ5A 3E9AA 1M6JA 1VYPX 4O17A 1I2RA 3G0XA 1W54A 1G4PA 4ZQCA 3CHVA 1LRQA 3TC6A 1YXCA 4E2DA 3QMTA 1IXNA 7TIMA 1WYIA 3O6CA 3IIOA 1G4EA 5LNWA 5AHFA 1F5ZA 3G1VA 1W56A 3BG9A 1E51A 1AW1A 3S6DA 1K02A 3UWZA 4IOTA 2Y7EA 4BF9A 1RD5A 2VFHA 3IRDA 1SZEA 5AYZA 5KINA 4LRTA 4PL1A 4LUIA 1DL3A 3MHFA 3EKZA 5DLCA 1K3UA 2H8XA 1FCQA 2NZLA 1IIGA 1W31A 3C2EA 4YCOA 3TJXA 1SO5A 5D2TA 1K7XA 4H3DA 1Z42A 4RX0A 3B05A 4Y6GA 1XI3A 1KFKA 1F76A 4IQLA 3E02A 1F05A 1JVNA 1BWKA 3DXIA 3TR2A 2PE4A 4UTHA 5C54A 4IWWA 3P8JA 5FI8A 3OHIA 3W22A 3DBPA 3C3NA 3SR7A 3DKJA 5AN7A 1OFQA 4EIVA 1JULA 4TX9A 4O10A 5AC6A 1H7OA 2YYTA 4X2RA 2NV1A 1XUZA 5CPLA 3G1YA 4OQVA 5FF0A 1U5JA 3R5EA 1GOXA 3NQ6A 4FHAA 5DCBA 3G24A 1GJPA 3TA6A 3W72A 3KVJA 3HG3A 1B57A 3B06A 3PB0A 3W73A 2QUUA 4PCFA 4YXGA 3MP4A 1V5XA 3TXVA 5CZTA 1NAL1 4P61A 1HUVA 1UBSA 2C6QA 1K7EA 3I7RA 3NVTA 1KM4A 3GK0A 3W2JA 1WAUA 1W5NA 2NXHA 1JCXA 1ME8A 5E93A 1KBIA 3U8GA 1H7PA 3QFEA 5KITA 2DJLA 4O54A 4QJ1A 4AWSA 1LM1A 3HPSA 2CLIA 2GQ9A 3DU0A 2ZZ2A 5LKYA 4FNPA 1SO4A 2QCGA 4FIRA 3OVPA 3BVJA 1SW3A 3G22A 3TQ0A 4JDYA 4XKYB 3W7MA 5K9CA 4HKPA 3EB2A 3G1AA 3MP3A 5KZDA 2JKAA 2WO5A 4DELA 1PVNA 2E6FA 3DZ1A 4DEFA 4NX0A 2NX1A 2HTMA 3DGRA 1ZNNA 4UR7A 3THAA 1FCUA 1TSIA 3L5MA 1QWGA 5DCDA 4MY9A 1MO0A 1M7OA 3W3OA 2BXVA 2VFDA 1PL9A 1KLZA 1D3HA 1TPC1 3QMSA 3C0JA 5HNRA 4DPPA 2BX7A 2H8ZA 3LRLA 3EWXA 2QCHA 1LLZA 2OT1A 1QOPA 1F2JA 3G8RA 2BTMA 1K03A 1GZGA 5K3VA 1XUUA 1MSSA 3S8HA 5G5IA 4UFIA 3TAOA 1SU5A 2YCEA 3QZEA 3PAJA 1TTPA 1TPVA 5EA9A 3W1UA 2A7RA 3WK1A 3S5NA 3I68A 4L4LA 2Q8ZA 4GNJA 4ADTA 2H3BA 2E6YA 3IIPA 4GUIA 1RPXA 2VEPA 4B5NA 4O1AA 1L6WA 3KFTA 5U7SA 4XTDA 4WD0A 2J9XA 2VXNA 3UPWA 5K4ZA 3C2FA 5F2GA 3UQNA 2CLOA 3W1TA 1W37A 3W1QA 3I7SA 2W0UA 1SQ7A 3O6DA 3NQAA 1AL8A 3EWBX 3UY8A 1YTDA 4LUJA 3DI1A 1F6PA 4LY8A 3HG4A 4O13A 1VLIA 1ZAIA 2LLEA 4EF8A 1VGAA 4PFMA 5DY2A 3SJ3A 1XXXA 1X1OA 3A5FA 4GUFA 1ML1A 3UXDA 1G6CA 4AB4A 4JTGA 5A5WA 3STCA 2V9DA 3LGEA 4ZQPA 1T96A 3KX6A 4AXKA 1SZFA 2GOUA 1GVQA 3MYPA 1F6KA 3LHYA 4N6EA 2VOMA 2ZRWA 4MYAA 1OYAA 3A24A 3CM4A 3O8AA 4UMBA 1WX0A 2VFEA 3TC7A 3M9YA 3GVGA 5D02A 3TH6A 3G3MA 2HSAA 5K2ZA 1VYSX 1VLWA 3STGA 1TPWA 5AHLA 1YPFA 1OX4A 3BPWA 3STEA 4XBSA 2QCCA 5C6MA 2NV2A 4TO8A 4WXZA 1TREA 2ZQ0A 1KLYA 4OGZA 4WZHA 3AJXA 3LERA 4GUGA 4M6PA 2VELA 3NZRA 2C18A 1HO1A 2ZYFA 5MHBA 1ZAHA 3W7DA 4QAIA 4QITA 3TMLA 3HIJA 2QCNA 4DBDA 5L9FA 1ME7A 2TMDA 3L2IA 2WQPA 3NQ7A 1IXQA 1GYLA 4LW7A 2X30A 3NQVA 4OE7A 3LCGA 2E5BA 3P62A 1VH7A 1VC4A 3LI1A 5G4WA 3W2NA 3EKLA 5AB3A 1JRCA 1QNVA 1VHCA 1OFAA 1JR1A 1GVRA 5I3KA 1TCDA 4WQ6A 3B0VC 3DHFA 5K9XA 4LC8A 3GXNA 5KZEA 1KM5A 2WJZA 1FXPA 1PHWA 3PG9A 3NA8A 3NOEA 4JYDA 4EF9A 1OYBA 3PBUA 3M5XA 1ICPA 3OEXA 3W7IA 1TTIA 5LGXA 5LNVA 3HQ1A 3OA3A 2DZTA 5HR6A 5BOOA 3CEPA 4JTLA 3GDMA 1RZMA 1LYXA 2ZA3A 3ATZA 1H1ZA 3QW4B 4UNKA 3RU6A 1G4TA 2A2IA 2GVLA 4O4WA 3G0SA 5G2HA 2TRSA 3NQDA 4N9DA 4O28A 4AVFA 4X22A 3C2VA 1VR6A 1H60A 3CWOX 3M5VA 2DZWA 4DQWA 3EWUA 3A5VA 2NLIA 1EP3A 4AWTA 3WJZA 4GC4A 1ICQA 4MUZA 3WJXA 3Q58A 5F1VA 4Y9AA 1QCWA 3W70A 4KWVA 2DZUA 3IIXA 2AAMA 3G1HA 2CFFA 4JYEA 4FNQA 4N9BA 1QPNA 3LI0A 3FLUA 4O52A 2VENA 1MEHA 4LNYA 2QAPA 3UZ5A 1C8VA 3JRKA 3ABSA 1G69A 1DQXA 4RK8A 2YW3A 3TFXA 1FCBA 1PE1A 4UCGA 1OG0A 2EF9A 2KZHA 1JJKA 1ZALA 5CZSA 3DFQA 4M19A 1NSJA 3Q2DA 3L5AA 5D03A 1JCLA 1H7WA 3CWNA 1EUAA 5TQLA 3QM3A 2B7NA 1LTDA 3C2RA 1F73A 2NX3A 1ZENA 1CI1A 5T26A 2C19A 1LBLA 1I2OA 3BG5A 3GKFA 3W2MA 4NXSA 1QMLA 2NXIA 1EWDA 1BEUA 1H7XA 3N2XA 3VCRA 4RV8A 1FDJA 5CKSA 5LSMA 2PRMA 3R12A 1R30A 1K8ZA 3L21A 5KSWA 3M41A 4H4IA 2EGZA 2P10A 4NJHA 2B7QA 3L0KA 4JX4A 4EVZA 2X1SA 1UASA 3V75A 2AQWA 1FDYA 3STFA 4JD4A 3HGSA 3SSJA 3H55A 1K8XA 4LTSA 4LWWA 3RNDA 4DBEA 2RHGA 2CU0A 5LZLA 3FKKA 3G3DA 5AC7A 2FJKA 4LT9A 1H51A 1KFJA 1SSDA 1FWNA 1EB3A 1HFBA 3FJLA 3W1AA 3TIMA 1C29A 3L65A 3MI2A 3E0IA 5TBOA 4I9AA 4RJEA 4YL2A 2A1YA 3TV8A 4K8HA 2H6RA 2V0TA 4I7VA 1ZY9A 3N34A 1DORA 1P0KA 3PUEA 3MMTA 4Z1AA 4KFPA 5AHIA 3M5ZA 3HGJA 1JCNA 1V7YA 3CTLA 1GVFA 5FF3A 1QR7A 4ZQOA 5I3IA 2H90A 5KZMA 4GUJA 1O95A 3IVUA 4N6FA 3W7QA 4O50A 3WK0A 1WDWA 3CIXA 1TPH1 4JGDA 4O0KA 1R2SA 2J24A 3SIZA 3DH7A 3GDRA 2EPHA 3PBYA 3LRKA 3QQ1A 4O1BA 2HMCA 4JYFA 1ALDA 1KV8A 3S9YA 4DO6A 4ORMA 4UFMA 2ISVA 4JX6A 1FWRA 3IEBA 5LNUA 1I45A 3P81A 3W2UA 3VKJA 1NVMA 3GNNA 5AHMA 3PVFA 1XCFA 2E5DA 1JUEA 1Z44A 1XBVA 1LCOA 2PRLA 3KRZA 3P60A 4K7YA 1MZHA 3EWWA 2A5HA 3M7WA 5F4WA 3Q37A 4AMAA 3T78A 4H6KA 5EBUA 1K7FA 2B7PA 4MY8A 2F7FA 3P5YA 1TRIA 3TJLA 3MJYA 3BO9A 3FKRA 4JY8A 2GPTA 1EP1A 5CZ0A 2QJIA 1TV5A 5HQEA 3F4NA 4MJZA 5D04C 4O14A 3LBMA 4AWUA 5K9DA 1NF7A 1EX5A 4Y8FA 3P5ZA 2R14A 5IBXA 3HO8A 2Y88A 1VCGA 3BW2A 5DXYA 3G18A 3LHTA 2GVJA 3C4UA 4PC8A 4AHOA 2FLIA 2I1OA 5DXXA 5J5RA 2JKEA 2XN2A 2FPYA 5I3JA 3U2OA 2DJXA 5C5YA 1WQ5A 3M5YA 4FXRA 2P1FA 4BFAA 2R8WA 2B0MA 3M44A 3HOJA 3LTSA 4LS2A 4RKAA 4JTIA 1LBFA 2OZ0A 4ADUA 2X1TA 4POCA 5CZJA 2UV8G 1J5TA 2E6DA 4IMGA 3TKFA 3FJ6A 1KBJA 4FB7A 1QOQA 3DENA 1VS1A 3QW3A 4C1LA 4WUIA 3M47A 3R8RA 3S5ZA 1LRNA 4ZL1A 