2ZZ1A

Snapshot of the reaction from 6-cn-ump to bmp catalyzed by orotidine monophosphate deacarboxylase from m. thermoautotrophicum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz1A00
3UWUA 3HGSA 1BWKA 1SSGA 2TSYA 1GVOA 3DFNA 2YW4A 4OQVA 1JCXA 4G1KA 1KFLA 3EWYA 4FF7A 2V2CA 2ZRYA 2DU2A 3C4UA 5KINA 4NVTA 4Y96A 2P0OA 1W54A 4GNJA 1BKSA 4TMBA 4AVFA 1LM1A 3LTPA 3BW4A 2NWSA 4O4WA 4AAJA 3C2EA 3LI1A 1KTBA 4LT9A 4UTWC 3DFQA 3SY5A 5LHFA 4Z1DA 4MZ1A 1H51A 1JRCA 1QPOA 1W37A 1YLVA 1C29A 4ML9A 5DXYA 4Q32A 1K8YA 4S1FA 3TQVA 5LGZA 3TJXA 2GVJA 2ZQ0A 4QISA 3C2FA 4LRSA 1G4PA 3EWBX 3LCIA 2CFFA 1KBJA 3QW4B 1SO4A 5DY3A 2QEZA 2CZEA 3R12A 1GTHA 2Y62A 3GVGA 1PHQA 3RK8A 4HHPA 3EX6A 2G97A 1J4EA 4XUGA 4LTSA 3M5ZA 3IEBA 4JTKA 4O10A 1H7OA 4LV9A 1W0MA 2P1FA 1JJKA 1MEIA 5BMXA 2YDAA 1TV5A 2VFHA 3LM7A 2XN2A 2ATMA 2Q3RA 3EWZA 1J2WA 3BW3A 3GIYA 4CNOA 2H6RA 5CSSA 3P60A 1EUAA 3FA5A 1KM0A 1W31A 3NAVA 3LX9A 3PF3A 2QDHA 4YXGA 1GVQA 4P2VA 4UTLA 2PE4A 4TX9A 3GB6A 1H62A 4HPXA 3G1FA 1LOSA 3QZEA 1JUBA 3CWOX 4QNWA 1KFCA 1TTJA 1IXQA 1FDYA 3SSJA 1OFQA 3UY8A 5G1YA 3G0XA 1EPXA 4JY9A 1O60A 1OX5A 2GQ9A 3LXBA 2NXIA 4HPJA 4DXVA 2ZDRA 4GWEA 3RLVA 2NUWA 5FF2A 2YFNA 3O16A 1YXYA 3ZS4A 3NA8A 1OYCA 3B05A 4E2DA 3W85A 1LZOA 3EWUA 3THQA 3WK0A 3HGJA 5D02A 3EEGA 2FQIA 2PC4A 5D30A 2GVGA 4K36A 1KBIA 5AFDA 5CKSA 4OGZA 2G5WA 1FY6A 3MP5A 4LS0A 1YXDA 1VYSX 4TMCA 1NSJA 1F05A 3LBMA 2PRHA 4TU1A 1KW1A 3W1TA 2FDSA 5AOUA 1CI1A 3W7LA 2V9DA 4UTHA 3W84A 4O0KA 1X1OA 3C0JA 4IJBA 3HOJA 2AGKA 1YDVA 1SO5A 5C2XA 4N4PA 5TQLA 3T44A 1Q3NA 2FPTA 4JX4A 3OVQA 4FNRA 3GDTA 1B57A 1K03A 3R2GA 3GXTA 4MY1A 3W7RA 1WV2A 3QH2A 5AHIA 1H61A 3P8JA 1D3GA 4FX7A 4ORIA 3HG5A 1JUKA 3QSTA 2BTMA 4GE8A 3EX2A 3MHGA 2TYSA 5K4ZA 2I9EA 1VPXA 4KFPA 3W6YA 3SR7A 5HINA 1VGAA 4L4LA 2FIQA 4UTUA 2CW6A 2X16A 4FNQA 2QUUA 4WD0A 3W76A 2E6FA 1H60A 3UPBA 3DGRA 4ONVA 1X7FA 3M41A 4DQWA 1F6PA 1RR2A 1W56A 4O0ZA 5L6UA 1W1ZA 3ELFA 2B0MA 4JTGA 1W3NA 4MLJA 3W7MA 4FIQA 4FNSA 2Z0IA 2DJXA 4K39A 4S2CA 3HO8A 3LTYA 1GWJA 3QMSA 3R13A 2V8ZA 4IXHA 1SUXA 5LNSA 1LRNA 4OV4A 4N4QA 1LOQA 3S5YA 1R47A 1GYLA 4O4VA 4WY0B 3E9AA 5HUOA 4GUHA 2FLIA 3LRKA 4JD4A 2QR6A 2ZYFA 4HSOA 1RZMA 3QSRA 3W2MA 1T96A 3CT7A 1YDOA 4DF1A 4H3DA 1P0NA 2O7SA 3MYOA 3RNDA 3HMJG 4NJIA 4BI6A 1ZALA 3W1NA 2XN0A 1L6SA 1FDJA 1EWDA 2E77A 2RKXA 4AHPA 1EA0A 3H55A 3W1RA 2Y7DA 1ZHAA 4PODA 2P10A 5A8GA 2ISVA 3VE9A 1SFJA 4JIQA 5LNUA 3Q58A 4DEFA 4XBKA 1XC4A 4GBUA 1I45A 4QM1A 1EB3A 3KVJA 2ZZ1A 5D03A 1FXPA 3OVRA 3W7KA 4LVGA 4GUIA 5I3GA 3P80A 3BLFA 4MYXA 1YPIA 3TQKA 4FEZA 4KWWA 2X2GA 3G0SA 5CPOA 4JN6A 3HGRA 3W3OA 4Z1CA 3BARA 5CZSA 4POCA 4GUFA 2V2DA 2BLEA 4KWVA 4WUIA 4AHOA 2VXNA 3TW6A 2AQWA 5HQEA 2YW3A 3GZ3A 2FJKA 2ZZ2A 3CU2A 5DLCA 3QPYA 1KM1A 3W1LA 1WX0A 1TREA 4R33A 1WOBA 3UWZA 4LOCA 1TB3A 5E1QA 2C1HA 3LCGA 3W2KA 5DCDA 2QJHA 1IGSA 4XZ9A 1LBLA 2A7RA 1NFBA 3ATZA 3NL5A 1QCWA 1IXNA 3PBVA 5BOOA 5DBUA 4PA8A 2BXVA 3GKAA 1OFEA 4GFSA 3QFEA 5EYWA 3PBUA 4UTKA 4O1CA 3W1XA 3T78A 5LNWA 1IIGA 1G6CA 3IVSA 3CEPA 1AW1A 1IXOA 2J6XA 4HNNA 1LBFA 1SO3A 2NV2A 4UTIA 1OF6A 4S2BA 5AHNA 3Q37A 1P0KA 2Y7FA 3EWWA 2E68A 5EKYA 5D09A 1T0OA 1RQEA 3L5LA 1XM3A 1XXXA 5D2TA 1N55A 2B7PA 3KX6A 3KFTA 3L67A 1VLIA 2PRLA 3W1UA 1YADA 2E6DA 2QKFA 3TSBA 4A2SA 3WK2A 2A7PA 1F73A 4IUOA 2J9YA 1VH7A 2VEKA 4MZYA 3C2VA 1EIXA 3INPA 5G1TA 1QO5A 4WZHA 2VEMA 4FNPA 3TKFA 3NL6A 2W79A 3QEZA 3QM3A 1PCWA 5F2LA 5KZMA 1EX5A 3LHZA 3IIOA 2C15A 1TQJA 3MYPA 2WO5A 3C61A 1FCUA 1BWLA 3S5OA 5L9FA 3MP3A 1THFD 3OA3A 5DELA 3LHUA 3FYPA 2V5BA 3NPUA 3ABSA 4WX2A 1FWTA 4R34A 4EWND 3SGZA 1ZNNA 4O12A 3B0VC 3HGOA 2QUVA 5KZDA 1TPEA 3S6DA 5EY5A 4IMEA 3S9YA 2CWNA 3L5MA 3NEVA 5F1VA 1TTPA 2E6AA 3W7IA 4NNBA 1TPUA 1TPFA 3BV4A 3G0UA 3C56A 3L9CA 3LRMA 5D38A 4Z08A 2UV8G 3YPIA 3NR0A 3W7JA 5IM51 3P5ZA 3G1YA 3G1XA 3BVJA 4Y9AA 4WOZA 3SJ3A 3W7QA 2VFFA 4UTWA 3NZ1A 1BEUA 4MY9A 5AC8A 4A21A 3B04A 4JTTA 1S5TA 1LRQA 1I2NA 4YLWA 4RZ5A 5LZLA 3FJ6A 3TMLA 1WA3A 4JDBA 2IQTA 3RLUA 4X2RA 1PS9A 4IMGA 5FESA 4ALDA 4N9EA 3K30A 3N34A 3P7YA 2ABAA 4IMCA 4FX8A 1F5ZA 1B4EA 4WXYA 4HT3A 5MHBA 5LKYA 1DBTA 1TPH1 4DF2A 2C6QA 3PSWA 3MO7A 1QPQA 4HNUA 4KFOA 5FEPA 1GZGA 3JRKA 4LWWA 3WJZA 3TSDA 2E09A 3GXPA 3NQAA 4MKNA 1ZFJA 3A22A 1W5OA 2YFOA 2NUXA 3PY2A 4AEOA 4PH6A 1K7XA 5C6MA 1A5CA 3STEA 3W74A 2KZHA 1QWGA 1GVRA 3ANYA 1L9WA 3M0ZA 1TPDA 3KRZA 4Z0SA 3O05A 4GC4A 1LDCA 4HSNA 3O63A 1GG0A 3UZJA 3PBYA 3UWWA 3TU9A 1VZWA 5LNRA 3NQ2A 3PG9A 3IGXA 1SFLA 5IBXA 1DL3A 3GDRA 1MEHA 3LDVA 2FFCA 2WKJA 1TV8A 3A5FA 1KA9F 2DZSA 4WQ6A 3TC6A 1LLZA 1B9BA 4IMDA 2VEPA 3IV3A 1XDLA 1R46A 4LC8A 1BTMA 4GRSA 4TO8A 3NQ6A 3M43A 2Y85A 1DJQA 3NG3A 1A50A 1OABA 3MP4A 3RF9A 5DCEA 2Y88A 4MLRA 2CLOA 2NWRA 4UC5A 3GAKA 1SW7A 4JYFA 3I7QA 4UUIA 4FHAA 3TIMA 2VENA 4LVAA 1VHCA 1OFAA 3DFTA 1ZJIA 1U83A 1AL8A 3KAOA 2YR1A 3TSMA 2FTPA 2C3ZA 3DFOA 1JR1A 1WQ5A 1ME8A 3FS2A 4U28A 4BI5A 3V75A 2E5CA 3MI6A 3GLCA 4UXDA 1J5TA 3DHDA 4O52A 3W72A 1YTDA 5FF7A 5G2IA 4H6KA 3TROA 2GJLA 4JX6A 4R7JA 3UD6A 3C52A 5K7JA 3DAQA 5CZTA 5HWNA 3UZ5A 4HKPA 3W1MA 3TNOA 2QUTA 2JKPA 3UPWA 3G8EA 3LERA 5DY2A 1OFDA 2AAMA 1HTIA 3F4WA 5SWUA 1LYXA 1XBYA 3V1PA 4AMAA 2JGQA 3CLMA 3GKFA 1ICSA 2YX0A 1TJRA 5D37A 3LLFA 2C13A 4UTJA 2WQPA 4TIMA 2A6NA 4XWUA 3NM3A 1HG3A 2DZUA 3N73A 4W9TA 3DI1A 3EXSA 1GOXA 3BGGA 4C1LA 7TIMA 3HPSA 1RVGA 4MPQA 1QOPA 3A23A 1G7UA 3L2IA 3QMTA 4PL1A 2FB2A 5FF0A 3W7NA 4HIBA 2WNNA 1O95A 1H50A 5TBOA 2Z6JA 4E2BA 3MMTA 2H8ZA 3KXQA 4O53A 2R14A 2VFGA 1ICQA 1WBJA 3TFCA 2PURA 3NZRA 2X1TA 3EKZA 5C5YA 5F4XA 4N9DA 4UIOA 4BFAA 2QJGA 3PM6A 3BG9A 4I7WA 5U7SA 3HG3A 2Q3OA 3U2OA 3DI0A 2PCQA 1XBZA 4MUZA 4PC8A 3Q2DA 3TR2A 1K8XA 3B06A 4LU0A 4DBDA 3HG2A 3G8RA 3S1XA 2A2IA 3DH7A 3C6CA 3KVKA 4E0CA 1Q6LA 2J24A 4HNTA 2Y7EA 2JK2A 4H4IA 3OIXA 3W7OA 3UWYA 4QAIA 1TYGA 1DHPA 5I3KA 4JIPA 4CCCA 3MI2A 1GJPA 1D9EA 4NQ1A 3M5XA 1TPB1 1K7EA 3UYCA 3NGJA 3O6CA 3CPRA 1VS1A 4M6QA 3EX3A 3P5YA 1W8SA 2A5HA 3GNDA 2QAPA 2A7NA 3JR2A 3PSVA 2OT1A 5C55A 4JY8A 3U6WA 1LOLA 2TMDA 1VLWA 2DZPA 3WJSA 1ZAHA 4DBEA 4N9BA 4BK9A 3NQEA 2BX7A 4AXKA 1OFPA 4M7TA 4UTMA 4J9JA 1I2PA 1RQHA 3LXCA 5AYYA 1AL7A 1T8XA 4UR8A 2C16A 3B03A 4U4MA 1O4UA 4YMZA 2VFDA 1SSDA 2DORA 6ALDA 2ZFAA 2R94A 3STFA 5D2YA 4UNKA 5KTLA 5HJLA 1PCKA 2QJIA 3PWAA 1ZAJA 4LS2A 3M1ZA 1XBVA 1PL9A 1YYAA 4RZ4A 1OJXA 5AHLA 1A5AA 4K7VA 1TPC1 5BW6A 1UUOA 2OZ0A 2GOUA 4NJGA 2FB3A 2YGYA 4OWGA 3EKLA 4A3UA 1UBSA 2QCDB 3FEMA 4O1BA 4JR5A 4O28A 1SZFA 1M7OA 1S5WA 8TIMA 1XDMA 5D2WA 4YCOA 4LV4A 4HN4A 4O16A 1H63A 3EXTA 4YL2A 4O50A 4O8RA 2O7QA 3W2UA 3WK3A 4WY0F 3TK7A 4MIMA 4K6AA 1FWRA 5T26A 3BW2A 3N2MA 4AF0A 3P84A 2Y6ZA 2A21A 4NXSA 4JTUA 3W73A 4MFDA 2CLKA 2H90A 1LRTA 3ABQA 3N9SA 3NOEA 1FCBA 5KMYA 3FIGA 1WYIA 5AHEA 2YSWA 3JS3A 4CLMA 1OG0A 1UCWA 2RH9A 3LBCA 3TA6A 3SW6A 2E6YA 3CQ0A 3C2OA 3TXVA 1TSIA 1DV7A 4FO4A 3F03K 5E0KA 3P67A 4LVFA 2E1DA 1OFRA 2CLFA 1ICPA 5CZ0A 3CM4A 2Z6IA 2A0NA 3M5VA 1GVFA 5CGQA 3WJYA 1LBMA 3W7HA 1EEPA 2H3BA 3W7PA 3LTSA 2DZWA 4OU1A 2GQ8A 2XN1A 4CCDA 1OK6A 5FEWA 3BPWA 4UFKA 3GR7A 2V2HA 2ZTJA 3UXDA 3UXAA 4EF8A 1JCYA 3ABOA 2QDGA 1VCFA 1LROA 3I7SA 2QCCA 3UWQA 3QQ0A 3NPVA 1G69A 4A2RA 5BRBA 1JCMP 1C8VA 1L2UA 1TTQA 3PS7A 3TC7A 1SW0A 1ME9A 4EVZA 4MZ8A 1B4KA 4RXFA 3HPXA 1TCDA 2YZRA 1NEYA 3O1NA 5KSWA 1M6JA 1O94A 1VHNA 4JTJA 3C3NA 4UR7A 1K8ZA 5F4SA 3O6YX 1WOAA 3UWVA 1YTKA 1QPNA 3S1WA 1Z41A 1OX4A 1GTEA 2CZFA 5FF3A 4O14A 1KM2A 1I2OA 1KV5A 1VQTA 2ZA2A 1P5BA 3G1VA 3PAJA 1QDSA 3PVFA 1EP3A 2BWGA 1FX6A 2C0AA 2QCHA 4EIVA 2WNQA 4RCXA 2CZDA 1UUMA 4XTIA 2GUUA 5F4WA 3W7DA 1KM3A 5G5IA 3CHVA 1FWWA 4JYEA 2Y7GA 3OHIA 4AF0B 4LVBA 3W7EA 3E96A 1VJIA 3LXAA 3L0KA 3LCLA 3THAA 4XKYA 4QIUA 3NQDA 1GQNA 4CCEA 4N9CA 3SECA 2ISWA 4Z0JA 1W3TA 2CLMA 1MZHA 2WSYA 3PBWA 1SZNA 1OYBA 3LRLA 3G22A 5K9DA 2EAWA 3N19B 1Z48A 1H1YA 2DZXA 2DP3A 2CLEA 2VOMA 1JQXA 3QRHA 4MJZA 1OX6A 1FCQA 4X3ZA 1JCNA 1A5SA 5CZJA 4BI7A 1XUUA 1ZENA 1S5VA 3M9YA 1N8FA 1W5PA 3A5VA 1OYAA 2TPSA 3S8HA 3HBLA 2HSAA 3FKRA 3QPZA 1G4SA 4O15A 1R2SA 1YTEA 3NQ8A 5D05A 4MVAA 1TQXA 3L68A 3SGUA 1M7PA 4JYDA 2YXGA 1VYRA 4O11A 3W23A 3USBA 1EUNA 2HS6A 3VI2A 1HFBA 3B8DA 5AN7A 1Q6OA 1KFBA 5KITA 4M19A 1F6KA 1DKWA 4IX0A 1FWSA 4ZQNA 1W5MA 3MJYA 3FFSA 2QCFA 1GVSA 1XBXA 5AYXA 2EGZA 4UFLA 3W2LA 4O13A 2J27A 3W07A 1JUEA 3LI0A 4FX6M 1F76A 2X30A 4PFMA 4YCPA 3FYOA 4RR4A 3NPWA 1QOQA 4I7UA 1Q6RA 3G24A 3EX4A 3P82A 3RFAA 4ZL1A 3G3DA 4IOTA 3G18A 1X8FA 4RV8A 2NV1A 4OBTA 1SZEA 5DXXA 3IGSA 1F74A 1L6YA 3TH6A 4D2JA 1G4EA 2C19A 2EKCA 1H7PA 3QF0A 1JQVA 4A29A 3G1AA 2X1SA 3S42A 2A1YA 3I6RA 4DF0A 2RDUA 3L5AA 4N02A 3TJLA 1KFEA 4IWWA 4UFMA 4LUIA 4K38A 1ADOA 2QCMA 1B3OA 4JDYA 1VR6A 3UY7A 1KFKA 4BWLC 5H91A 4Q4KA 1HUVA 3KVLA 1X1ZA 2GPTA 3DXIA 1TRIA 1A53A 3W7CA 2H3DA 1H7XA 3WJXA 3KHJA 4DPPA 1AMKA 3TMQA 2GJNA 4UCGA 3HQ1A 3LCXA 1W5QA 3P61A 1ME7A 1UASA 1TIMA 5I3JA 4K8EA 5DN1A 2NX3A 5E93A 1RQBA 4JS3A 6TIMA 4ICNA 3E02A 4GUJA 5CPLA 1QFEA 3KOFA 2W6RA 2Y61A 4GXMA 3IIZA 1DQWA 4OT7A 1F7BA 4K7YA 5TIMA 4FXSA 3ZWSA 3UNDA 4JGDA 3R5EA 2VELA 1SZGA 3S0CA 4BF9A 4JTFA 1LORA 2CLLA 2OT0A 5C54A 1Q6QA 1JCJA 1FUYA 5HR6A 3WJWA 4JTSA 1SPQA 4ZQPA 2Y63A 3EWXA 5G2HA 3LLDA 2J9XA 2F84A 4NU7A 5EBUA 5F1UA 2GVLA 2VKZG 2EHHA 3O6DA 3TQ0A 5H2ZA 4LVDA 1DJNA 4NX5A 