1RR2A 3W83A 1FY6A 2Y61A 3LCXA 2W79A 2A85A 3F1QA 1H61A 3A22A 5DCEA 3BARA 5AFDA 2FTPA 3TU9A 1VHNA 4JICA 5K7JA 3L68A 3LTPA 2YR1A 3TROA 4LVAA 4MLJA 2A0NA 4BK9A 3W07A 4YLWA 1GG0A 4DPQA 5LHEA 4MFDA 3QMRA 1GYNA 4JTUA 4DO5A 1KTBA 1L6SA 2J6XA 4M6VA 1P5BA 4WXYA 5HJLA 1Z41A 1WA3A 2PRHA 3NPXA 1W3IA 2TSYA 4HPXA 4OU1A 1OF8A 4UTMA 1FWSA 1YXYA 4Z1BA 1VZWA 1THFD 2GUUA 1GVOA 4JXCA 3S1UA 2J27A 4IMEA 1W5QA 4L4MA 3IGUA 3MBFA 4MZ1A 1PV8A 4UTJA 1W8SA 4TMBA 2GVGA 1YXDA 5EPDA 1IGSA 4RCXA 2E68A 3UWQA 1WV2A 2A21A 1OFRA 5BW6A 1SFLA 3MBDA 1TB3A 5LGZA 4Q32A 4IMFA 1XBYA 3S0CA 3FYPA 1OFEA 3I6RA 4NQ1A 3PG8A 1AG1O 5BMXA 2NUXA 3FYOA 3PUOA 2PURA 1GTEA 3UNDA 1WBJA 3TAKA 2ZZ1A 3S5YA 4LS1A 5HULA 3W6YA 2Z0IA 1KFEA 1EWEA 4K39A 2QAFA 2EHHA 4AH7A 1G67A 5FF4A 5DN1A 1FBAA 1DHPA 1GEQA 1J2WA 4S2BA 5LHFA 4BI5A 1XDMA 1A5CA 2AGKA 3CB8A 6ALDA 1OVDA 1R2TA 3VE9A 2YYUA 1TPB1 1RQEA 4FNSA 3S1WA 3TW7A 1FWTA 2ZA1A 2C13A 2VKZG 5D38A 5FEXA 1KM0A 3W88A 3S5OA 4J9JA 1A5AA 1FQ0A 4GJ1A 2JKPA 3UD6A 1OFPA 1VCFA 1GPWA 1TJRA 1H62A 3NGJA 1ZCOA 4CNNA 3HB9A 1O60A 4OBTA 4O1CA 3O05A 3MUXA 2WOQA 2XN0A 4JTTA 4NX5A 2Q3OA 4EWND 1JRBA 2YFNA 1GVSA 2DZVA 4NUWA 3NL2A 1H5YA 3LXCA 1I8JA 3IVTA 1OABA 4IX0A 1C9DA 4IPJA 3R13A 1FXQA 3BV4A 4U28A 1G7VA 2J88A 1SZNA 4GFSA 4MJMA 2GJNA 2ZRZA 4CNOA 1Q45A 1KM1A 1W5OA 1YADA 4FO4A 4PTNA 3GYEA 4UFJA 2Q8LA 3THQA 4N2YA 3N73A 4UFKA 1MXSA 1DJNA 3WK3A 3LTYA 4YWIA 4UTTA 2DORA 5HUOA 1MEWA 3NAVA 4O12A 1W1ZA 4OT7A 4PH6A 3RK8A 2NWRA 1OFOA 4HNVA 2CLMA 4E0CA 2RDTA 1X6UA 3M0ZA 3W1NA 1UCWA 1AMKA 4RZ6A 4TR9A 3UWYA 4JTSA 2TYSA 1JQXA 2OCZA 4R34A 4AEOA 3CQ0A 1B9BA 3ABOA 3WJYA 1SO6A 3W75A 3VFLA 5HR7A 2JK2A 3W1PA 1SW7A 3E49A 4JEQA 2HS6A 3N9SA 3IVSA 5DELA 5CG7A 5D37A 3PSWA 4MVAA 5EYWA 4N4QA 4DF2A 3ATYA 1TQJA 4WOQA 4K37A 2CW6A 4FNRA 3QPYA 1TTJA 2CLFA 2GJLA 3S42A 1YDVA 4JDBA 2QJHA 5EY5A 2B4GA 3B4UA 3KRUA 3GDLA 4N9CA 3SECA 5ABTA 3ZWSA 2Y85A 1T0OA 1KTNA 3ABQA 1GWJA 5HMSA 3R89A 3O1NA 4UR8A 3HGRA 3S1XA 2E77A 1NEYA 3C8FA 2QR6A 4N4PA 3NQFA 4UMAA 1S5TA 4HHPA 3PB2A 1T8XA 2X1UA 1ZJIA 4ICNA 4IXXA 4JR5A 4AHPA 1IF2A 1VJIA 3LHZA 1WOAA 3UWUA 3CLMA 4W9TA 3EEGA 3H53A 2ISWA 4XTIA 4NZJA 3MP5A 4S1FA 3G1SA 3MWAA 2CZDA 1LOLA 2R94A 3DFTA 4Y90A 3P8IA 2NUYA 3WFAA 4RR4A 1OX4B 1LBMA 4BWLC 3NG3A 3KVKA 2YFOA 3PWAA 2G97A 1Q6RA 4ORIA 5J5DA 2ZZ3A 4IX2A 3GLCA 3ZWTA 3ABRA 4NXKA 1JCMP 5K4XA 4NU7A 2I14A 4AF0A 2GQ8A 3JR2A 2E09A 4QNWA 2Y7GA 3P80A 1YDOA 3LB0A 1VPXA 2DZPA 2C0AA 3MI6A 3TCEA 1I2PA 2V30A 5CSSA 3GZ3A 2QCMA 3GNDA 1P0NA 3WJSA 3FA5A 4A29A 3OVQA 5G2WA 4O1DA 5DY3A 2CLEA 3NQGA 3TQVA 4NT0A 3Q94A 3BK0A 1AK5A 3N2MA 3QF0A 5F2MA 2Y6ZA 1KM6A 4UTTC 3N19B 4O11A 1TPFA 2A7PA 1X1ZA 3G1DA 3QQ0A 1EPXA 1ONRA 4ONVA 3G8EA 1RV8A 4CLMA 5E0KA 1EEPA 1JCJA 1LOQA 2DZXA 4ZMGA 1OK4A 4LRSA 4MYXA 5FEWA 4M5PA 1BTMA 2OX1A 2X1RA 1TJPA 2QCEA 4ZZ9A 3LXAA 3VNDA 3T7VA 5D2XA 3GXPA 1N7KA 5H91A 4OHQA 1I2NA 4TMCA 3LHUA 4JN6A 2OJPA 4Z0JA 4MY1A 2QCDB 5BRBA 3W9ZA 1JCYA 3G1XA 2BSLA 3SW6A 2G96A 4E38A 3GIYA 4GWEA 2QJGA 3LDVA 1S5VA 1TV8A 3T55A 4HSOA 4E2BA 5FEZA 1KV5A 4ML9A 3O06A 3C6CA 2PC4A 4PEKA 3OIXA 2QUTA 4KWWA 2ZFAA 3EWYA 3DHDA 1QO2A 4CCDA 4CCCA 1Q6QA 1IIHA 3L66A 2ABAA 1KFLA 4HNNA 2CLLA 1JUKA 5CPNA 1PHQA 3SFKA 1H1YA 3TSMA 3BLIA 4IXHA 2G95A 5I3HA 4XUGA 2ZRVA 3CIWA 4UTWC 1PS9A 1T99A 2ZA2A 4R7JA 3N3MA 1YLVA 4JY9A 1MEIA 3CPRA 3SY5A 4CNPA 2FQIA 4QM1A 2V82A 4FX6M 1ICSA 3P61A 3B03A 4CQ9A 2Y63A 1XL9A 4LVFA 2YXGA 2ZTJA 3PUDA 2BLEA 5D32A 5D33A 4YCPA 5FF7A 1CW2A 3GB6A 3TNOA 5CPMA 4Z0SA 1TV7A 4ZQRA 3C2OA 3W1MA 4A21A 4UTLA 4A22A 4UNLA 3OG3A 2I9EA 3QPZA 1XDLA 4O4VA 3L0NA 2OT0A 3NM1A 3NDOA 5G2IA 3GX9A 2RDWA 2QCFA 4UC5A 2DZSA 2P0OA 1LORA 2D73A 3QSTA 4LV4A 4IGHA 4NJJA 3SGUA 3RLUA 5EL1A 4KFOA 3L0GA 1YTEA 3TSBA 4GXMA 5HWNA 1OX5A 5H2ZA 3SI9A 5C55A 1QPRA 1TRDA 4ADSA 1Q3NA 3QJAA 1DQWA 4EOUA 1OHLA 2FDSA 3QC3A 2QDGA 3WK2A 4HSNA 5BMWA 1DKWA 3A21A 1OJXA 1W3NA 3RF9A 2CLKA 2O7SA 2A4AA 4I7UA 1QO5A 4HNTA 4FXSA 2V8ZA 2WV8A 1LDCA 2J9YA 3P74A 4NNBA 3O15A 3TXZA 1UB3A 1EP2A 3L67A 3T4CA 1PIIA 2ATSA 5FEPA 2FFCA 1Q6OA 4NJKA 1YYAA 2ALDA 4O0ZA 4IPIA 2Q3RA 3NZ1A 1A5SA 1FX6A 3D0CA 2Y62A 1L2UA 5D30A 2V5BA 5D2VA 3PBVA 4K36A 4PA8A 4Z08A 4MLRA 1EA0A 5D09A 4MZYA 3H54A 1KTCA 4IJBA 2QUVA 1QAPA 1WOBA 4AHQA 3QEZA 4M7SA 4R33A 3MW7A 3TFCA 2Z2UA 1G4SA 4PODA 5F4SA 1XBXA 3W7OA 2VEKA 4Z1CA 1GG1A 3W23A 3MHGA 2IQTA 4R53A 1XBZA 4UMCA 1D3GA 2F84A 4FF7A 4N02A 3BG3A 5C2XA 3HMJG 3NPUA 1H63A 4QQ3A 1SPQA 3USBA 4KKXA 3W7PA 3UPBA 3E96A 1LOSA 2GQAA 3I65A 1O5XA 4DO4A 1P1XA 3W7EA 1VRDA 1TMHA 3IV3A 4MZ8A 3O6YX 3R2GA 1ZAJA 4U4MA 1KW1A 2ATMA 4Q4KA 1SSGA 3M1ZA 4LVGA 4JTEA 4GE8A 2NWSA 3I7QA 1X8FA 4UFLA 4O18A 5EMUA 1YPIA 4UTKA 3UYCA 4JX5A 3KHJA 4I7WA 3V1PA 2YX0A 5AOUA 4ZQMA 5HWJA 3TUUA 3GDTA 3HPXA 4WY0A 1R2RA 3IGXA 1GQNA 4FX8A 3L9CA 3DKLA 2Y70A 3NM3A 2NX9A 3KRSA 4NNCA 4M7TA 3AO0A 4K7VA 4UIOA 1EUNA 1M7PA 1U83A 2EKCA 4O16A 2O7QA 2CZFA 4Z1DA 2QCDA 3P7YA 1GT8A 4GBUA 1B4KA 2WNNA 4LV9A 4JIQA 1RVGA 1G7UA 2QEZA 4CQ8A 4LVDA 1H7NA 4A2SA 3NYZA 3LCHA 1I2QA 3F4WA 