4NJKA 1PVNA 5HMSA 3G1DA 2DZVA 3P74A 4QNEA 2OX1A 2EPHA 2QCNA 1R30A 3PUEA 3TCEA 3TX9A 3CWNA 1V7YA 4P61A 2RHGA 4AB4A 1ML1A 3TDFA 5D04C 3ZR4A 3W71A 5EPDA 2V30A 5AC6A 3A24A 2Q8ZA 1LTDA 3CC1A 3LOTA 5AC7A 1SW3A 2E5BA 3E12A 4ORMA 5HWMA 5LHEA 4XKYB 3OBKA 5J5DA 5AHMA 4Z1BA 3IIPA 3HPZA 1OF8A 3IRDA 4M7SA 3E0IA 3TFXA 2CZ5A 3N3MA 3W88A 3D0CA 1Z42A 1RPXA 4LRTA 3NQCA 5K9CA 3NQVA 1SO6A 4CQ9A 5ABTA 3QMRA 5LGXA 1DQXA 3DFSA 3I68A 4O54A 3DU0A 1PV8A 2Y89A 1FXQA 3IVTA 1JVNA 1ALDA 1KLZA 1NVMA 3NXFA 3S5NA 2RFGA 2B7QA 4JTIA 3W2JA 3I65A 3STGA 5DCBA 5BNKA 3N2XA 3ZFHA 3BG3A 3O07A 1G4TA 4CNNA 3HIJA 1TMHA 4LW7A 4Q33A 3W22A 3DZ1A 4DO4A 2ZZ5A 4O18A 1HO4A 4DELA 1JRBA 3PG8A 3LHVA 1EWEA 1XCFA 2B7OA 4UFJA 4FIRA 1NF7A 1H1ZA 1VRDA 3ATYA 1QMLA 2HMCA 1NF0A 1I8JA 3B0PA 2ZZ3A 2NX9A 3MUXA 5CPNA 3TAOA 5CPMA 4Z1AA 3NQ7A 4N6FA 5F2MA 3A9IA 2ZRXA 4NNCA 5AYZA 5LSMA 1DOSA 5EMUA 4MY8A 2XFWA 3HJZA 3QW3A 4QJ1A 4EF9A 3VE7A 4QSHA 1KM4A 4ZQRA 3W83A 3NO5A 5J5RA 4IQLA 3GDKA 2WJZA 5I3FA 1KTNA 3BK0A 1TJPA 3GK0A 1WDWA 2OCZA 3NNTA 1I2RA 4KFNA 3FJLA 2JKAA 3T55A 1YPFA 2NZLA 3CB8A 2DJLA 4LS1A 3S1VA 1KM6A 1TTIA 1FCVA 3CTLA 4UNLA 4DPQA 2BSLA 4UTTA 4LY8A 1GPWA 4ZQCA 4UTTC 3M47A 3KVMA 3B4UA 4PEKA 4RLIA 1KM5A 3GX9A 1MXSA 2ZZ6A 2J9ZA 3W86A 5EA9A 5IBXC 4WOQA 4CQ8A 3FKKA 1AK5A 3LV5A 2QCEA 3O06A 3L0NA 2NUYA 5I3HA 3GDLA 3NM1A 4M5PA 3MBDA 1K02A 1QNVA 2NLIA 4ZVJA 4PL2A 2B4GA 3SI9A 1D3HA 2H8XA 4ADSA 2ZBTA 4O57A 3B0UX 2E5DA 4IMFA 1U5JA 3DHFA 4OV9A 1XUZA 3G1HA 1EP1A 3DKLA 1IIHA 3CIWA 1IXPA 5K2ZA 3NYZA 2VFEA 4IXXA 4BR1A 4LNYA 3LCFA 5CSRA 3GXNA 3R8RA 4B5NA 1N7KA 4KKXA 4UFIA 3LHWA 3F4NA 4M6VA 3C8FA 4LUJA 2WNZA 1QAPA 3GAYA 1RV8A 3FOKA 3LHYA 3PUOA 3QYQA 4JTEA 2JKEA 4JTHA 2DZTA 3BO9A 5G4EA 2V82A 1PHWA 3LGEA 4ZZ9A 4PTNA 5HULA 4ZQOA 4O1AA 3GDMA 3MHUA 2QCDA 4O19A 1KFJA 1GT8A 2X1RA 1G7VA 3RU6A 4FXRA 2WV8A 2EF9A 3BG5A 2ABBA 3H54A 2Z2UA 3GYEA 2ZZ7A 2FPYA 5CG7A 1Z44A 5GVJA 1O5XA 1OHLA 4QQ3A 3S5ZA 4ADUA 3KRSA 3M5YA 3RMJA 2ISSA 1CW2A 2J88A 5D2XA 2CLIA 5FF4A 4XQ6A 4NZJA 2F7FA 3L0GA 1W5NA 3N9RA 4L4MA 4X22A 3IGUA 1X6UA 3W7GA 3Q94A 3EX1A 4Y6GA 4AWTA 1NAL1 3HG4A 4MYAA 4FB7A 3OG3A 2WPBA 2CU0A 3IIXA 3TV8A 1LCOA 2WOQA 2WSQA 4GUGA 5DBTA 5HWJA 3UQNA 3GNNA 3VNDA 1TO3A 1TPVA 2ALDA 2I14A 3OVPA 3U8GA 4GJ1A 3L21A 4K37A 1PE1A 1I4NA 2W0UA 3HB9A 1WXJA 5FEXA 1WBHA 4TR9A 1GEQA 4YWIA 3OEXA 1R2TA 1XL9A 3W75A 1XKYA 2ZZ4A 1T99A 4O17A 4NXKA 1L6WA 3M7WA 4CNPA 4IX2A 2Z1BA 5HR7A 2ZRUA 1Y0EA 5I3IA 3EB2A 2A4AA 1F2JA 5G2WA 3NDOA 1FQ0A 1ONRA 3S1UA 2V0TA 1P4CA 3I7RA 3NQFA 2ZRWA 1WAUA 1VYPX 4WXZA 3DBPA 3NVTA 3PUDA 3R89A 4AHQA 3C2RA 2VC6A 3A21A 4K8HA 4ZMGA 2YYTA 4IPIA 1XFBA 1VCGA 2OJPA 2A6LA 5FI8A 1AW5A 3IIVA 2YPIA 4A22A 3W1PA 5D33A 3W87A 4RKAA 3NQGA 1CX9A 1GG1A 3IVUA 4M6PA 3STCA 5A5WA 1H7WA 3DFPA 4MFEA 3W70A 3KRUA 1G67A 1MSSA 2D73A 4WY0A 1LP6A 1UB3A 2HS8A 2ZRZA 4N6EA 3M16A 1UJPA 1SQ7A 1H5YA 5F2IA 4AWSA 4UMAA 2WSRA 1W3IA 4NUWA 4IGHA 4UFHA 4OHQA 3T7VA 1DORA 1OK4A 4IPJA 1FDZA 4CQAA 1FWNA 1HO1A 4XBSA 1M5WA 2G95A 2JGYA 4QITA 3AO0A 1AW2A 4AWUA 4NJJA 5G4WA 3O15A 4RX0A 5FEZA 3G1SA 4X9SA 3VCRA 1VC4A 4JTLA 1K7FA 1V5XA 1ZY9A 3BLIA 5U4NA 4EOUA 5K3VA 2CLHA 3LHTA 1K3UA 1TRDA 2VEIA 2BZNA 1OFOA 5AB3A 1I2QA 4MOZA 1C9DA 4UMCA 2QCGA 1AG1O 2ZTKA 3T40A 3QQ1A 3CIXA 4RZ6A 2ZA3A 4R53A 2R8WA 2QCLA 2HTMA 1OVDA 3M6YA 5AHFA 2RDWA 4Y90A 2YCEA 2GQAA 3HF3A 5LNVA 1SR9A 2TRSA 1S3HA 1YXCA 3BLEA 3G3MA 3QJAA 1PIIA 3TW7A 2I1OA 2VFIA 1EP2A 4FNTA 3VKJA 4DO6A 4I9AA 4JX5A 2YYUA 3MI3A 2NXHA 4FNUA 2QAFA 3NL2A 2ZA1A 3LCWA 3W1AA 4UMBA 2Q8LA 1JULA 3PR2A 1QR7A 2V81A 5D32A 4DO5A 3SFKA 3TXZA 3L65A 4OE7A 2A85A 3MWAA 3ABRA 3NQMA 5BMWA 4BWLA 3EXRA 1XI3A 5KZEA 3W9ZA 1P1XA 4ZQMA 1KLYA 2LLEA 1RD5A 1VCVA 4JICA 3CEUA 1MEWA 1FBAA 2B7NA 2R91A 3AJXA 1YDNA 2QF7A 5HNRA 2C18A 3ZWTA 1MO0A 1QPRA 1DVJA 1A5BA 3FLUA 2RDTA 3SZ8A 1O5KA 1OX4B 3SIZA 5F2GA 3P8IA 3QC3A 4NNAA 3E49A 1TPWA 1Q45A 3PB0A 1ZAIA 1ZCOA 4RXGA 2FPVA 3VFLA 4RK8A 2ZCGA 1H7NA 1TV7A 4PCFA 2JBMA 3DENA 4LC6A 2NXGA 3TUUA 1QO2A 3T4CA 3BGJA 4JXCA 4C1KA 5K9XA 3PB2A 2V5LA 3NPXA 3P62A 2G96A 2ZRVA 3TE9A 2OMAA 3N14A 1KTCA 4AH7A 4I7VA 5D2VA 1JCLA 4WJEA 3O8AA 3L66A 4O1DA 3LV6A 1LLWA 1R2RA 1KV8A 1E51A 1SU5A 4NJHA 3MHFA 3W2NA 3PULA 4RJEA 4XTDA 3WFAA 3DKJA 3W1QA 2NX1A 3P81A 4N2YA 1H7RA 2Y70A 4HNVA 3WK1A 4Y8FA 2X1UA 5K4XA 3H53A 3MBFA 4NX0A 4NT0A 3GR8A 1OFBA 5HUPA 3M44A 3LB0A 4JNMA 2C14A 1GYNA 4E38A 1IF2A 2ATSA 3PC0A 4JEQA 5EL1A 3MW7A 4NZFA 3LCHA 3NL3A 2PRMA 3TAKA 1HL2A 4MJMA 4ADTA 3F1QA
chains in the Genus database with same CATH superfamily
3WL0A 4WK9A 3EDEA 4A8RA 1OY0A 3HPAA 1CGTA 1J0JA 2WLZA 2YW4A 3HQOA 4PMQA 3EDFA 1LT8A 4ZE4A 3T2OA 2V2CA 3BJFA 3C4UA 1POKA 1W54A 1BKSA 1V6WA 3PAOA 4J3VA 2GDVA 1VAHA 2NWSA 1SYTA 4MB4A 5B7YA 2NQ5A 1JZ7A 3IACA 1PZ0A 2E3ZA 1ZBVA 2E9LA 3LI1A 3SY5A 5LHFA 2QPSA 5I77A 4IFRA 3GWQA 4Z1DA 4MZ1A 2OYLA 1YLVA 5XIAA 3RJYA 3TJXA 4MB3A 1OB0A 2EPMX 3C2FA 4LRSA 1G4PA 4H6RA 2REQA 1US0A 4L4OA 1GTHA 3ARTA 1PHQA 5JVLA 3FEQA 1FH9A 1J4EA 3GHRA 5A8QA 2P50A 4GVGA 3CL7A 2D2HA 4IGNA 3SUVA 1TV5A 1DJGA 3T09A 3LM7A 4TV6A 4KRZA 1TX2A 1LUCB 3VIPA 5D9OA 3VTRA 3EWZA 4ZSUA 4CNOA 1IWAA 3P60A 1XF0A 4HYVA 1KM0A 1OZMA 3CUJA 3NAVA 2J7BA 3LX9A 1PYFA 3PF3A 1QNOA 3ALGA 4P2VA 4GZEA 1H49A 1OC5A 2ZUWA 4UTLA 5BXPA 2PAJA 4HPXA 4LEFA 1JUBA 3CWOX 4PTVA 2X09A 1KFCA 4QNWA 1EJTC 4XBJA 1EEXA 1OFQA 4FP1A 4PUNA 5HPCA 3ME3A 3LLXA 4KERA 2GQ9A 3LXBA 3WF3A 4DXVA 2ZDRA 1RCQA 4GWEA 1C9WA 1PWMA 1UKQA 3PHAA 1K8CA 2BP1A 4G9PA 3FA3A 2BVWA 5A6BD 5ABEA 2F6UA 3NA8A 1OYCA 3CUGA 1QASA 4E2DA 1KKOA 5HXMA 3THQA 1ISXA 1Q63A 4JHZA 4F79A 2PC4A 2GVGA 1E71M 3TEVA 4K36A 3WQPA 1KBIA 4DJDC 4PRRA 2BHZA 3R0UA 1WNOA 3SB0A 1NSJA 4H04A 3W7LA 1MUMA 2DIJA 2V9DA 3W84A 3A13A 3GW0A 4YVXA 1GKPA 4B5SA 3M07A 2AGKA 1YDVA 1SO5A 1K70A 2FPTA 3IJ6A 2EEXA 3H2EA 4YTQA 1V51A 4FNRA 3C8NA 3UG8A 3D5HA 4K8GA 4ECLA 4AZHA 1P7TB 1WV2A 3QH2A 1B5TA 3P8JA 4GINA 4AG0A 3QSTA 2OTDA 5JBDA 3EX2A 3MHGA 5K4ZA 3WQ5A 4ATDA 5HPOA 3W6YA 4KFPA 3SR7A 2FIQA 3LS9A 4UTUA 2ISDA 1QBBA 2X16A 2QUUA 4IP5A 2OYMA 4GX9A 4ONVA 1X7FA 2IPJA 3M41A 2GGIA 1F6PA 2ON3A 1RR2A 3S2LA 3WQOA 2E40A 3W29A 5L6UA 1QVBA 1NFPA 1J8VA 3AS1A 3OG2A 4V2XA 3AMLA 2DJXA 4K39A 3TYZA 2OFJA 4IXHA 1MNZA 4XUYA 4N4QA 3ZR6A 4QEHA 2WCGA 2PDPA 2YCLB 5E6YA 1G94A 2ZYFA 5BYWA 1XSKA 3QSRA 1XLEA 3W2MA 1YDOA 4DF1A 4H3DA 3BLPX 3HMJG 3VIHA 2VRKA 5C0QA 1EWDA 2GVYA 2E77A 4UOZA 3WH9A 4AHPA 1V0KA 3H55A 4NAFA 3W1RA 1J79A 4C1NB 1TG7A 5D9PA 5A8GA 3TLQA 2CBVA 1JNEA 5LNUA 4XBKA 3N13A 3T05A 5C9WA 3VX0A 4IFOA 4QM1A 5FIPA 1X6NA 3URQA 3OVRA 3OOQA 1GVEA 3P80A 2XM1A 2GUBA 5JUVA 4MYXA 1YPIA 2C79A 3RJXA 4DYEA 3G0SA 3NEHA 3BUVA 2YBTA 5GNXA 3BCJA 5CZSA 1WDRA 9XIMA 2V2DA 4KWVA 1LLOA 3WDHA 3TW6A 1FHDA 1XLFA 2PEVA 3GZ3A 1HF6A 2ZZ2A 4CU7A 3W1LA 2QPUA 4RE4A 1MI3A 2XJ7A 4OOZA 3UG3A 3WF2A 1R5YA 1TB3A 3AAMA 2QJHA 4XZ9A 3LUTA 1NFBA 3ATZA 3ITTA 3PBVA 5BOOA 3H23A 3AZTA 4PA8A 2BXVA 1AH3A 3PBUA 2IXUA 4O1CA 3T78A 1EOKA 3AXHA 4Q4RA 1WPCA 3OODA 1IZJA 3W26A 3CEPA 4HNNA 4HP5A 3WG6A 2DEPA 2NV2A 1OF6A 1P0KA 3KE0A 3EWWA 4JZ5A 3L5LA 2FH6A 5D2TA 4UWMA 1XR2A 1PBGA 2VL4A 3DERA 3THDA 2E6DA 2QKFA 2XG9A 1NH6A 4A2SA 3WK2A 3K4DA 2OLAA 2XH0A 1KXVA 3IPWA 4MZYA 3C2VA 2VD8A 4FNPA 2F6KA 3FNDA 1FWHC 3AZSA 4XO6A 3FY1A 3QEZA 3A3WA 3LHZA 1KXHA 2O9TA 3CL6A 1FCUA 1BWLA 4DIAA 3II1A 4L6OA 3LHUA 3LZ3A 2V5BA 1UA3A 1NELA 4R34A 3REQB 1EF2A 3HGOA 2QUVA 1TPEA 3AU2A 5AVHA 1YEYA 2WCSA 2WHKA 1Q6DA 1TTPA 3PTQA 3H8AA 3BV4A 3G0UA 1UWIA 3L9CA 2X42A 4C7FA 3YPIA 2AMXA 3P5ZA 3G1YA 4MSSA 1EA9C 2OEJA 3SJ3A 1BSLA 2R6OA 2VMFA 2O9RA 2XTKA 1XHGA 5M17A 3RR4A 3B9OA 4QG9A 4R7WA 1HN1A 2OQHA 1S5TA 1T41A 3FN9A 3PZTA 1NM9A 2XYLA 3FJ6A 2I16A 1WA3A 4ZEPA 1VKFA 3RLUA 3VU2A 1HT6A 4IMGA 1YNQA 4N9EA 3K30A 3P7YA 4FOJA 3ANVA 4H1ZA 3PZGA 1PKMA 3EB4A 1EGZA 4FX8A 1B4EA 3ORWA 2C6QA 2HWGA 3PPFA 3VIIA 3MO7A 3NZPA 5EMJA 1DTNA 3WJZA 4LWWA 3TSDA 3PK7A 3A22A 1VBGA 1PUDA 1EJRC 4FALA 3PY2A 4AEOA 2XIMA 4IZGA 2Y5JA 3KL3A 1QWGA 5GQBA 4EPBC 4KCTA 4HSNA 1GG0A 3UZJA 3UWWA 2FGLA 3F4CA 2PWUA 5IBXA 1J9YA 3A5FA 1J11A 5BXSA 4WQ6A 1V3MA 3MUAA 3IV3A 5DF0A 2EXOA 2ZADA 5FL1A 3RF9A 4PEEA 2VCBA 1JYXA 4ZSTA 1IZCA 2NWRA 4JYFA 4UUIA 1XLKA 2AL2B 4FSAA 1OFAA 4DJDD 3BAYA 3G2GA 1ODUA 2YR1A 4CEUC 3TSMA 2DUAA 3DFOA 3WNMA 4U3CA 5EMLA 3MZNA 3FS2A 4BI5A 3VCNA 5JBEA 3MI6A 3V16A 4AYSA 4H9UA 3NO3A 1J5TA 2WZMA 2BY2A 2Y5EA 3UERA 4AZ5A 4JX6A 4EANA 3UD6A 3ZJ6A 5K7JA 3DAQA 4I5UA 5CZTA 4JTCA 4AIBA 3UZ5A 4AIOA 1E40A 3TNOA 4US5A 3ECQA 3WLJA 3G8EA 1SGJA 3LERA 5DY2A 3WNPA 1OFDA 4XVDA 1GUVA 3F4WA 5SWUA 4GPNA 1XBYA 4KWOA 3TTQA 2JGQA 3CLMA 4DYKA 2YLLA 5HMFA 2YX0A 5D37A 1M03A 4XB3A 4QXIA 1R3QA 4TIMA 4I9JA 3BLLA 3EXSA 3BGGA 1O1HA 1SMAA 3BXWA 7TIMA 4C6LA 4MPQA 1QOPA 3A23A 3VUSA 4PL1A 2FB2A 1HL9A 4JIIX 3RYSA 4DNHA 1H50A 3IANA 5TBOA 2OELA 2Z6JA 3NUKA 3QOKA 4O53A 1CNVA 4OBRA 2R14A 2VFGA 1ICQA 1XIIA 4BQ2A 4UB9A 3TFCA 3EKZA 5C5YA 4WGXA 2BXZA 1K4HA 2QJGA 5I2UA 1W1YA 1W1TA 3HG3A 4BJHA 3DI0A 2CLPA 1K8XA 3GTNA 3BJTA 3CHEA 4LAOA 3S1XA 3DH7A 1PKYA 2V3FA 4LALA 1CXKA 2J24A 3IARA 5GJMA 2ZUUA 3OIXA 4ACZB 2EPLX 3CUHA 4JIPA 3L4TA 3MI2A 4CCCA 2WWDA 4XK2A 4FLSA 5JIPA 2WHLA 1TVLA 1E4LA 3IV8A 4LPCA 2J4GA 2QJNA 3BMXA 4H7VA 3EX3A 2CZVA 1W8SA 1AZ1A 2ZUVA 4C7DA 1GKQA 3OVGA 