3BW4A 1KA9F 4PL2A 3VI2A 1ZFJA 1SW0A 2H3DA 1A5BA 3N14A 4NZFA 5E1QA 3NPWA 3NQEA 2VFIA 2C14A 1XKYA 4DF0A 4ZQNA 1QPOA 4JS3A 4Y96A 1KM2A 3NXFA 1O4UA 3C52A 3BLFA 3QSRA 4P2VA 3PC0A 1WBHA 3PS7A 4UTUA 4OWGA 2C1HA 4MFEA 3HBLA 2X16A 1NF0A 3M16A 1W5MA 3W2KA 1LP6A 3CEUA 2JGQA 2CWNA 1A50A 2FPTA 4Q33A 2QDHA 3W7NA 1RQHA 4BI7A 2B7OA 3W1XA 5IBXC 2DU2A 4YMZA 1TIMA 4D2JA 1FDZA 4DXVA 2CLHA 5LNRA 5D2WA 4K8EA 3TE9A 3GDKA 3MI3A 3PR2A 4AF0B 1LZOA 1VYRA 5FF2A 5G1TA 1F7BA 1X7FA 3LM7A 3YPIA 3T44A 1O94A 4WX2A 3W7LA 1DOSA 1UJPA 2A6LA 4XZ9A 3EXRA 3NPVA 5FESA 5DBTA 1HL2A 2YGYA 3FS2A 2JGYA 2ZZ6A 2WSQA 2BZNA 2OMAA 3BW3A 1TPDA 4NNAA 1PCKA 3ZFHA 1CX9A 4QNEA 1W0MA 3FFSA 2RH9A 4XQ6A 3HGOA 3W7CA 5CGQA 1TO3A 2ZRXA 3NQ2A 2V5LA 1H7RA 2VFGA 3NQ8A 2ZRYA 1W5PA 1FCVA 2V2DA 4A2RA 2Z6IA 3ELFA 3NL3A 3UWWA 4NJIA 4O8RA 3LLDA 4AAJA 1R47A 1XFBA 4QIUA 3NNTA 3BGGA 5AHEA 3LCIA 1OX6A 2WPBA 1N8FA 1SFJA 4QISA 5IM51 3DI0A 3GKAA 4NJGA 3KOFA 3B0UX 3TX9A 2ZBTA 2CZEA 3LOTA 4M6QA 2YDAA 2NUWA 4X9SA 5KTLA 1R46A 5TIMA 4HPJA 4RLIA 1O5KA 3JS3A 5G4EA 4K38A 3NQCA 5HINA 1PCWA 4HN4A 4LS0A 3C56A 1ZHAA 3UXAA 1TQXA 4JTKA 1GTHA 1KFCA 1LROA 1JQVA 3NR0A 4UTWA 4OV9A 4HIBA 3QYQA 4LU0A 3BLEA 1HO4A 4FX7A 3NO5A 4WY0F 4JTJA 5AC8A 2PCQA 1OK6A 3SGZA 1SO3A 1TYGA 1SZGA 3EXTA 3KAOA 4JTHA 1S3HA 2QF7A 4MIMA 1Z48A 2QKFA 2ZRUA 4IMCA 1DJQA 3MO7A 3LHVA 4GUHA 5KMYA 3T40A 5BNKA 1KM3A 4NVTA 4XWUA 4DF1A 3FIGA 2ISSA 1L6YA 5F2LA 3TDFA 3LBCA 1HTIA 3EWZA 3W86A 4FNTA 1YTKA 4LC6A 3PF3A 3PBWA 2XFWA 3M6YA 4O15A 1W3TA 3PULA 1A53A 2Y7FA 4MKNA 1IXPA 3MHUA 4UUIA 1DV7A 2A6NA 1YDNA 4RXGA 1OFDA 2C15A 3P82A 3HPZA 3OBKA 3HG2A 4XKYA 3GAKA 4TIMA 2G5WA 3ZR4A 8TIMA 4IMDA 3O07A 3TK7A 2RKXA 1UUOA 1S5WA 2ZZ7A 2FB3A 3DFPA 3P84A 2WNZA 3P67A 3LHWA 3OVRA 5U4NA 3DFNA 3FEMA 2V81A 1N55A 5AYXA 2ZTKA 3EXSA 1J4EA 4WJEA 3G0UA 4FIQA 1SR9A 1ME9A 3EX2A 2V2HA 3IIVA 3FOKA 4RXFA 1HG3A 1TPEA 2Y7DA 3NQMA 1D9EA 1Q6LA 3LRMA 3ZS4A 3GR8A 2W6RA 1DVJA 2QCLA 2Y89A 3GAYA 2C16A 3DFSA 4N9EA 3UY7A 4ZVJA 3LXBA 4ALDA 1WXJA 3NEVA 5A8GA 1L9WA 3NL5A 4RZ5A 3VE7A 2A7NA 3W76A 2X2GA 1AW5A 3W1LA 4BWLA 4GRSA 4JTFA 3KVLA 3TW6A 1LLWA 5D2YA 1FUYA 2FPVA 3ANYA 3B0PA 1JUBA 2ZCGA 5SWUA 4MOZA 1M5WA 1BWLA 2ABBA 5I3FA 4TU1A 3M43A 1Y0EA 3W7RA 5DBUA 3QRHA 1VQTA 4KFNA 2BWGA 5HWMA 1I4NA 4IUOA 4UTIA 4CQAA 2RFGA 3A9IA 1P4CA 2E5CA 1SUXA 3KVMA 3IGSA 3CC1A 2J9ZA 1TPUA 3SZ8A 5CPOA 4JIPA 2Z6JA 1QFEA 3W71A 2EAWA 3S1VA 2YZRA 3UWVA 3DFOA 1VCVA 3W7JA 3RLVA 3UZJA 4LOCA 2RDUA 4UFHA 1H50A 3L5LA 5D05A 4FEZA 1AW2A 2XN1A 5F1UA 3W7HA 5GVJA 1B3OA 4S2CA 1FWWA 4MPQA 1IXOA 4A3UA 2C3ZA 4QSHA 3F03K 3PM6A 1RQBA 3LX9A 4HT3A 3EX4A 2VFFA 1QPQA 4OV4A 4BI6A 2ZDRA 1OFBA 5F4XA 3C61A 2TPSA 3NL6A 4O19A 3PY2A 5F2IA 3HJZA 2E6AA 3PSVA 3LV5A 1BKSA 4O57A 3GR7A 2ZZ5A 2R91A 3W87A 5L6UA 3TQKA 3GXTA 3EX6A 3RFAA 2WSRA 4O53A 5CSRA 3W74A 3CU2A 1KFBA 1QDSA 3K30A 2VEMA 1UUMA 2VEIA 3W2LA 1OYCA 3CT7A 4CCEA 2FIQA 3W7KA 5I3GA 1F74A 3LV6A 1K8YA 3A23A 2DP3A 4JNMA 3LLFA 3W85A 4RZ4A 2ZZ4A 3TMQA 3W7GA 3BGJA 1TTQA 2WNQA 3O16A 4X3ZA 3EX3A 4WOZA 3W1RA 2YPIA 3QH2A 2FB2A 1EIXA 4K6AA 4LVBA 3RMJA 2Z1BA 4BR1A 3EX1A 2WKJA 3DAQA 2WSYA 3N9RA 3LCWA 2YSWA 1B4EA 5AYYA 3O63A 3B04A 4FNUA 3B8DA 1NFBA 1LRTA 1XC4A 5HUPA
chains in the Genus database with same CATH superfamily
4W5ZA 2NLYA 3RX3A 3KXQA 3LS9A 3WF2A 1SJBA 4Q4QA 2QNEA 2E7FA 1QNOA 3AU2A 1OF6A 2XGZA 3INPA 1IR2A 3MJMA 3IJ9A 1J01A 3G1FA 4B5WA 2E1DA 3S2CA 2BY0A 1JGMA 3E12A 2NXGA 3P6LA 3PZNA 4DVOA 1M6JA 1W2VA 1QI4A 4S3EA 1HVXA 1G4PA 1YXCA 4LY4A 1IXNA 5EMLA 7TIMA 3VDHA 5CC6A 4PBGA 2CBIA 1G4EA 4W89A 2RGLA 1H11A 5FKYA 3UR2A 3UWZA 1CGYA 4E8CA 2UY3A 4BF9A 1XYBA 3AI0A 5IDZA 4PTWA 3EKZA 5DLCA 5AZ1A 4X2PA 3H2MA 2C1IA 3WNOA 1SO5A 1K7XA 1UWQA 3B05A 3C0LA 1XI3A 2VR2A 1KFKA 1GVEA 1I0DA 2OR2A 1CT5A 4IQLA 3E02A 3WH6A 2PLJA 4C7GA 3BJTA 2WSKA 3BL3A 1FWDC 5LIKX 1XKJA 2C71A 3IAPA 2PZ0A 3EGJA 4X2RA 4C6JA 4YVXA 3WL0A 3KBJA 1PX8A 1QI0A 2ASHA 5DCBA 2QJJA 4ZBCA 3EMCA 3PFRA 3HG3A 3B06A 3MP4A 3TXVA 1BF2A 2WWDA 1BYCA 4UQDA 4W93A 2YB4A 4M1RA 1EJWC 3M0MA 1ENUA 2DIEA 4WDUA 1KM4A 9RUBA 2Q09A 3FY1A 4ACZA 4PR4A 5E93A 3U8GA 4P8UA 2DJLA 3AS3A 2PDWA 4AWSA 4LNCA 1LM1A 3Q4DA 2OO6A 3PK7A 2CLIA 4DB7A 5LKYA 4FNPA 1SO4A 1UKSA 1Q4WA 1EA9C 4AZCA 3NGFA 3OVPA 3CL8A 4C5YA 2WKLA 3TQ0A 4JDYA 1QVBA 3URQA 3VZYA 5HATA 2QDEA 1L8PA 4H00A 1RPKA 2JKAA 2WVSA 4DELA 3E1F1 4C90A 4XX6A 4LSBA 5JQ9A 3EWDA 4IPLA 3CH0A 2G3MA 1IE7C 3LSBA 2NX1A 1D8CA 2HTMA 3DGRA 2WHJA 5FCZA 2QPXA 1BPLB 1TSIA 3VNZA 1MMFA 3QY6A 3REQA 2TAAA 3BSHA 4M6UA 3VGBA 5CJMA 3C0JA 5HNRA 1JYXA 2J8GA 2QF8A 3KZPA 2NQLA 2H8ZA 3LRLA 1G94A 1E1FA 2OT1A 4Z1YA 2YLAA 2BTMA 4B3KA 5K3VA 3L2LA 1XUUA 1MSSA 3S8HA 3VUPA 1M7JA 1E4NA 4HNLA 5G5IA 1SU5A 2YCEA 4K1GA 1E72M 3H7UA 4QFUA 1XDJA 4PUNA 4GOAA 4V2XA 5EA9A 3MZ2A 3VUSA 4PE8A 1EYEA 1ISXA 2V3GA 1E1CB 4IL2A 2WVVA 5M3WA 4I6KA 1F3WA 1UBPC 2XZ7A 3ITLA 5K4ZA 3TYUA 2CLOA 3IJIA 3W1TA 4GNKB 2Y24A 3SUVA 3AXIA 2BVYA 1YTDA 2J7GA 3NSNA 5IOBA 4LY8A 4O13A 2VC9A 1ZAIA 2W27A 3HZ3A 1PX3A 3GW0A 3SJ3A 5DY2A 