3GU9A 1D7FA 3PSVA 2CKRA 4ZBCA 3H2MA 3KS5A 1EZ2A 3AIQA 3ICJA 2AL1A 3NQEA 1GOWA 5C71A 4UTMA 1UD3A 3BTNA 2J75A 2O55A 4U4MA 4YMZA 1SSDA 1DYSA 1XSIA 1HJVA 2YA1A 3HU7A 3BMVA 1FWFC 2VHLA 5T9CE 3VPLA 3M1ZA 4RZ4A 4INFA 1LF1A 4A4AA 5BW6A 1OCQA 4J2PA 4NJGA 2YGYA 1SFTA 1UBSA 1CZ1A 3FEMA 3N6HA 4PR4A 1R38A 1XD1A 3QBUA 2RUSA 2J66A 8TIMA 3EWDA 4WSHA 4JQ3A 4YCOA 2G3JA 1OINA 1H63A 3EXTA 4C6OA 1TUXA 1AQHA 2CEQA 4HA4A 4W8LA 2O7QA 3WK3A 1HVXA 3TK7A 3BJSA 3G5EA 4MIMA 4AD5A 2WW5A 4AD3A 4XZHA 3GG8A 4GYKA 1NFGA 4JTUA 3AZRA 1LRTA 1JZ8A 4GO9A 1FCBA 3EGJA 5I7GA 2XIOA 4MDPA 4CLMA 3HJEA 3VILA 2TODA 4V33A 2QPXA 7PTDA 3MMUA 4FO4A 1RD6A 1WO2A 2E1DA 1OFRA 2BY3A 3ARWA 4HZ8A 4QSFA 3CM4A 4B3LA 3M5VA 3BDKA 2PWEA 4FI4A 5E9AA 1LG2A 4OUEA 3W7HA 3C86A 2ZOXA 3UJRA 1OK6A 4JN7A 2J8GA 3TYDA 4QCEA 2DGAA 3GU2A 2V5JA 3ABOA 1XH2A 4C6IA 3UWQA 3QQ0A 2AAAA 4L9ZA 5BRBA 1ZJHA 4F9DA 1L2UA 3TC7A 4EXBA 4WDWA 4MZ8A 1NARA 1ITUA 1JDDA 3GDBA 4FA3A 1VFSA 4HN8A 3L2LA 4P8UA 4AMCA 4WCJA 5EB8A 1VFHA 2Z1WA 3C0QA 4E3TA 1GTEA 3OZMA 2CZFA 4D71A 3SFWA 1VQTA 2PP1A 1B54A 1HJQA 3GH5A 3PVFA 4C6EA 1KWGA 4IIHA 2WMIB 9XIAA 4EAYA 4NASA 4C65A 3WNLA 2G4JA 4GO8A 1UUMA 3ZJKA 4XTIA 2GUUA 2I5QA 3W7DA 1KM3A 5G5IA 5HQLA 3VNMA 2Y7GA 4CN4A 1JDAA 2ZX5A 4RDVA 3AHVA 3P3BA 1VJIA 1W6TA 3LXAA 3VM7A 4XKYA 1GQNA 4N9CA 1E56A 4RDYA 1E4IA 4H6EA 1W3TA 4FXJA 4NRSA 1B31A 3GXFA 2WSYA 1V6TA 3PBWA 1OYBA 3LRLA 5A69A 3N19B 2R82A 1H1YA 3KDNA 3LMYA 4KETA 4DAIA 4W5ZA 2DP3A 1TZZA 2V63A 1I0DA 1FFRA 2CKSA 4X3ZA 5CZJA 5FJIA 1R8LA 4GI9A 3N4EA 4DN1A 1WE5A 3IJDA 1W5PA 1OCJA 2TPSA 4H9XA 2ZDSA 3LN3A 5D05A 3RILA 5H8MA 3L68A 3E2SA 4B15A 1JD9A 5M2FX 1VYRA 2YDQA 3M0XA 3B8DA 5H6HA 2PWDA 5RUBA 4M19A 4BEQA 4W8BA 4IX0A 4ZQNA 1T7LA 3PZIA 4ZOAA 4LUSB 3K8LA 3DG7A 1OT1A 4CVUA 1XGEA 2OXNA 3ITCA 3WUEA 4DJEC 4L61A 2ACUA 3A4AA 2X30A 4YCPA 4TQTA 3TNBA 4D6IA 3H12A 3NPWA 3V18A 1QOQA 1LT7A 4B2DD 4ZL1A 3KM8A 1EHNA 2WB5A 4OBTA 4XVEA 3RX2A 3PJTA 1F74A 3KTSA 1BXNA 3T8LA 1K9EA 3U4FA 3QY6A 4QTGA 3A3XA 3S42A 5I24A 4XIMA 4N02A 3L5AA 4D6FA 1KFEA 3VNLA 1ADOA 4XZWA 4JDYA 3TTOA 1XLHA 2JF6A 2EKGA 3UY7A 2ZUMA 4G56A 2VT0A 4DX3A 2FMNA 1ZRQA 1TRIA 2H3DA 1GHSA 2X1IA 4ZB5A 2OQYA 2P88A 3EOEA 1TIMA 2IS7A 5I3JA 3B9DA 1ITQA 1BF6A 1B3ZA 3W38A 3FGCA 1RQBA 4JS3A 4ICNA 4AY1A 1TMQA 1E4MM 5DQPA 2Y61A 2PS2A 3VXGA 3FVDA 5I3DA 3UESA 4J5NA 4KEMA 1J0KA 3V0TA 5AKQA 2F2KA 3R5EA 3KS6A 4JTFA 2CLLA 2OT0A 2OX4A 3OGRA 4W87A 3ARXA 3WJWA 4ZQPA 3EWXA 2J9XA 3ZIZA 4NU7A 5F1UA 3WQDA 2VKZG 2GJRA 4ROPA 3RITA 1NDVA 1QNSA 2FHCA 5H2ZA 4R85A 4A8NA 4NX5A 3CTTA 4GYJA 1CEOA 5E0CA 4CD8A 1Q2SA 1DE5A 1GHRA 1HVQA 4QNEA 4N0RA 2EPHA 2QCNA 4E4FA 3W53A 4Q6XA 2JEQA 4ES4A 3NWRA 4KH2A 4P61A 1V6YA 1HQTA 4IGSA 4AB4A 3TDFA 3EOSA 4HHLA 3W71A 5H8PA 2V30A 1U1JA 1LTDA 1XC6A 3BZJA 3LPOA 3LOTA 1SW3A 5HWMA 3BLKA 5LHEA 5J5DA 5AHMA 1VF8A 3HPZA 3M0YA 3IRDA 3WLQA 2DY3A 1UWUA 3N3MA 3W88A 3D0CA 3WIJA 4B3ZA 4LRTA 3P93A 2D0HA 2CCRA 5HMDA 3PZVA 3NSNA 3M46A 1SO6A 1VRXA 3KWSA 3I68A 2YL5A 3QV6A 4Q7NA 3A47A 4FLOA 2PB1A 4HYWA 3QN3A 4BHYA 2ZXQA 2NQJA 3WBAA 5DMMA 2B7QA 3I65A 4RV3A 4DUVA 3N2XA 3TTSA 4EX4A 2ZXDA 3CZ8A 3AWNA 2PCEA 1G4TA 4I8DA 4NZCA 2OVLA 3K1DA 3O0FA 4KWUA 3W22A 1R7OA 3MS8A 2ZZ5A 3W01A 1JRBA 3PG8A 1W3JA 3H7VA 5A2CA 5JXQA 1U30A 4J27A 3I3DA 3CUXA 1TJ0A 1Q8AA 1MW0A 4Z2JA 1PYMA 3A9IA 4ZOEA 2O56A 1AQMA 4QJ1A 4MAZA 3GYCA 4DI9A 2GUYA 4PB4A 5BWFA 1R9XA 1GOKA 1XIDA 5C70A 3GK0A 1TJPA 3SN1A 1WDWA 1I2RA 2V5KA 4QDMA 3FJLA 3PP7A 1XLDA 2NZLA 3CB8A 2DJLA 4Y8EA 4Q8VA 3S1VA 1KM6A 4HZ6A 3FW6A 3LPPA 5FA5A 3VZYA 2BSLA 1V3KA 3BH4A 1GPWA 1PX3A 3C5QA 4UTTC 4ZO7A 1KM5A 2V5DA 4GH1A 1MXSA 2ZZ6A 3WZ0E 3DX5A 4WKHA 1H1NA 3AHTA 4GI6A 1WKYA 3VK5A 1AK5A 1M9HA 3NM1A 1KCXA 4PL2A 5CPTA 4WKFA 1D3HA 2WLYA 2W63A 1ZJBA 1KFWA 4DJFA 4B3KA 3DHFA 1IIHA 5K2ZA 3N6QA 1XLIA 3LPFA 4NAEB 4PMUA 3LCFA 1J5SA 5CSRA 4J35A 2PDXA 4B5NA 1N7KA 4UBPC 5T9BG 1A5NC 1NQKA 4IIBA 1JZ2A 4LUJA 3LHYA 3QYQA 3VKDA 2JKEA 3SCRA 4JTAA 2AKZA 4JTHA 4KGLA 3BO9A 5G4EA 1RSCA 5HULA 3VKBA 4HGXA 1N82A 1GT8A 1ZS2A 1SZRA 3BG5A 3H54A 4HNLA 3QYSA 2YXOA 5CG7A 3FXGA 1OHLA 3A12A 4B16A 2J88A 5D2XA 1R3SA 4XQ6A 1MXDA 2D2JA 3AYVA 3N9RA 2VX4A 4JNZA 1H4PA 3W7GA 4DZIA 3HG4A 3IGHX 5IRPA 3OG3A 3IIXA 1EJUC 1LCOA 5HWJA 2JQXA 1XG4A 3O3RA 2PU0A 3U8GA 1QNRA 1ZBWA 3PZUA 1I4NA 2BY1A 2W0UA 3HB9A 1XIBA 1WBHA 1TR9A 2IW0A 3B8TA 1DWJM 3OEXA 1R2TA 1XL9A 4UNIA 1CGYA 5BOEA 1IE7C 2ZRUA 1Y0EA 3NDOA 1Y5XA 4KT2A 3PPHA 2VRJA 4H2CA 1A5LC 1EDGA 3RU8X 3I7RA 3LNMA 2FVLA 3NQFA 2PTWA 4L6DA 4KCVA 2Y0FA 4AZBA 3DBPA 3OZPA 3T0AA 4YU1A 4D1IA 3SN4A 3DYPA 3IIVA 3KTXA 3SCVA 2YPIA 4A22A 5D33A 2IPWA 1XRFA 