1XXXA 1X1OA 3A5FA 3UXDA 1KKRA 4AB4A 4JTGA 1XC6A 1AFSA 1BXNA 2V9DA 3KX6A 2OX4A 2GOUA 1GVQA 3VNMA 3T08A 3HQNA 3FVMA 3NEHA 2IW0A 4D72A 2ZRWA 1RBLA 3O2LA 3CUXA 1WX0A 5D02A 3TH6A 4HMNA 1DIDA 3M46A 1AQHA 2ACUA 2Y5SA 3SAZA 1RHCA 2E4TA 4PBEA 5C6MA 1PB0A 3TWAA 1OT1A 3S2NA 3URAA 3N6HA 4TO8A 1KXHA 1E4LA 1DJHA 1W9BM 2JIWA 1QPKA 1XS2A 4EACA 1TCMA 1LG2A 1BAGA 3J7HA 4ZXOA 2GGHA 2VELA 2CBJA 2C18A 4S3CA 4IUGA 1HO1A 2HV5A 2ZYFA 5TAOA 3UG5A 3VA8A 4FMVA 3W7DA 5A8NA 1B5TA 4QITA 3TMLA 3NZGA 1CECA 5L9FA 1ME7A 3L2IA 2WQPA 1IXQA 1CWYA 1WUFA 3VM5A 2X30A 3LCGA 3P62A 2OOGA 1VH7A 1Q8AA 1JRCA 3H21A 3THUA 3DHFA 4PUUA 5K9XA 1EBHA 4LYPA 4TOQA 3APYA 2WJZA 4WR3A 1FXPA 3VO0A 4WVXA 3P0XA 4NF7A 4Q8PA 1YMYA 3EEZA 5LNVA 1AUSL 3HQ1A 3TJIA 3OA3A 2J78A 1H1ZA 1D7KA 2A2IA 2VZOA 2WZTA 1MFUA 4C7DA 1AQMA 3WO8A 2TRSA 2XHYA 3CMGA 4X22A 1VR6A 1CPUA 3M5VA 3UGVA 9CGTA 4DQWA 1QNPA 1PYFA 4AWTA 5H8PA 1ICQA 2O9OA 2QGYA 1UR8A 1YBQA 4H9TA 3WBWA 2PDLA 1HT6A 2XVGA 4IIDA 4AU0A 2QYGA 4N9BA 2G37A 3CQHA 3UJEA 3LD5A 4LNYA 4E6MA 4GBDA 3UZ5A 1J0ZA 2CHNA 1OM0A 3JRKA 3ABSA 1G69A 3E5PA 2J7HA 2YW3A 4RK8A 5A6LA 1MW3A 2XWDA 1WKYA 1GHSA 3DFQA 3DHPA 3C0QA 1NSJA 1JCLA 1VB9A 3CWNA 3F2DA 5TQLA 4D6GA 1P6WA 3UA3A 4H2HA 5I2UA 3KTCA 5T26A 2OEJA 1LBLA 3PWGA 1BVWA 1N2VA 3GKFA 3W2MA 1POKA 1QMLA 1M3UA 1EWDA 2CCRA 4GZJA 3VCRA 4NP7A 4RV8A 1BYBA 5CKSA 1NELA 1P0EA 4KRUA 2Z27A 1K8ZA 5KSWA 4H4IA 3GSMA 6PTDA 3L0KA 3VX1A 4AG0A 4JHOA 3SN4A 3TR9A 1Q6FA 1ZJBA 5I23A 5FJPA 2AQWA 2A3CA 1FP8A 3NO3A 4OJYA 4ES4A 4LTSA 3GQYA 3FXGA 3WCZA 3L4VA 5AC7A 1P0DA 3FJLA 3L65A 3E0IA 4GNVA 4I9AA 4QX4A 4YL2A 3CAQA 4R27A 3GG1A 4K8HA 1BXBA 2H6RA 4IT1A 3B9EA 4I7VA 1ZY9A 3GH5A 1SJAA 1P0KA 2PSNA 4DLMA 1M03A 4QG6A 3GBEA 1B30A 1JCNA 4P8XA 1GVFA 5FF3A 2ZDSA 2VWTA 4M0XA 1JAKA 1WUEA 3C0SA 3CIXA 4JGDA 3CMJA 3KDNA 3S5SA 1QK2A 2WB5A 3QQ1A 3QN3A 1XINA 2MANA 2Z4GA 1E70M 4HHLA 1ONWA 1ZBCA 2DVXA 2OZTA 2DIKA 5LNUA 1I45A 4PMXA 1NVMA 1XCFA 1MNSA 4GVFA 3BZGA 1GGOA 3VNJA 4B2DD 4AMAA 1VFMA 3T78A 4RDVA 3UZZA 2BHZA 3K4DA 3P5YA 4L4OA 1DJZA 4WJ8A 3ZXWA 1TRIA 4LCRA 1UWIA 3GU1A 3BO9A 3FKRA 4JY8A 4RW3A 2VCAA 2GPTA 5CZ0A 3EDJA 1E9LA 4MJZA 1OD8A 1M65A 1NF7A 3P5ZA 2XSXA 2POZA 3T0DA 4AWEA 4A3RA 4PB4A 2FLIA 2ON3A 3WMLA 5EBAA 2Q6ZA 2JKEA 1X97A 3H4GA 2P1FA 3CH9A 1LLOA 3S2LA 5J8LA 2B0MA 1S39A 1KFWA 2OZ0A 2PS2A 4DJEC 4ML4A 4Z2IA 4Y2WA 1KBJA 3QLDA 4HBKA 1QOQA 3DENA 3QW3A 4WUIA 1LRNA 1RR2A 1EHAA 3FK4A 4DZIA 3EOUA 3BARA 5K7JA 5C7VA 3TROA 3MCNA 3PAOA 2A0NA 4Q8VA 1T8QA 4YLWA 2ISDA 5LHEA 3H12A 4MFDA 4JTUA 1L6SA 1FFRA 4M6VA 3QC0A 2AL2A 4DJEA 4PSPA 2TSYA 4HPXA 1OF8A 2GUUA 2CKRA 4L4MA 4QCEA 3VVGA 4HCLA 4MZ1A 1GK8A 1PV8A 4H6RA 5I7GA 1W8SA 5HMDA 1NFGA 4B5SA 3ITOA 3L12A 2GVGA 1IGSA 2OYKA 4GY7A 3WQCA 3HPFA 1WV2A 3WH8A 2A21A 2XGBA 5HAOA 1KKOA 4URIA 4BEUA 4BQ3A 8XIMA 2R9RA 3I6RA 1AG1O 5BMXA 4BQ5A 3UBPC 1WNOA 3PUOA 2PURA 4WKAA 3UNDA 4KH2A 4JTQA 5D8ZA 3W6YA 4DIAA 5JBDA 3TTOA 1VPQA 3VILA 7REQB 4MWAC 3VGDA 1VKFA 1WDDA 5FF4A 5DN1A 2PWEA 1FBAA 1DHPA 4BI5A 2V67A 1AZ2A 1XDMA 1A5CA 1ZQ5A 2AGKA 5C0QA 1DQUA 5G1MA 2DGAA 1RQEA 3RPDA 3S1WA 2X0SA 2WM1A 1KM0A 4J9JA 3QOMA 4AVOA 1FQ0A 1H41A 1VCFA 3WF4A 1EXPA 1TJRA 1H62A 3NGJA 5BYWA 1O60A 4OBTA 3VOIA 1OCBA 4W87A 4BQ4A 2D3LA 2IXVA 2Q3OA 4YPJA 1NDWA 3VXGA 3E2QA 1HL8A 3H70A 3OZMA 2WMGA 3B4YA 1H5YA 4C6KA 1JIBA 1RLCL 4KWSA 3IVTA 1FH7A 1WDQA 1AJZA 2GSJA 4H8NA 3KL3A 3WL1A 2PWGA 4AX7A 1G7VA 3OPSA 4MJMA 2GJNA 2FFIA 1TIWA 4KEMA 3MKCA 1Q45A 2QMKA 2P5NA 4PTNA 3THQA 2AMXA 3UVIA 4XZNX 3POCA 2EPLX 1GZJA 3NQBA 1TZ9A 1DJNA 2P3EA 3WK3A 3WLQA 1N8WA 5E5CA 3V7PA 2DORA 1VFSA 1J0KA 1MEWA 3T1GA 1EGVA 2NWRA 4NRSA 3SGGA 2CLMA 4Z2HA 3W1NA 1AMKA 1C8QA 2CHOA 4RZ6A 1WDPA 4JTSA 2O4QA 2ZUTA 5HXMA 2OCZA 4DUXA 3CQ0A 3D47A 3NIYA 4NAEA 3ABOA 1V03A 3GH7A 3VFLA 3S9IA 3OYXA 4PSRA 4CGTA 3KL5A 4H2CA 3E49A 4IFKA 3T8QA 3UYIA 4MVAA 4PMNA 1V02A 4N4QA 4DF2A 5A8QA 4WOQA 1TKKA 3MU7A 4FNRA 1TTJA 3XINA 2CLFA 3KLKA 2G8ZA 3S42A 1YDVA 4JDBA 2XIOA 5EY5A 4K8GA 1BQCA 4N9CA 1KCXA 3ZWSA 2Y85A 5KEZA 4KPLA 4WKFA 3ABQA 4UR9A 1SR0A 3WKZA 4C6BA 9XIAA 3WD2A 4ATLA 2F61A 2QR6A 1HKWA 3NQFA 2D23A 4UMAA 1V8EA 1QNSA 4DAIA 3OHMB 2AAAA 5LIWX 1ITCA 2X1UA 3AZTA 4MB4A 5CBBA 4U3AA 1EJSC 1VJIA 3UT0A 4KWUA 1VFUA 4U2ZA 5LIUX 1OGBA 3EEGA 3H53A 2R82A 1UP0A 4XTIA 7XIMA 1LOLA 2R94A 2GGEA 2CKSA 3U2EA 3WFAA 4GK8A 3VABA 4GIAA 3KZSA 4JL2A 4IICA 2PAJA 3H7RA 4C5ZA 4ZODA 4H9ZA 3ABRA 1JCMP 1R3SA 2XH4A 4AF0A 2GQ8A 3JR2A 1UWUA 4QNWA 1YDOA 4L80A 4CU8A 3LB0A 3VX0A 2C0AA 4AD0A 3MI6A 3WH9A 2CIPA 3BXWA 1QTWA 2PLCA 5CSSA 3MY9A 3FA5A 3W27A 3NQGA 2QVHA 3BK0A 1AK5A 4LF1A 1KM6A 4QJ5B 1V0MA 1NP0A 3QKEA 3I3EA 4ENLA 1X1ZA 3WF3A 4YIWA 5CBJA 3PPCA 3SFWA 1G5AA 1UP3A 1BKHA 1ONRA 3G8EA 1UOZA 4CLMA 3HFYA 5E0KA 1EEPA 1JCJA 2ZE0A 2FZMA 3OBAA 1HJUA 3K46A 1QUMA 1BTMA 2OX1A 4OVXA 3URNA 3LXAA 3RCYA 3LZ3A 5D2XA 1J18A 4UQ9A 3G2GA 4HB7A 5E6ZA 4ZE5A 4MY1A 4GHRA 3G1XA 2BSLA 4E38A 2PP1A 2X40A 3GIYA 4GWEA 2XIQA 2HVMA 4XZBA 2PWUA 3C6CA 4PEKA 3A6OA 3OIXA 2QUTA 3GTFA 3BURA 1PTDA 2PDMA 3EWYA 