1PTDA 4MB1A 4M6PA 4I9MA 5A5WA 5FL0A 1XLLA 3SRFA 3MCOA 1LP6A 1UB3A 2VM8A 3BURA 4ZXOA 4CN1A 5F2IA 4UMAA 3W37A 1Y8BA 1W3IA 2OO0A 4IGHA 3MWCA 4XAPA 4MDOA 3NCOA 1NDYA 1GNXA 1FHUA 1W9UA 3HFYA 1M5WA 3GZAA 2Q09A 3AO0A 4AWUA 1MFUA 4JL2A 4KIEA 4NJJA 5G4WA 2ACSA 4NSBA 4MWAC 4WSKA 3T4WA 3G1SA 4QS6A 1VC4A 4JTLA 2CHNA 1HXJA 3LHTA 3VDCA 2VGBA 4PRTA 1ZGDA 5AB3A 4MOZA 2R9RA 2QCGA 5EGRA 1AG1O 3OIHA 3AYSA 2ZA3A 4CD6A 4ZE5A 1GW1A 2R8WA 1V4YA 5BU9A 2Z1SA 3M6YA 1QI2A 4PUMA 1UQZA 3HF3A 1XYFA 2NQLA 1SR9A 1YXCA 3TW7A 1DIDA 2VFIA 1V02A 2NXHA 1XP3A 2XSAA 1HKVA 2ZA1A 3KZSA 3W1AA 3DGBA 1REQB 3QTGA 5D32A 1MQPA 3BC9A 2O4QA 3SFKA 4WDTA 5BMWA 4PMJA 1E9YB 1CLVA 3T0CA 1P1XA 4PCTA 4AVNA 1KLYA 3WMSA 1EBHA 3APYA 2YLAA 1EJ7L 2XVKA 1RK6A 3PBGA 4F40A 3AXMA 3UR8A 5J04A 4RNJA 4R3UA 1YDNA 1P6WA 1MO0A 3RO8A 2Z29A 5BCAA 1MFVA 2ONEA 2RDTA 2QJMA 2E7FA 4GI8A 1OX4B 3SIZA 3P8IA 2G50A 3QC3A 3CAQA 3PTMA 1Q45A 3PB0A 2ZVRA 4ZTXA 2BDQA 1ZCOA 4Q8WA 5CC5A 5HANA 3GU1A 1ZL1A 3A4WA 1WDDA 1M1BA 4F4RA 3MQTA 4ML4A 3UPMA 3S6OA 3DENA 2XIJA 4C6DA 4D8LA 5K9XA 3NPXA 1P0DA 2G96A 4I9TA 4LXFA 3TE9A 3N14A 2J7GA 4PMZA 4TVDA 5CJMA 4I7VA 4D6DA 4O1DA 5I0DA 3WLLA 4ZOBA 3GC5A 3MHFA 3HTWA 3PULA 4RJEA 3DKJA 3WD1A 4IP7A 2WC7A 1QHOA 2JF7A 4QS5A 4BS0A 1KBLA 1R7AA 4RL3A 2G41A 1OFBA 4GD0A 4C5YA 5HATA 4A35A 4GVFA 2G37A 4NZFA 4BA0A 3NL3A 5ABFA 3JU2A 4KRTA 1HL2A 3VOGA 4MJMA 2BGSA 3CMJA 3UWUA 1SSGA 2X7VA 1YPXA 4GISA 2FTYA 1SMDA 5CPQA 3VGBA 3DECA 4GVIA 2NVCA 4M24A 4S3DA 5KINA 4NVTA 2VO5A 4TMBA 4F2TA 3POHA 4IL2A 1MUCA 1LM1A 1G0CA 3C0LA 3LTPA 3BW4A 1ZQ5A 4NRRA 5CJ5A 1T8QA 2RDXA 3UNTA 1S46A 1M7JA 4AAJA 3QC0A 3E0LA 1B30A 4HMNA 4RPQA 1GVIA 4RDWA 4QROA 4DVOA 4DZHA 2VX7A 1GZJA 3DFQA 1BGAA 1NOUA 1XRVA 2WJDA 4NG3A 3VNIA 2W67A 2VURA 3BCFA 4D6HA 1W37A 4ML9A 5LGZA 4TVCA 1D8CA 3N18A 3EWBX 3LCIA 1KBJA 3K13A 3QW4B 1TVPA 3TYEA 2QEZA 2CZEA 1B2YA 4D6JA 1IQ8A 3WCZA 1BSIA 2GQ3A 8XIMA 3RK8A 1XX1A 1JXKA 3ZMRA 2BS9A 3HN3A 3EA1A 4B2DA 1MEIA 1R3VA 3FAXA 1PWLA 2DW6A 2Q3RA 4FOUA 5AYIA 1J2WA 2EBNA 2I5GA 3BW3A 1KR1A 1DP0A 1EUAA 4CEXC 4HU3A 4BY3A 2J7EA 1D8WA 2BVDA 2X41A 1GVQA 3ZSSA 2PE4A 5AY7A 1H62A 4JQAA 3G1FA 1LOSA 3QZEA 4O1FA 3DIPA 3CXOA 3UY8A 1F9CA 1OQFA 2Y1HA 1EPXA 3PFRA 4GNKB 1N2VA 1Q5MA 4RW3A 4HJFA 4NHVA 3RLVA 2EG6A 4Q4QA 2HBVA 3O16A 1H0IA 1YXYA 1JI2A 1Q6CA 1JPHA 3W85A 1EGVA 1MQRA 3WK0A 1JYNA 3HGJA 5D02A 1CXEA 1S2WA 1Q85A 4KBXA 1BXCA 5AFDA 1FP9A 4OGZA 2Q6ZA 2HNHA 1YXDA 4TMCA 3WBWA 1F05A 2PRHA 3M64A 2J25A 4JEJA 1Z8AA 4MGGA 4O0KA 5IDZA 1X1OA 3C0JA 4RW5A 2YB4A 3CPGA 1VPQA 1EO5A 3VAVA 3OVQA 3TJIA 1Q66A 1B57A 3R2GA 1H61A 2G3MA 2TAAA 3GFZA 2YIHA 2HDJA 4GE8A 4FMVA 1EJXC 3T1GA 2A3CA 2Q01A 3LNPA 1IR2A 1V0MA 1VPXA 4L1GA 3ZT5A 3MKKA 4CQDA 3U5UA 5HINA 2X0SA 3SCNA 4REQA 3FJ4A 3WQFA 1CPUA 2CW6A 4FNQA 5C2GA 1KC7A 1XYBA 4QP0A 3UPBA 3DGRA 5A6LA 2D69A 5JU6A 4LAZA 1OGBA 4IFKB 2VZUA 4HCLA 3KP0A 4O0ZA 4LBSA 2VZSA 1W1ZA 1QBAA 3GM8A 3N04A 1X96A 2BGQA 5A6SA 2B0MA 3PNUA 1BLIA 4OZOA 1W1B1 1W3NA 4AZGA 1XSJA 3W7MA 4FIQA 1TKKA 3HO8A 3LTYA 1GGOA 3KBMA 1S39A 2VUNA 1LRNA 2CNCA 4MB5A 1QATA 1GYLA 1R47A 1PTGA 1XICA 1FWBC 3E9AA 5HUOA 3W6MA 3T6CA 1W9XA 2J7CA 4PBEA 4GUHA 2FLIA 1DHKA 1T96A 3CT7A 4LB3A 3H6OA 1P0NA 3CUFA 3SCPA 4CUCA 4ASTA 3RNDA 1UBPC 3RAOA 4BI6A 2XN0A 2PDQA 4WJXA 2RKXA 5GJNA 2P10A 3VE9A 1SFJA 4JIQA 1RBLA 2ADAA 4DEFA 1X98A 1XC4A 4GBUA 1UD6A 3SM0A 2IUZA 1BYBA 3TWBA 3W7KA 4LVGA 1EYEA 3UU0A 2IKHA 3EPMA 4GUIA 3BLFA 1E4NA 3TQKA 4KWWA 4B91A 1XJBA 1XRSA 2X2GA 1F8IA 4KEZA 1U1HA 3HGRA 3W3OA 3BARA 4POCA 3NO1A 1L2QA 3IUDA 3ARRA 4WUIA 4AHOA 4HZMA 5M3WA 3KOWA 5MKGB 3PTDA 1DPMA 3ZLFA 3QPYA 1XQLA 1V0LA 1WX0A 4IFKA 1TREA 4R33A 1DEDA 4P7RA 1UZDA 3UWZA 2WVUA 5E1QA 2C1HA 2ZC8A 2DV0A 3VIGA 3CV7A 1WZAA 2A7RA 2ZC1A 5HNTA 5DBUA 1KO0A 3GY1A 4UTKA 4J28A 4GIRA 1CTNA 5LNWA 1G6CA 4PUDA 2J6XA 5FKYA 1SO3A 1GQJA 1UIPA 4S2BA 3Q37A 2Y7FA 2E68A 5D09A 1T0OA 3O6AA 3GC2A 1RQEA 3H7RA 1UPMB 2X0HA 2B7PA 3KX6A 1A0EA 4UR9A 4DJFD 1VLIA 2PRLA 3BE7A 4BZYA 1YADA 2ODOA 2A7PA 1JCTA 4HYRA 1FP8A 4IUOA 3P0WA 1GVYA 1CENA 4L1WA 4LUYA 1EH9A 2HK0A 3L2MA 4WZHA 2VEMA 1VEPA 2E25A 1V3HA 4C6KA 4PTXA 3IIOA 3WDJA 5GPRA 3GH4A 3OA3A 4XD6A 3NPUA 1XIJA 3H70A 2HPIA 3TC3A 1FWTA 3SGZA 5T8GA 3B0VC 3W27A 5KZDA 1MWOA 3OBAA 5EY5A 4RNFA 3NEVA 3L5MA 5F1VA 3W7IA 1TPUA 3MU7A 1KCLA 2F6XA 2GSEA 3C56A 1XH1A 1NWUA 4LY4A 2DT3A 3MDUA 1I0BA 3FSTA 3NR0A 4GY7A 3G1XA 1K6AA 3BVJA 1NP0A 2OLSA 3W7QA 4KESA 4UTWA 4DZ5A 1R0MA 1RJPA 4J3TA 2WXDM 4FR6A 2R1NA 4BKNA 1LRQA 3CQIA 1MDLA 4IIGA 4H01A 3JZEA 5LZLA 3TMLA 4JDBA 3WD0A 3MSYA 3AXIA 1OCBA 5FESA 4E5TA 2VRQA 1ZU8A 2VX6A 8XIAA 2CBUA 2OWCA 3RR1A 1F5ZA 3OQEA 4WXYA 4HT3A 5LKYA 1DBTA 1TPH1 2JALA 2HVNA 4DF2A 3PSWA 2PGFA 5ECVA 2W4XA 3U7VA 4KFOA 2A3AA 4KCWA 2GVEA 1XQKA 3PANA 5CC7A 2XHYA 3GXPA 4MKNA 3GBDA 1FH7A 1W5OA 3DC8A 2YFOA 3B9AA 4KIRA 3SQMA 4CKQA 1K7XA 4C6FA 3RPMA 5C6MA 3ANYA 1L9WA 3M0ZA 2GGHA 3APGA 3TU9A 4NKCA 3SCQA 5LNRA 4GXPA 3NQ2A 3UZYA 5AC4A 1LL7A 2FFCA 2PBOA 4RE2A 3LM3A 2XM2A 5C7HA 3TC6A 1KBKA 1B9BA 3RLHA 2F8QA 1XDLA 4LC8A 4MADA 1BTMA 3AIEA 1AODA 3NQ6A 4TO8A 3M43A 3GUWA 1J01A 2PFHA 1HKMA 4DBSA 1OABA 3N2CA 4AZCA 4MLRA 1XGZA 2WJFA 4W4QA 4UC5A 1SW7A 4FHAA 1DJWA 2VENA 4LVAA 4MM1A 3DFTA 1ZJIA 3KAOA 4GKLA 3WLIA 2D20A 2C3ZA 2PDWA 1ME8A 3KTCA 3R8HA 3V75A 2E5CA 4U3AA 4UXDA 3DHDA 3W72A 3UT0A 1W91A 2O9PA 4H6KA 1PEZA 2X8RA 3ANUA 3TROA 2GJLA 1P0EA 3KL0A 1JPDX 1HKJA 1TCMA 1U5VA 1O12A 4ZO9A 1TJ2A 4BQ5A 1MYRA 2DT2A 2PDFA 2CHOA 2AKMA 4DJDA 2D2OA 1HTIA 2YXXA 3EMCA 4M0XA 1LYXA 1YBQB 4AMAA 2DPEA 4E8DA 1UPPA 3HQNA 1MXGA 3LQLA 2CBJA 1ENUA 2INZA 2J78A 3PZNA 2O0TA 2DSZA 3BLOA 4XWUA 3VINA 2OQLA 1UZHA 5BXTA 3DI1A 1M04A 1RVGA 4I8YA 4EPDC 3MV11 1G7UA 3N11A 3R7MA 3ZVHB 1UMYA 3QMTA 1HZYA 5FF0A 1QJWA 3WH6A 4TX8A 1O95A 3KBNA 5FACA 1C8YA 5XINA 3KXQA 1CLKA 2XDFA 2PURA 3NZRA 1A0CA 2X1TA 4ACZA 2CESA 5F4XA 4UIOA 1JNDA 3PM6A 3WFZA 1M53A 3AUOA 4I7WA 3U2OA 1XLGA 4B92A 1XBZA 4PC8A 1X8CA 2ZUSA 3Q2DA 4C91A 3OP2A 4YTSA 3F2BA 1DJYA 3G8RA 2A2IA 1UJQA 5AC5A 1PZ3A 3I3BA 2P76A 3KVKA 4E0CA 1Q6LA 3GVWA 3OZYA 4HNTA 3UG4A 1EDTA 2WVSA 4R9XA 1K9DA 3UF9A 4MNMA 4CGTA 3UWYA 4QAIA 3V35A 4ZGYA 2XWDA 5HNUA 4NQ1A 3M5XA 1TPB1 5FJJA 1K7EA 1UC4A 4QE5A 3EDJA 1A4LA 2XVPA 2WK2A 3A4XA 3P5YA 3B3DA 2A5HA 2QAPA 3JR2A 1P48A 1NIUA 4GQGA 2DZPA 1TR1A 3K1GA 1M68A 4MWAA 4N9BA 4MNLA 4I3GA 3UR7A 4AXKA 1OFPA 4XAGA 4J9JA 1XLJA 1AL7A 2G3NA 3B03A 3OLDA 3WQ6A 5I02A 2ZFAA 2R94A 5KTLA 3WF1A 2VNCA 2QJIA 3KBSA 2INFA 1PDZA 1ZAJA 1BRLA 1YYAA 1OJXA 1QW9A 4UZUA 1UUOA 4CQBA 1L6GA 1V3JA 4P7NA 1UHVA 2QCDB 4GH3A 3COTA 3J7HA 1SZFA 4AW7A 1S5WA 3UA4A 3VOHA 5M03A 3UR2A 1XDMA 2JFEX 1JYVA 1SM9A 4O16A 4YL2A 4URIA 5DRIA 3CNYA 4J3WA 2J7DA 3ARUA 1Q65A 3N2MA 4AF0A 2IKIA 3OLEA 4IGMA 4NYYA 3P84A 5HK4A 4MFDA 2H90A 5IHSA 3ABQA 5KMYA 3NOEA 2R1PA 4L56A 4DO7A 1WYIA 4W7VA 1V93A 4LJ3A 1YX1A 3TA6A 4HOZA 4GA8A 3C2OA 1TSIA 1X7IA 4NYUA 2VQUA 5E0KA 4LVFA 2CLFA 4K1GA 1ICPA 3SURA 2POTA 1GVFA 3EZ4A 3QZ6A 4HPHA 2ZE0A 2H3BA 3LTSA 1E0UA 4UFKA 3GR7A 3IJLA 4PN2A 3UXAA 4B5TA 5B80A 3CHFA 3NPVA 1ZP3A 1C8VA 1TTQA 1O7AA 3PS7A 3AYRA 4H6QA 4ILSA 4RXFA 1B4KA 1TCDA 3H2FA 7TAAA 4ERAA 5KSWA 4GG9A 1M6JA 1O94A 3ONCA 2DSKA 3BOLA 1UWRA 3C3NA 1XIGA 3N2OA 1M7XA 5LIWX 2BG5A 1YTKA 2CHRA 3VO0A 2X2YA 1OX4A 4Q7IA 5BXRA 3M0IA 4H00A 4O14A 3SGGA 3AALA 2PTYA 1KM2A 1QDSA 3RM8A 1O68A 1EP3A 1QWKA 1FX6A 4EIVA 4RCXA 3JVAA 4PTMA 2GDQA 1FWWA 4AF0B 2EPOA 3G6LA 3NZQA 4LVBA 4TUFA 4W5UA 2CETA 1DWFM 3L0KA 1W9DM 3LCLA 4PB3A 3GE7A 1UWAA 2OKTA 4Z0JA 2XIIA 4IIEA 1JDEA 1J10A 1P0BA 3ITXA 1MZHA 2WANA 4L1XA 4DHGA 5LYRA 2EAWA 2I7GA 3SCUA 2DZXA 4N7QA 4XZNX 2CLEA 2VOMA 2XH7A 1M3UA 2ZX9A 2A3BA 1KQYA 4F9JA 2QV5A 4W8AA 2WMJA 2NSXA 3E0WA 4J3ZA 2W9MA 2CERA 1ZENA 1CGVA 2VGFA 4AWEA 3KLLA 2HSAA 3FKRA 3QPZA 1G4SA 4O15A 5MF5A 1YTEA 3NQ8A 2IKGA 1X38A 3CJPA 3IAPA 3RCYA 4ICCX 3DBNA 3GNXA 5EBAA 1OEPA 3TZNA 4HTYA 3CO8A 4S3JA 1Q6OA 5KITA 3R79A 4RNHA 4L9YA 1DKWA 2HQAA 3GO2A 4PMYA 1E6SM 3WDQA 1FHVA 5AYXA 2EGZA 4F0HA 3W2LA 4GQBA 4O13A 2E28A 1DJIA 2P53A 4FX6M 4HOXA 1XYAA 3EB3A 4RDZA 3M0LA 3FYOA 4DBUA 2VZTA 2V6AA 3P82A 4PRWA 1KGUA 3RFAA 1EQPA 1LQ2A 1SJDA 3TA9A 3G18A 4RV8A 2NV1A 2HBXA 2WVTA 1PTAA 2HPMA 4Q8OA 2WC3A 4W7WA 1JQVA 4A29A 3UWEA 2X1SA 4GYPC 3HV8A 1JZ5A 4IWWA 3KP1A 4UFMA 4P5UA 2G4FA 4LUIA 4K38A 3UGRA 2QCMA 5CBJA 2XPKA 3RRAA 1BVNP 3WDIA 3KVLA 1XYZA 1X1ZA 1WDSA 2GPTA 4QDWA 4IG2B 1A53A 4PZVA 1H7XA 4HNCA 1YQ2A 1E9ZB 4DPPA 3MUIA 3TMQA 4UCGA 1QOXA 4Q3MA 1W5QA 1ME7A 1XIMA 3IJ8A 4K8EA 4HCDA 1E9LA 2BB0A 4DLMA 5DN1A 2NX3A 5E93A 3E02A 4GUJA 1R9YA 4ICMA 1QFEA 3KOFA 3CO4A 5CCZA 1DQWA 4OT7A 1UKOA 2YL6A 4ZOCA 3EEZA 3ZWSA 2QJJA 3UNDA 3H2CA 3AIVA 4JGDA 2VELA 1SZGA 2QDDA 4BF9A 1LORA 4NZ5A 2VC9A 3P0XA 1MMFA 4FS9A 3ALFA 3R0KA 2ZX8A 3TTEA 2VC5A 2GSHA 2Y63A 1HL8A 3UVIA 3SADA 2OGYA 3HZ3A 4WKAA 5I09A 1K9TA 3LLDA 3AIWA 1IEVA 1V79A 2WVVB 4CCZA 4LVDA 4QLJA 4NJKA 2Z27A 3CV2A 3G1DA 2DZVA 4HTBA 3FVMA 4GC3A 4GIYA 3PUEA 1I9CB 3R1ZA 1NWRA 3A9BA 1TMLA 3CUZA 2PGRA 2RHGA 1S38A 5D04C 4HZ7A 3ZR4A 5D4YA 1Z89A 3A24A 4IICA 3LPGA 5AC7A 2E5BA 3TYCA 4DYJA 4ZFCA 2BGNE 3MC5A 4IQEA 1OF8A 4ENLA 1MW1A 2CZ5A 3CZLA 4DJED 1RK5A 1XG3A 3OB8A 4UOQA 3WLHA 4CQ9A 2WCAA 3HA1A 4C6CA 5ABTA 1FOBA 1I60A 1S5NA 3N12A 3V5CA 4OIFA 