1DIEA 5C2CA 1WP6A 2CBUA 1E0UA 2CLLA 1H1YA 3TSMA 3SCNA 2G95A 1FWHC 3CJPA 1BTCA 4XUGA 3H7VA 2ZRVA 2BXYA 2HVNA 3GFZA 3NDZA 1M04A 4LQ1A 3WH5A 1ZSXA 4RDZA 4DYKA 3U9IA 4FX6M 2FMOA 4WDTA 5ABGA 2AKMA 4GYFA 1Q6GA 4CQCA 2Y63A 4LVFA 3N12A 4YCPA 1DWJM 3R94A 3GB6A 3U5UA 2ALRA 3TN5A 3THDA 4HYWA 4A22A 3OG3A 2Z26A 1RD6A 1EJTC 4GI4A 2RDWA 1DE6A 1U5HA 2VO5A 4PMYA 2P0OA 2Z00A 4PMQA 4E3VA 3PZGA 4KFOA 3GNRA 5H2ZA 4E4UA 1XYZA 1UKOA 3BC9A 1Q3NA 3GC4A 3I6TA 3BDKA 4KRZA 3QJAA 2TODA 4JTDA 1JDFA 4V1XA 4Z2LA 1YNQA 1FA2A 4EOUA 3U7BA 2FDSA 2FGZA 3F5JA 4J3SA 1GQJA 3QC3A 2QDGA 3TZFA 1FWFC 3A21A 4I9MA 1EJ7L 4QLLA 2A4AA 4I7UA 4L6HA 4GVHA 1QO5A 4HNTA 2WV8A 1Z3NA 3NXLA 4WLCA 4LEQA 2NVDA 3TVAA 4NNBA 3O15A 3T8LA 1UB3A 2ATSA 4MSSA 2FFCA 3R4IA 1YYAA 2ALDA 1R0MA 4O0ZA 4IPIA 1HP5A 3E0LA 4OBRA 1TA3A 4IZGA 1MZRA 4EPDC 3ONCA 1HJQA 4MZYA 1U1HA 1KTCA 4R33A 4M7SA 4S3KA 2VEKA 3HU7A 2BGNE 3W23A 1XYLA 1XBZA 4UMCA 3BG3A 3RJXA 5FJJA 1MUCA 3FVDA 1H63A 4IIBA 4Z2JA 3AC0A 3E96A 1LOSA 1K8CA 2XJ7A 1O5XA 3BCFA 3WQEA 2I7GA 3VCNA 1TMHA 4FZIA 4MZ8A 4GA8A 2C1GA 3HA1A 2ATMA 3PANA 3FXYA 1ZL1A 3UP8A 3DGBA 3I7QA 1X8FA 2NV9A 4UFLA 3W00A 5EMUA 2DSWA 1PKLA 4Q4PA 1PWMA 4W7UA 1PYMA 4JTAA 1QW9A 4JX5A 3NZPA 1PJ9A 3TUUA 1R3WA 1DP0A 3QR0A 1R2RA 2RUSA 1I1XA 1TJ0A 3DKLA 3NM3A 2NX9A 3MKVA 4A05A 3KRSA 4M7TA 3AO0A 4PMJA 1U83A 3T4WA 1RALA 5MKGB 1GT8A 3F5LA 3CXOA 1JFXA 2WNNA 4LV9A 1G7UA 4CQ8A 2EG7A 4LVDA 1KRMA 2PTYA 1H7NA 3FDKA 2ZUNA 3LCHA 3K13A 1I2QA 1SMAA 1OC7A 3Q65A 3ZJ8A 3WUFA 1UD4A 4LUYA 3VI2A 2WMIA 3VGHA 5E1QA 1A5BA 3NQEA 2C14A 4OUEA 2GL5A 4DF0A 3M0VA 4BA0A 1XLAA 4JS3A 1CENA 1Y65A 3C52A 3BLFA 4P2VA 3EYPA 2C1HA 1U1JA 3HBLA 2ZX8A 4P7QA 3S47A 2W5FA 4G7EA 3AUOA 4IGSA 1W9UA 3QGKC 2BS9A 1C8YA 2XISA 3TC3A 4MNMA 3BAWA 5HOSA 2HK0A 3N2CA 4Q33A 2NVAA 1JF5A 2B7OA 4CKQA 2BVWA 3W1XA 3SURA 2V3DA 1EGZA 2Z28A 4YMZA 3HQPA 1TIMA 3W0KA 4HN8A 3K1DA 2I5GA 2DDXA 3H24A 3PR2A 3UETA 4AF0B 7REQA 1F7BA 3LM7A 1BSLA 4XVDA 1O94A 1QW8A 4WX2A 3DFHA 1UJPA 4H8UA 2XU2A 4L65A 4XZ9A 5FESA 1P43A 5DBTA 3F4VA 4QAWA 2JGYA 2BZNA 2P76A 4H1ZA 1NY1A 2F8QA 2CESA 5AYIA 3ZFHA 4AD2A 3TYDA 1CX9A 2DVTA 3FFSA 2RH9A 3FA4A 2YXXA 3NQ8A 3VAVA 1W5PA 1FCVA 2V2DA 2Z6IA 3ELFA 2PBGA 4J3ZA 4QRNA 3VOFA 3D5HA 4J1OA 1CNVA 5ENLA 1R86A 5HNUA 1CGUA 3GKAA 3S2JA 3UF9A 2HZGA 4V15A 2YDAA 4X9SA 2WLYA 5KTLA 1R46A 1U33A 5C9XA 3JS3A 3CASA 5XIMA 3R8GA 4K38A 3UR7A 2OSXA 4LS0A 5HA7A 1KFCA 2OG9A 1L6FA 3NO5A 3A3XA 4WY0F 4ECLA 3IAQA 2PCQA 1OK6A 4OIFA 2G3IA 1HL9A 4K3ZA 1XIBA 4WDXA 3C2YA 1GQIA 1KBKA 3UFYA 4UOJA 3N25A 2QF7A 4MG4A 3QZAA 3ENLA 2ZRUA 1DJQA 4GACA 2D1ZA 1YNPA 1MUWA 4FAMA 5GJPA 4ZSUA 2I9UA 4HTBA 4HZMA 2ISSA 4YVPA 2DW7A 2J25A 1XIJA 1HTIA 4FNTA 4XZLX 4IIFA 1EYWA 4OBSA 3PF3A 3PBWA 3M0IA 4O15A 3B0XA 2X2YA 2UBPC 2Y7FA 1IXPA 3MHUA 4RXGA 1OFDA 3OA5A 2C15A 4ACYA 1E6ZA 4IQJA 4J3VA 2WMJA 4GX8A 3ZLFA 5GPRA 8TIMA 1RH9A 3O07A 3TK7A 2W63A 4FLQA 1V0LA 3JUGA 5IDIA 1A4LA 2ZZ7A 2FB3A 2VJXA 4HHHA 1IZCA 3LHWA 5U4NA 3FJ4A 1JEZA 2V81A 3EXSA 3GXDA 2YZ5A 3ZVIA 1V3KA 3FOKA 2AOSA 4W88A 1W3LA 1D9EA 3ZS4A 3GR8A 3ARQA 2C16A 1HGWA 4GO9A 4AIEA 4N9EA 4G9PA 3RG6A 3LXBA 3WBEA 4PMRA 1WXJA 2AL2B 3BCDA 3MUZ1 1XD0A 4WIWA 1W3JA 3VE7A 4E8GA 2A7NA 3GFYA 3W76A 3W1LA 1S2WA 4GRSA 4JTFA 1LLWA 3T09A 2ZXQA 3IK2A 1FWBC 1H09A 2FPVA 3ANYA 3GW3A 4HA0A 4DWSD 4MOZA 1M5WA 3KOYA 4M8UA 4AIOA 4DZ5A 5I3FA 3E74A 1V6VA 5CLWA 4GYKA 1IT0A 1WDRA 3U0HA 5DBUA 3AIBA 3QRHA 3JZUA 2OB3A 2ACSA 2D69A 3GTNA 3RO6A 5HWMA 4I5XA 4ZO8A 1I4NA 5I07A 4UTIA 3M07A 3A9IA 3KVMA 2GGJA 3IGSA 5C9RA 2QJMA 4U5KA 3CAVA 4A3YA 4P7LA 3BAYA 4KQNA 4LAZA 3DFOA 3PPGA 3UCQA 4G56A 4HYRA 3KCOA 4C60A 1CCWB 3L5LA 4HZ8A 5GVJA 4HMEA 4HA1A 4GXWA 4G7EB 4GABA 4A3UA 5E9XA 2C3ZA 1W1IE 1RQBA 3LX9A 3EX4A 5DX7A 5EMMA 5M03A 5LA2A 2ZDRA 2DPEA 1O66A 5F4XA 3C61A 4INFA 2TPSA 3HJZA 2E6AA 1BKSA 1PBGA 3VZZA 5CSRA 5A6KA 3CU2A 1JNEA 1KFBA 1QDSA 3K30A 3W2LA 1V77A 1OYCA 4CCEA 2FIQA 1R8LA 2V5CA 5I3GA 1WZLA 3A23A 3LV6A 4AY1A 2JALA 3RPMA 2ZZ4A 3BGJA 3N2TA 3GWQA 3O16A 2WHMA 4WOZA 2YPIA 5KETA 3L2MA 3EX1A 4U33A 2V6AA 3VKBA 1W1PA 3N9RA 1J0HA 2YSWA 3B04A 4Q8UA 2A3LA 3VD9A 4GH1A 4X0NA 3HG5A 6TIMA 1FH8A 4G1KA 2J6VA 1QRQA 2VC6A 3GG7A 4PCNA 2V2CA 5T9CE 4HNUA 1SJCA 4JAWA 2WJEA 3WJWA 1TVLA 1LWJA 3WELA 5C71A 2FGBA 2H9AA 4WY0B 1J6PA 1ONEA 4DI9A 1ZUAX 4CVUA 1HJXA 5G1YA 4EE9A 3TSDA 2VRKA 3W84A 2XVKA 3U4AA 2CZ5A 3G6LA 3EA2A 1VYPX 4O17A 1I2RA 3TC6A 1LRQA 3HPAA 3QMTA 2BHUA 1ZS2A 2G3FA 1WYIA 4BF7A 3O6CA 3IIOA 4W85A 5AHFA 1JYVA 1F5ZA 2AQVA 2WHKA 1IWBA 4J35A 1W56A 1XYMA 5BOFA 1XIIA 3R79A 1RD5A 5AYZA 5KINA 4LRTA 1X38A 3MHFA 1FCQA 3E0FA 3SCRA 3TJXA 5D2TA 2ZIDA 1O68A 3URBA 3SDOA 2BY3A 4CN4A 3N04A 3NO1A 4D6EA 2PE4A 2NQ9A 2FJUB 1M9HA 4J3WA 3TLLA 3VTRA 3W53A 3OHIA 2R1MA 2DT0A 1CBGA 4X9YA 3GYCA 3DBPA 3SR7A 5I77A 3T07A 1YW1A 3AHTA 1OFQA 1E0VA 4O10A 3IPWA 5AC4A 1QWKA 3G1YA 4OQVA 5FF0A 1U5JA 4GH3A 3R58A 4FHAA 4ZB2A 3G24A 3U3HA 1GJPA 5FAJA 1VPYA 3TA6A 1DJIA 3KVJA 4MDPA 2QUUA 4PCFA 3CZKA 4LX4A 4YXGA 2WAGA 1UBSA 3I7RA 1FWEC 6CGTA 3NVTA 4HK7A 1WAUA 1VIZA 1JCXA 2IKIA 4HJFA 1ME8A 4DYJA 1H7PA 1HW6A 1TMLA 1GUVA 2R1NA 4LPCA 1RBAA 2DFAA 3JW7A 3GO2A 2BV9A 2YBUA 1SW3A 3LN3A 2QIIA 1GW1A 1K70A 2OWWA 3W7MA 4HKPA 3EB2A 3G1AA 5BOEA 2W62A 5KZDA 1A47A 1E40A 4KIEA 5MKGA 2WO5A 2E6FA 3B8WA 2GZXA 3ZLHA 3DZ1A 4NX0A 2PU0A 1CGWA 4UR7A 2ZE3A 1GOWA 4XUYA 1QWGA 3KEHA 4WKHA 3MV11 4B4FA 3EBVA 1K9FA 1M7OA 3KUMA 4NL1A 1KLZA 3QMSA 2HBVA 5JVLA 4QGCA 1T6MA 4HU0A 2J75A 4DPPA 2DT2A 3MKKA 2BX7A 2QCHA 5BXRA 2VX6A 4N0RA 3G8RA 1GZGA 1EGMA 2GSEA 1EFZA 4TV6A 5AKQA 1WKFA 4D6JA 1XSIA 2DV0A 3E5BA 5HANA 4S3BA 3LPOA 4C6QA 3LQGA 3PAJA 4GJIA 4DRSA 2VD9A 4Q8TA 3LK6A 2UY4A 1JDAA 3DHUA 1TTPA 1TPVA 4RNFA 1XD1A 3W6LA 3S5NA 3I68A 4KRTA 2Q8ZA 3CQKA 4GNJA 4ADTA 5LXXA 4CD5A 4LBUA 4A35A 4JIEA 4Q3MA 4O1AA 1MXGA 3K8KA 3NTYA 4XTDA 2PDXA 3C2FA 3QY8A 1Z9AA 3RHGA 5BXPA 1ITQA 5F2GA 3UQNA 1W37A 2A3EA 4LXFA 3GG0A 1TVPA 1GQKA 4JOMA 2VDHA 2VGFA 3NQAA 2ADAA 2OLHA 3DI1A 4TVDA 2CNCA 1F6PA 3BLKA 1E1EA 1I6NA 3UJSA 3JZEA 4Q8NA 1A0DA 6XIMA 2LLEA 1AD1A 1D3CA 4EF8A 2ZXDA 1VGAA 1Q13A 2WSPA 4GUFA 4IGMA 3RR4A 1DIOA 5A5WA 2QVNA 2YJQA 1T96A 3BOLA 2XVPA 1F6KA 1EQCA 3SB0A 1E15A 1WPCA 4UQBA 4MYAA 4GINA 3A24A 3O8AA 1DXEA 5EB8A 3T0AA 2L5HA 3JU2A 1O5QA 2HSAA 2WVTA 4Y9MA 2ZADA 2E28A 3BAJA 1TPWA 1YPFA 6A3HA 1OX4A 3AHVA 2XSBA 3STEA 4XBSA 2QCCA 2NV2A 3M7SA 4GIRA 4IJRA 3BMXA 2Z24A 4OGZA 3LERA 4GUGA 4QXIA 2GQ3A 3NZRA 3T2OA 1JGIA 3RU8X 4PZVA 1HKVA 3HIJA 2QCNA 4F8XA 4DBDA 3WQWA 4C6LA 3AXXA 3BZJA 3NQ7A 1GYLA 4FLSA 4LW7A 3NQVA 4OE7A 1S2UA 1A3HA 4WJXA 2XIJA 4L56A 3LI1A 2IPWA 3RDKA 3EKLA 3PTQA 1QNVA 1JR1A 4KETA 1XYFA 1GVRA 3B0VC 4Q6JA 3K8MA 4DJDC 4B4HA 3VIJA 4ATWA 5KZEA 1PHWA 3PG9A 2J7CA 1MNZA 3BAXA 2CPUA 3KCLA 3PBUA 4ZENA 3M5XA 4ROQA 3CQJA 1H49A 4MNJA 3BICA 2PB1A 1IT7A 3R0DA 4JTLA 3PJTA 1UKPA 2PDHA 1HJVA 4UNKA 1BD0A 4E5TA 3T2PA 1SZRA 3G0SA 4A4AA 3NQDA 2R1KA 1MW0A 1JXJA 4AZ7A 4DUOA 5DRCA 2QPUA 3CWOX 1R9ZA 1CGTA 1ZBWA 2OZ3A 1TWDA 4MUZA 4A8RA 3Q58A 1YBQB 1QCWA 3OU8A 5GQBA 4CU7A 1XLLA 5C9WA 3LI0A 1C3FA 1TJ2A 1C8VA 1GJWA 1VENA 3FHAA 1DQXA 4ILSA 1DEDA 4ZGYA 4I8YA 3ANUA 4QEHA 4HZ6A 3RLGA 5HJYA 2WMIB 4ZFMA 2KZHA 1CXEA 3TTQA 1JJKA 1ZALA 4M19A 3Q2DA 3L5AA 5D03A 1OZMA 2WMFA 3ECQA 2CEQA 1KRAC 1ZLPA 2NT1A 4Q8MA 1KCKA 3KTSA 2VI0A 1ZENA 1M68A 1CI1A 2NSOA 5G4HC 1J11A 4NXSA 3W4RA 3U4FA 1UKQA 2Y0FA 1S46A 3WX7A 4X60A 1HIZA 1TWWA 2FKPA 3R12A 4YWSA 1TA3B 2EGZA 4L9YA 3AIVA 3L4UA 1R9XA 4EVZA 2Y8UA 1JAEA 3STFA 4JD4A 5A6SA 3HGSA 2UY5A 3SRFA 3KBWA 2F6KA 1OD0A 1PKYA 1WO2A 4F4RA 3RNDA 4DBEA 2PDBA 1XIFA 1Q2SA 3NZQA 2OLSA 1H0IA 3BMWA 1LQ0A 1EB3A 1JI2A 3TOPA 4EPEC 3W1AA 3TIMA 1K9EA 1IWAA 4QR6A 5TBOA 5GNXA 1U2YA 4HU8A 4IMAA 4RJEA 3GC2A 3BLPX 3N34A 1TR9A 3QKZA 1QNQA 3PFMA 5AHIA 3CTLA 1QR7A 1VP5A 1TE6A 1O95A 3IVUA 4O0KA 1TPH1 4OFCA 4D8AA 1R2SA 2J24A 3GDRA 1Q7QA 1KV8A 1EDTA 4E2OA 2B81A 4GLEA 2QV4A 3GH4A 2OO0A 3VKJA 3GNNA 5AHMA 4DAFA 3PVFA 1XBVA 2PRLA 3KRZA 3P60A 3GHSA 5M1TA 3ITYA 5F4WA 5I00A 4L1XA 3PWIA 1ADSA 1K7FA 4AVNA 3R0UA 1EKOA 3ZOAA 3WF1A 1G1YA 4PULA 2JEPA 1EP1A 4ZOEA 1T40A 3ARUA 4J5NA 1TV5A 4RNJA 3F4NA 3VFCA 1GPFA 1E71M 5D04C 3LBMA 4AWUA 3ERPA 2OODA 2PWFA 4C6FA 5FSDC 5K9DA 1EX5A 4Y8FA 2R14A 2WC3A 3HO8A 4Q4RA 4MADA 2X1IA 1Z89A 4K1WA 2QHAA 5DXYA 3G18A 3LHTA 4CNUA 3MVIA 4JHMA 2I1OA 5I02A 2FPYA 4HA4A 2DUXA 5I3JA 1ONXA 2DJXA 4GJJA 5C5YA 1V7AA 4RL3A 3M44A 1JPIA 3HOJA 2O92A 4LS2A 4JTIA 1C7TA 1UH2A 4GI8A 4POCA 1YPXA 4HMCA 3RJYA 2E6DA 2GOKA 4MB3A 3S3GA 5IXEA 3BJFA 2QULA 4HOXA 1VS1A 3S5ZA 2EBNA 4W5UA 3W83A 3LCXA 4EAYA 1JL8A 3F1QA 5DCEA 3E0VA 1CGXA 2BVTA 1ODZA 3C5QA 1AD4A 2GFTA 3L68A 3LTPA 2YR1A 3ZT7A 4LVAA 4BK9A 5CAKA 2F6XA 4DPQA 3DEQA 4DO5A 4MB5A 3ZQ9A 2VMFA 4DBWA 4E3TA 4NG3A 3OGSA 5HJLA 1Z41A 1WA3A 4RW5A 3OTRA 2VR4A 1W3IA 5D9OA 5HNTA 4FOKA 2XTKA 4F2BA 5LA1A 1FWSA 2BGQA 1YXYA 2IPFA 4DZAA 1GVOA 4JXCA 4NZ4A 1E6XM 3WLNA 4F0LA 1VBGA 2BB0A 4UTJA 2FHFA 4TMBA 2HROA 4QDPA 3R10A 3V0SA 3UWQA 1OFRA 5BW6A 3KLLA 3BOFA 2Z1WA 5LGZA 1EX1A 4Q32A 1XBYA 3FYPA 5M17A 1QJWA 4NSBA 1Z7AA 3VGEA 1GTEA 1WBJA 2OKOA 3S5YA 4F2TA 2BODX 1OB0A 4LS1A 2Z0IA 1KFEA 3UPMA 5EFFA 1EWEA 3V18A 2XYLA 2QAFA 2EHHA 4AH7A 2G4JA 3LBOA 1GEQA 4S2BA 1UC5A 6ALDA 3VE9A 4MKVA 5JBEA 1HX0A 3GE7A 1TPB1 4FNSA 2HBXA 1XHGA 1FWTA 2ZA1A 4XD6A 2VKZG 3W88A 2HVOA 1A5AA 1OFPA 1R3RA 1XPYA 1ZCOA 3T2QA 4CNNA 3WQFA 4O1CA 3UA4A 4ATDA 1W1TA 3MUXA 2EO7A 2NSXA 1I75A 1GVSA 3ZO9A 4Y9PA 1LG1A 1AH3A 2DSKA 3VIPA 3NL2A 3LXCA 3WLSA 3CZLA 2JE8A 1J93A 4IX0A 1KXTA 4IPJA 1GOIA 3DC0A 2JFEX 4YTRA 2VZSA 4US5D 1O5RA 4XO7A 2ZRZA 1GNXA 1Q5MA 4C6MA 1W5OA 4IP4A 3CUZA 4FO4A 4UFJA 4Y9NA 2Q8LA 1WDSA 3CV1A 4N2YA 3LY0A 5E0FA 3EOOA 2I5QA 3LTYA 4YWIA 3VZXA 2BMBA 1KC7A 4AD3A 1M1BA 4ERIA 2DT1A 1OFOA 2XH7A 2YLLA 1XFCA 4LALA 4GXPA 3WD3A 2GJPA 4HGXA 2Y8VA 2Z29A 3O7UA 5FAGA 2V5JA 1R5YA 3AJ7A 5REQB 1JQXA 1K6WA 3LUTA 4AEOA 1B9BA 4QDWA 1SO6A 2XVNA 3PP7A 4WK9A 1E55A 4YTQA 3PBGA 2YDSA 4JBRA 2HS6A 1ITUA 3AYVA 4H9VA 1FH9A 5CG7A 3PSWA 5FIPA 5EYWA 3F2BA 3ATYA 1DHKA 3W28A 1PAMA 3AIUA 2GJLA 2VGGA 3LPGA 4RPQA 3B4UA 5B7ZA 2D22A 3GDLA 4Q8OA 1UWRA 5ABTA 2YOCA 3IK4A 4IPPA 5EMYA 5AVNA 4U3CA 4PUKA 2OWCA 3HGRA 1KXVA 3S1XA 4JQ3A 1NEYA 1S5TA 4I5RA 1T8XA 1FP9A 1NWRA 2QLYA 4FALA 4ICNA 4IXXA 4W8LA 4TTUA 1IF2A 1NH6A 3FNDA 1WOAA 3KS5A 4IFKB 2ISWA 3MP5A 1E1CA 2CZDA 3H23A 3PZOA 1F6YA 1JG9A 2NUYA 3GU9A 1F8IA 3MS8A 2V69A 3RYSA 1KGUA 3PWAA 4ORIA 3MWCA 4IX2A 4D9PA 3OZOA 2ZUWA 4NXKA 5K4XA 3MUCA 3QV9A 4I3GA 3PJXA 3ZVHB 2PMQA 3ID7A 4Q8WA 5CLTA 3P80A 1VPXA 4AEEA 3AQUA 3CUGA 3TCEA 3FSTA 4HOWA 5AZ0A 3PTDA 3WJSA 4QS5A 4JKKA 4A29A 4F79A 5G2WA 1B1YA 1TX0A 3TQVA 4BS0A 4YU1A 2E9MA 3N2MA 4UTTC 2P50A 1KD0A 1UA3A 1TPFA 2A7PA 3G1DA 2W4XA 4EXBA 3ICJA 4ONVA 5C9UA 1BSIA 3OLEA 4NAEB 1LOQA 1C8XA 4WEVX 3UW6A 2VEFA 4LRSA 1ZP3A 2WBGA 1Q7ZA 5BXSA 1NOWA 2X1RA 1AQ0A 4RPPA 1TJPA 7ENLA 3RUBL 3S9ZA 2AKZA 4NKCA 1N7KA 4IHCA 5H91A 4A3HA 4TMCA 4DJFA 1K77A 4UBPC 2OJPA 4B92A 3H2CA 3V0UA 4LYRA 4ZSTA 4AZ6A 2UZ9A 3T55A 1BGAA 3V5CA 4ML9A 1US2A 2PC4A 3QY7A 2UWFA 6TAAA 3WDJA 3O3RA 1S5NA 4KS0A 4GMEA 4PRTA 3WFLA 1HP4A 1JUKA 5CPNA 1H4PA 5I3HA 2C8NA 5D9MA 4QTGA 4YTTA 5A69A 3WLLA 4YNGA 1T99A 2WMHA 3N3MA 5HBFA 4JY9A 3CPRA 1IYXA 1ICSA 3WQOA 3F4CA 2ZTJA 3CO4A 2D0GA 5D33A 1XF0A 2FTYA 1OEPA 4ZQRA 3W1MA 3MSYA 4U31A 3HM7A 1E9ZB 5D9NA 4O4VA 4LUSA 2WZEA 3L0NA 3AMGA 3CZ8A 3NDOA 4S23A 3GX9A 2QCFA 4WDWA 3QGAC 4RE4A 1LORA 2D73A 3QSTA 4LV4A 4IGHA 4NJJA 4EWJA 3ARYA 5EL1A 1I60A 3L0GA 8A3HA 1YTEA 1UZ1A 4GXMA 5HWNA 3SUWA 4UB9A 1QPRA 2FZ8A 4ADSA 2E0PA 2PGFA 3IJ6A 2GVEA 3Q67A 1XWYA 3IJDA 3P93A 3UCDA 1Q65A 2OTDA 4S3FA 3THCA 3WK2A 1SYTA 3RF9A 4PTXA 2CLKA 2IQDA 2O7SA 1BVNP 1LDCA 3P74A 2VWSA 3RRXA 4B90A 3QGVA 4ZO9A 1A5LC 1Q6OA 2ZWZA 4NJKA 3WQPA 3LA4A 1A5SA 1XV8A 4Q7NA 1FX6A 3D0CA 1E6SM 1T41A 4U10A 5D2VA 4PA8A 2CC0A 5BROA 1TG7A 4NI3A 2GDUA 2EG6A 2QUVA 4IJBA 4AHQA 4CU6A 3MW7A 1IQ8A 1G4SA 4PODA 3W7OA 4G7FA 1ZP4A 3N15A 3LPPA 1D3GA 2F84A 2X8RA 1UZDA 4QQ3A 4KKXA 3IV8A 2X7VA 5FJTA 2EXOA 1E43A 3I65A 1WAWA 2MNRA 1IV8A 1VRDA 2XFFA 1Q2RA 1ZAJA 3M0JA 4U4MA 1KW1A 3VKKA 4YYFA 4LVGA 3G77A 2NWSA 3GTXA 4UTKA 1EC7A 2OQHA 4REQA 2XFYA 2DH3A 4EPKA 2YX0A 5AOUA 3GDTA 2MUCA 3IGXA 3AIRA 2FMNA 1RY8A 3OB8A 2JIEA 1H0GA 1ZB5A 4UIOA 1EUNA 2IKGA 4HJWA 2CZFA 4Z1DA 3EAUA 3PTKA 2QUMA 4MAVA 4B3LA 1RVGA 2V38A 3DFYA 4JPGA 2VEGA 3F4WA 3BW4A 3CUFA 1KA9F 4P7OA 4PL2A 2H3DA 1SW0A 4NZFA 5TNVA 2OFJA 1UIPA 1POJA 4ZQNA 3K4WA 5I6SA 4KEZA 1S2CA 2VM8A 3GXFA 1CB7B 1KM2A 5A6TC 3AMKA 5AY7A 4UTUA 1MI3A 1IEXA 1NF0A 4Y9OA 3AXHA 3BSMA 1BYAA 2FPTA 2QXWA 2PLKA 2QDHA 3W7NA 4BI7A 1K1DA 2Z2BA 5IHSA 4D2JA 3S46A 3V5FA 1PDYA 3ME3A 1DWHM 1PDZA 1EZ2A 3YPIA 1PKMA 1TV3A 2V68A 1XP3A 5C8BB 3B8VA 1A5OC 1DOSA 2A6LA 3FN9A 2NVCA 3ARVA 3I4EA 1XH2A 3NPVA 1HL2A 3EPNA 2WSQA 3ALFA 3BW3A 1QOXA 4FLRA 4NNAA 4LEFA 4F9DA 2W67A 1NIUA 3EA3A 2CETA 3EB4A 1E5NA 2XH2A 1W0MA 4FP1A 4XQ6A 1XRTA 1TO3A 5H8MA 1ZCCA 2V5LA 2VFGA 3IJ7A 4JHZA 4JFTA 3ORWA 4NJIA 3LLDA 1XFBA 2CXGA 4JN7A 6XIAA 5AHEA 1OX6A 2WPBA 1N8FA 2PDIA 1SFJA 1GQLA 1JDEA 4NZ3A 1YDYA 4NJGA 2ZICA 3VIFA 2ZBTA 4M6QA 4HPJA 4RLIA 4IL0A 2VQTA 1Y5WA 1QHOA 2PTZA 1PCWA 4DJDA 1MW1A 5IFTA 3C56A 2CZVA 1F61A 2ANUA 1PXGA 1GTHA 1LROA 1JQVA 3NR0A 4HPHA 1YE4A 3QYQA 1UWTA 3WQ5A 3DESA 3N1AA 3BLEA 1HO4A 4FX7A 4V27A 1FVPA 4JTJA 3LENA 2HXTA 3BLOA 4GKTA 4MUPA 2ACRA 3QQWA 1I0BA 5AC8A 1VFTA 1A3XA 4MDOA 3WBYA 1SZGA 3KAOA 1FWAC 1Z48A 2HPIA 4S3GA 3A3WA 2VRQA 4GUHA 2BHYA 1EEXA 5D4YA 4LCSA 4NVTA 2OELA 4XWUA 3WNNA 3KOZA 4DF1A 3W82A 3TYBA 5F2LA 3TDFA 1W8GA 4WSHA 3EWZA 3W86A 3VIMA 4TV5A 2XFWA 1S1PA 1A53A 2NT0A 1XG3A 1DV7A 2A6NA 3REQB 3CIVA 4JEJA 1MRQA 2G50A 2I16A 3B9OA 3IANA 3GAKA 3GNPA 4TIMA 5FJUA 4QE5A 1B3YA 4GKLA 4MJ4A 4J40A 1XYAA 3QV6A 4H7ZA 4IMDA 4QG9A 1UUOA 3VNIA 3BAKA 3RITA 3ARZA 3DFPA 5HQMA 3QOKA 2PTWA 1FHUA 1Z32X 3FEMA 3LQLA 1N8IA 4AZCB 1N55A 4KCVA 5AYXA 2ZTKA 2FVMA 3VIHA 1J4EA 3MMDA 3VIGA 3IIVA 3P14A 5FACA 4RXFA 4DNMA 1R7OA 3S2MA 1TPEA 3FX4A 4FPSA 2PFHA 1W9PA 1X6LA 3LRMA 4KCTA 2OPJA 4ACZB 2QCLA 3UZYA 3AZSA 3UG3A 3ZR6A 3UY7A 3WQ4A 2P88A 3OIHA 1Y5VA 4LBRA 5DMNA 3NEVA 1JZ5A 1L9WA 3NL5A 3CAKA 2X2GA 2OWXA 4H6EA 3KVLA 5A8MA 1FUYA 4BZYA 2OEKA 4FLOA 2R1LA 3BANA 2ZCGA 2A3AA 2QMJA 4R88A 4DBSA 4PMOA 2GLKA 2PTXA 4PUEA 1TV4A 2ABBA 4Z2KA 3TOYA 2Z25A 4KGJA 3W7RA 2BWGA 4A8IA 1WXYA 3II1A 1B2YA 4J28A 1SUXA 1J10A 1ZBKA 4NZCA 4RZBA 5CPOA 4ZTYA 1PO9A 3TJ4A 3A4AA 1MQPA 3MDWA 1JZ2A 1YHTA 1TWSA 3W7JA 1XLBA 4LOCA 1LL4A 2RDUA 1R6WA 1H50A 1W6TA 2XN1A 5F1UA 5HDRA 3VKAA 2ISFA 3EPOA 3CO8A 3IRSA 4NIRA 3GHRA 2PCEA 3DYPA 6REQB 4WGHA 4AC1X 1HJWA 1IXOA 2EPKX 2VRJA 1UZHA 3N18A 3PM6A 3T0BA 2VFFA 1W1YA 1QPQA 4HP5A 3VGFA 4OV4A 3WY1A 2C79A 1OFBA 2YL9A 3PY2A 2HJPA 4KIRA 4O57A 2R91A 4GQQA 3W87A 5L6UA 3TQKA 3GVVA 4ZO7A 4ZE4A 3QTGA 1ISZA 1L6GA 2XPKA 4HA3A 4S39A 2WCAA 1OCJA 1UUMA 3T42A 3T0CA 4Q4MA 3WDRA 4GISA 4AZ5A 3W85A 3GTHA 4RZ4A 3CYVA 5C7HA 1X1NA 3KHDA 2DT3A 3L4TA 3N2OA 1EIXA 3RMJA 4AD4A 4BR1A 1VFHA 2WSYA 2Z1SA 3MSDA 4W7WA 5D8WA 2WKGA 1UPMB 5AYYA 3WNPA 3O63A 1S2AA 3IIZA 4UXDA 2O9PA 1ADOA 2GVYA 4HK5A 3SUSA 3MYOA 5T9BG 5LNSA 4C1KA 5EKYA 5AHNA 2PU1A 1CTNA 1AZ1A 5GNZA 1DJWA 2F2HA 3LCLA 1V79A 1M7XA 3MPGA 1FWIC 2INFA 5CXPA 1GORA 3E9AA 3VIIA 3FDGA 4LUTB 4H7CA 3G0XA 1W54A 4ZQCA 4E2DA 1V3JA 1U1UA 2Y1HA 2XINA 3EPMA 2INEA 1YE6A 7CGTA 1XGEA 3B9DA 4JIIX 1GOOA 1V93A 3CUJA 2VVNA 3U57A 3BG9A 1E51A 1AW1A 1MYRA 3S6DA 1K02A 1V6TA 5IFPA 4IOTA 2Y7EA 4GGBA 2AGTA 4L6OA 1VAHA 1S38A 1DL3A 1A5MC 2H8XA 2NZLA 1IIGA 1W31A 1P7TA 3C2EA 3KRBA 1Z42A 4RX0A 4Y6GA 5LXEA 2VR5A 4GQRA 3N4EA 1F05A 3TR2A 2HPMA 3DXIA 5C54A 4IWWA 5FI8A 2RAGA 4HCHA 3W22A 4NZ5A 3C3NA 3WD4A 3DKJA 5AN7A 1OSEA 4TX9A 3D46A 3LGDA 5AC6A 1H7OA 4DWSC 2YYTA 2ZC8A 2NV1A 3FSUA 4FOUA 2VX7A 5A6BA 4HHMA 3CB3A 5RUBA 3B8SA 5DMYA 1VF8A 3NQ6A 4QLKA 4DNHA 1S2TA 2EEXA 4XKMA 1ZZMA 3W72A 1GONA 3POHA 2Y4SA 1V3LA 1B57A 3PB0A 3W73A 4CD6A 1PZ1A 1V5XA 5CZTA 3A3HA 2C6QA 5XINA 3GK0A 2DQWA 4LAMA 3TA9A 3RO8A 1W5NA 3AIWA 3N6QA 4PRRA 1XLGA 3QFEA 5ABEA 4F40A 4DUWA 4WF7A 4QJ1A 3HJEA 3HPSA 1D2KA 2GQ9A 2BNJA 2W3ZA 3OJGA 2I5IA 4FIRA 3TP4A 2Z2AA 4GY0A 3GHUA 3OW1A 4XAYA 4IFRA 1A5UA 3MP3A 2OYLA 1J96A 3A12A 1KCZA 1YKWA 2SFPA 3VU2A 1PVNA 2OGYA 3AAMA 3CAWA 4WHBA 2FYMA 2X0HA 3VD5A 3THAA 3V16A 1A49A 4IQEA 1FCUA 1EIBA 1SMDA 5DCDA 4MY9A 4Q4SA 1MO0A 4QQUA 2BXVA 3S6OA 2RGMA 3R25A 1E3ZA 1TPC1 3IUIA 1OY0A 3KM8A 1PX4A 1LLZA 1DWFM 4NAFB 1K03A 1LWIA 3AMDA 3VYLA 3PBMA 1JPHA 2ZX9A 3LU2A 5KZ6A 2JF7A 2OEMA 3VDAA 4H8VA 3CS2A 1DXFA 2H3BA 1B3WA 1MQQA 3IIPA 1H1NA 4GUIA 4ZR8A 2VEPA 5JU6A 4XD5A 3NSXA 5DT7A 5D9PA 4WD0A 2VXNA 3UPWA 1RK6A 3R7MA 3GM8A 4F9JA 4LBSA 3ZT5A 2OGJA 3W1QA 4AZIA 1CLVA 3MQTA 2W0UA 1SQ7A 1S2VA 1XLIA 3WYZA 2DUAA 4UCFA 4FSAA 4C6CA 4GCXA 3DG7A 3BUVA 1VLIA 4RV3A 4PFMA 4MNLA 4E4PA 3LGEA 5BWFA 3TQPA 3HURA 4XV0A 3WDPP 1NOFA 2HDJA 3WBXA 1SZFA 2WVVB 4JIHA 1TV2A 2FH8A 4US5A 4K68A 1A0EA 4PUMA 3LHYA 4N6EA 3PUGA 2VOMA 1KGXA 2Z7GA 3CM4A 3TC7A 2WJDA 2XM1A 3G3MA 4KWOA 4IG2B 4A8NA 4H7VA 5K2ZA 1VYSX 1QXLA 2YCLA 1HJSA 1VLWA 3TW9A 4AW7A 7TAAA 3VC5A 1JPDX 4C6DA 3GFXA 3VMOA 1RCOB 1XCXA 2J66A 4PCTA 4AFYA 1L0PA 1QNRA 1TREA 4XK2A 2ZQ0A 1Z8AA 4WZHA 3AJXA 1FFQA 4I8DA 4M6PA 1ECQA 1VJZA 4QAIA 3MO4A 1ISYA 4TX6A 1NTHA 2REQB 2E5BA 1A0CA 2W66A 3PZMA 1VC4A 3FGCB 1IWPA 3W2NA 5AB3A 1VHCA 1IEWA 1HQTA 1OFAA 3SO7A 4C6IA 3BCJA 5I3KA 1TCDA 4WQ6A 4R5EA 1OIFA 4LC8A 3GXNA 2VC5A 3WG6A 2HWGA 2J8FA 2PA6A 1QT1A 4JYDA 4EANA 1OBAA 5HJXA 2PODA 2WQDA 4PUWA 3IWPA 3UNTA 5A6JA 5LGXA 4RUBA 2DZTA 5HR6A 2DSUA 1S3TC 3GDMA 2WMKA 3ATZA 3QW4B 3RU6A 1G4TA 2GVLA 4O4WA 2NQZA 1MQRA 5G2HA 1P48A 3V0TA 2DW6A 4O28A 4MB1A 3C2VA 1H60A 5BZAA 3N3TA 2DZWA 3EWUA 2DSZA 4D8LA 3R8HA 3NFUA 3OBEA 2IPGA 4QE4A 4GC4A 5FSEC 3WJXA 2XH0A 1IZJA 2PP3A 4KWVA 3BLLA 4I9JA 2DZUA 3IIXA 2CFFA 4FNQA 3N13A 1O7AA 2VENA 4XSMA 2PDQA 2VGIA 2QAPA 5B80A 5CPQA 3DIPA 5DQPA 1WE5A 2ZUMA 3AMCA 4ZB5A 3TFXA 1FCBA 3OG2A 3DDMA 4IIGA 4UCGA 1HN1A 2J77A 4XZIA 1OG0A 2EF9A 3T0TA 2OQYA 2POTA 3UJ2A 4AD5A 3QM3A 2PWVA 3ZJKA 5CC5A 1LTDA 4WRHA 4GC3A 3C2RA 1DJXA 1F73A 1W1VA 1I2OA 3BG5A 2NXIA 1BEUA 1ZU8A 4DO7A 3N2XA 3HQOA 1RLDA 3H2NA 3B8TA 1FDJA 3GBDA 3HMCA 1R30A 3L21A 3M41A 5JIPA 2GDVA 1UR2A 2P10A 2PBOA 1BXCA 4NJHA 5ABFB 2B7QA 2YL5A 3AHXA 4D1IA 2E25A 1XGZA 4IQDA 2X1SA 3GNXA 3V75A 1FDYA 1WZKA 3V5OA 1DJGA 4HNCA 2EPOA 1K8XA 5FJIA 4GI9A 3WUEA 3XIMA 2RHGA 2V5DA 2CU0A 5LZLA 3G3DA 4LT9A 1H51A 1FWNA 2HE5A 1PPIA 1HFBA 1OWQA 1QHPA 1V51A 1NM9A 1C29A 1UUQA 3MI2A 4G1NA 1FWCC 3L4WA 4E8DA 1GJUA 1US3A 1UR9A 3B8IA 2A1YA 1Q6EA 1X96A 2V0TA 3ONBA 1JPMA 3L4XA 5CZKA 4Z1AA 1ZJAA 4KFPA 3M5ZA 3HGJA 1AODA 1FHLA 4ZQOA 5I3IA 5KZMA 3G6MA 4GUJA 3W7QA 1ZJHA 1B3VA 1RP9A 2V3EA 2GUBA 2V63A 3WNMA 3SIZA 2YBVA 3DH7A 2EPHA 3PBYA 3LRKA 4KMQA 4O1BA 2HMCA 3GU2A 1RK5A 2D20A 1RXOB 4UFMA 4GIEA 3SCSA 2CYGA 1XSKA 1FWRA 2E1WA 3IEBA 3SY8A 4TXEA 1P1MA 2W61A 1JUEA 3OQEA 1RUSA 1LCOA 3SBFA 3VIOA 3WD0A 1CIUA 4K7YA 1KBLA 1MZHA 2A5HA 3M7WA 1CXFA 1UQZA 2OKTA 4H6KA 2YCJA 5EBUA 2ZUVA 4FA3A 3WQ6A 4XBJA 1ZGDA 3SRDA 3OLIA 4P7RA 3MJYA 1E6QM 3IACA 3OP2A 4KT2A 1RA0A 3W6MA 2FH6A 4JL1A 2QJIA 5HQEA 1RP8A 4E4FA 1JCTA 4YN5A 1ESWA 5IBXA 3PZTA 4R9OA 3BW2A 2V3FA 5A6MA 3C4UA 4PC8A 5PTDA 1T5AA 3VNKA 3U2OA 3QXBA 1WQ5A 3M5YA 4CCZA 3V35A 1VBJA 4RKAA 3W02A 1UKTA 3WFZA 3GDBA 5CZJA 3SJNA 2UV8G 4IMGA 3EA1A 3FJ6A 4FB7A 3ZSSA 1UJQA 4C1LA 3KOWA 2W79A 2VP8A 2YDRA 2A85A 3A22A 4MJ2A 1J8VA 2J13A 3A4JA 2HNEA 2J7DA 3TU9A 1XLMA 3RXZA 3WDIA 1PUDA 1VHNA 4JICA 4BY3A 2Y5EA 3VOGA 4P8WA 1KTBA 4ZOAA 4L1GA 2AMGA 4Z42C 1UMLA 5J04A 1J12A 3RM4A 2PRHA 4IP5A 3NPXA 3AISA 1V6YA 4MWAA 4ZCWA 4OU1A 3WQVA 3S1UA 1THFD 2C0HA 1UP2A 2O55A 4FOJA 4EXQA 2V5KA 3WEMA 5CQ1A 2G0WA 5EPDA 4RCXA 3FAWA 3CL6A 2WWCA 1TB3A 1J5SA 1V0NA 3MUAA 4DWDA 1LJYA 4IMFA 1PZ3A 3S0CA 2ACQA 5A6AA 4YVVA 2OQLA 3ARXA 5H6HA 5T91A 4J27A 1XCWA 2NUXA 3EOSA 3FYOA 3KL0A 4K2SA 4CEUC 3TAKA 3FJNA 1BLIA 5HULA 4K39A 3IJ8A 2GK1B 5GNYA 3CZJA 2E8YA 5T8GA 5FL0A 1R2TA 3ARTA 1QW7A 2WM0A 2XIIA 3QBUA 1F4HA 3TW7A 3W38A 3UR8A 2C13A 1OINA 5D38A 3L7RA 5FEXA 4G8TA 3S5OA 2QZRA 2JKPA 3UD6A 5CPSA 4PTMA 5M5DA 3WNKA 3O05A 5EMJA 1AA1B 2XN0A 3CPGA 3WIJA 2WCGA