3ARZA 1ITCA 2Y89A 7REQB 2EG7A 3NYDA 1PKLA 3IVTA 4YVVA 5FSEC 1KLZA 2UY4A 3LZ5A 3NDYA 1XLAA 3RLGA 1GQLA 4MAVA 3WLRA 1UD2A 1WUEA 4QAWA 2PDNA 1RLDA 1CXFA 4LW7A 4Q33A 4WHBA 3DZ1A 4JKMA 3TONA 3AQUA 1HO4A 3V4BA 3CGTA 1EWEA 4IMAA 4JN8A 4QDPA 1H1ZA 1VRDA 3ATYA 1QMLA 6PTDA 3H2OA 3IJ9A 2R1MA 2ZZ3A 1U2YA 4GHRA 1Y5VA 5CPNA 3TAOA 5CPMA 4GGBA 4Z1AA 5F2MA 3MKCA 1UOKA 5AYZA 1DOSA 4MY8A 2Z7KA 1GONA 2OLHA 4EF9A 3VE7A 4ZQRA 3DFYA 3AMKA 5A6AA 1J93A 5I3FA 1QXLA 1UP2A 1JZ3A 2PZ0A 2HXUA 3BK0A 3NNTA 3ZLHA 2V67A 2WBGA 3SJNA 1H0GA 2XZ9A 4W89A 3AHYA 3UZXA 3BLDA 3UCDA 3ZSTA 3CTLA 4HSHA 3VGHA 4UNLA 4Q8UA 5A2AA 3VVGA 2VCCA 4GIEA 2BVTA 4ZQCA 3M47A 3B4UA 4MHBA 3AFBA 4ZO8A 2YJQA 2J9ZA 3W86A 3FYYA 4WOQA 3FKKA 4ATLA 2QCEA 1EIBA 3L0NA 4M5PA 3OO2A 4X9YA 4ZVJA 2QMJA 3OW1A 3EA2A 1Q6GA 1HKKA 2H8XA 2DH3A 4ADSA 3RX3A 4TTUA 4AISA 2E5DA 4BF5A 1XCXA 1IZKA 5HA7A 4DWSD 2G8ZA 3NYZA 4IXXA 4BR1A 5LIYX 2ASHA 1B90A 3F5LA 3R8RA 3UA3A 1WCGA 2FFIA 4UFIA 3GUGA 4LBUA 1UR2A 2WNZA 4F8XA 2DFAA 3TVAA 5DO8A 2ZUTA 4M82A 1MRQA 3LGEA 4IJRA 1ESWA 4PTNA 4C6PA 5CEWA 3GDMA 1JL8A 2QCDA 1KFJA 2X1RA 4EPKA 3M4HA 5KETA 4IQJA 1BD0A 1TA3B 5GVJA 2Z24A 3BMWA 4ADUA 1IWPA 3RMJA 1A5MC 1TE1A 2ISSA 1CW2A 4H9MA 1IV8A 2QMKA 4NZJA 2F7FA 4KPLA 1F4HA 3BQ6A 4X0VA 5JQ9A 4LAMA 3Q94A 1Z9AA 3EX1A 4Q4OA 3SBFA 2CU0A 4U5IA 2WOQA 5DBTA 1F3XA 1TO3A 1TPVA 2ALDA 3OVPA 1S2CA 3L21A 1JZ4A 1S5MA 1XS2A 4UQAA 5MKGA 5FEXA 4LQ1A 1DJHA 3W6LA 3N6JA 4YWIA 3W75A 1XKYA 2ZZ4A 1DE6A 4O17A 3M7WA 1C90A 2VI0A 4H9YA 4DI8A 2DIEA 5HR7A 2UY2A 2E8ZA 4FXFA 4ZODA 3A4JA 1F2JA 2MNRA 3R8GA 1YMYA 4B4HA 3S1UA 1BQCA 3WF0A 1XLBA 2V0TA 1Z6KA 4AYGA 1WAUA 3NVTA 4WDUA 3MANA 4KGJA 4FAMA 5HOSA 4DWSC 4IPIA 1XFBA 3RHGA 1VCGA 1JI1A 2A6LA 5FI8A 5FOOA 3W1PA 3NQGA 3ZOAA 1H7WA 4O0QA 3ZJ7A 2IMRA 3KRUA 2D73A 1P6BA 3IK2A 3L12A 2ZRZA 1C3FA 2GGEA 4U5KA 2AOSA 5C2CA 4NUWA 3T7VA 2OEMA 3SUSA 4IPJA 3AMCA 4CQAA 3T08A 2NQ9A 3VZXA 3WYZA 3Q67A 2G95A 3N25A 4CD5A 4QITA 1Q8JA 1AW2A 3UW6A 1WP6A 3O15A 4JFTA 1S1PA 3I10A 3EAUA 4X9SA 5GNZA 1WZKA 4JBRA 1K7FA 4I5RA 3BLIA 4EOUA 5K3VA 1K3UA 1TRDA 3TTYA 2VEIA 2BZNA 1YE6A 3C0SA 3ITLA 4F0RA 1L8NA 1HJXA 5XIMA 1C9DA 2XZ7A 4IPPA 3T40A 2DSUA 1AZ2A 5HBFA 4XZIA 3R11A 1RVKA 1V0NA 4NI8A 2HTMA 1XIFA 7XIMA 3L4YA 1QK0A 2VZOA 1A3WA 1S3HA 4PCPA 3DESA 1PIIA 3PJUA 1DIOA 4CU8A 4O1EA 5EMYA 1EP2A 4XZMX 3MI3A 2OO6A 3DEQA 5AVNA 3NL2A 3GNRA 4AIUA 2SFPA 3PBMA 3M7SA 3PR2A 1QR7A 4MKVA 4AC7C 3PZQA 3TXZA 2B31A 4OE7A 1C8QA 3MWAA 4LCQA 4X63A 1EGMA 2VDIA 3H4WA 4QG6A 1K4GA 1TVNA 2GYIA 2PP3A 1JDCA 4G5DA 3E3HA 2NSOA 4JQ2A 3P14A 3QLDA 3CAWA 1XV8A 3CEUA 3LSCA 2D2GA 1VJZA 4NAEA 4TX6A 4H9ZA 4DY1A 2QF7A 3FCPA 1QPRA 1J6OA 1A5BA 4FLQA 4Y2WA 3VYLA 4I90A 3SZ8A 1O5KA 5ENLA 1E55A 3PPCA 4PUEA 1VEMA 3E49A 1EC7A 1UC5A 2PWFA 4H41A 1TWWA 1ZAIA 2NV9A 1KCKA 1JG9A 1F61A 3ZVHA 4RK8A 3OYXA 1HP4A 1H7NA 4Q7BA 2I9UA 1T40A 2NXGA 5CPSA 1NP2A 3T4CA 3QKEA 1UH2A 3M0JA 5H8UA 3PB2A 1BYAA 2V5LA 4JIEA 2ZRVA 1AUSL 2X40A 2IXVA 3TP4A 1UROA 2A3HA 3CWHA 1KTCA 6ENLA 3KHDA 1TWSA 5D2VA 3NIYA 1UR0A 3O8AA 4JKLA 4WJEA 4A3RA 3EPOA 2J8TA 2PUZA 1LLWA 4U31A 4GCXA 4CU6A 1YE4A 1SU5A 1EXBA 4EACA 1XIEA 1JIBA 1M01A 3W1QA 2NT0A 3P81A 4D8AA 1H7RA 4XZLX 3WK1A 2X1UA 3F5KA 5I07A 3H53A 3APTA 4NT0A 3GR8A 1V03A 3M44A 4G2DA 3VX1A 4W7UA 2C14A 1GYNA 3H26A 3S2NA 3BV7A 3PC0A 5EL1A 3MW7A 1S2AA 3LCHA 2FZMA 4YVPA 4XAZA 4E6MA 1EBGA 5TD4A 4KQNA 4LF2A 3F1QA 3HGSA 1BWKA 3L4XA 3CS2A 3WFLA 1VD6A 1KQZA 1JCXA 3SQSA 4G1KA 1KFLA 1XDJA 1RCXB 2NW0A 4Y96A 1F3EA 2P0OA 5JH1A 4B5WA 3GHUA 1J18A 2XUCA 3WQGA 4KEVA 3VNZA 3LYEA 2DIKA 3C2EA 3ES8A 1B1YA 3MSGA 3CYJA 4Q8TA 3CK5A 4IIDA 3V5OA 4D6CA 2HE8A 3M0HA 2Y8KA 3S47A 3PJWA 1H51A 1JRCA 1C29A 4Q32A 2RJGA 3QR1A 2ZQ0A 4QISA 2FVMA 4GK8A 5BWAA 3TCSA 4AQLA 3NTYA 2Y62A 4Q8PA 4HHPA 3EX6A 3TN5A 1DWHM 4LTSA 1GJUA 3IEBA 3GFYA 1H7OA 4LV9A 1W0MA 2P1FA 1JJKA 5BMXA 4U10A 2MUCA 1UWQA 3WBEA 2VFHA 1OSEA 2XN2A 2ATMA 2H6RA 3MA8A 1VEOA 3FA5A 3QR3A 1EKOA 2QDHA 3SY8A 4M1RA 3FA4A 1OIFA 1JPMA 4IIFA 1A49A 4JCLA 1TTJA 1EC8A 4F0KA 5G1YA 4JY9A 1OX5A 1HNYA 4LANA 4HPJA 3DG6A 4Q8MA 5FF2A 1T5AA 1CXIA 2YFNA 2WC4A 3ZS4A 4YYFA 3EWUA 3WEZA 4JHMA 2Y8UA 3CPUA 3EEGA 4L65A 4GY0A 2FQIA 5D30A 5FJTA 3CQKA 2C1IA 4IHCA 3D3FA 4YWSA 3RUBL 1AH0A 2G5WA 1FY6A 4LS0A 1VYSX 1UKPA 1DQUA 4TU1A 3W1TA 2FDSA 5AOUA 3GW3A 1CI1A 1EPVA 2FJUB 3U2CA 1XH0A 2GJPA 2QIWA 4IJBA 2A3LA 4X2PA 2WMIA 1VIZA 2WZHA 5TQLA 3UBPC 1Q3NA 4JX4A 3GDTA 3MVIA 1JEZA 1HGWA 4R27A 1Q6FA 3GXTA 4MY1A 2WM1A 4OVXA 4Y9MA 3W7RA 5LA2A 3WQEA 5AHIA 4WF7A 1D3GA 2VEGA 3C2YA 3GXIA 4A6GA 1JUKA 4BQ3A 1JD7A 3QLLA 2TYSA 2I9EA 2PLCA 1RBAA 4L4LA 3R25A 3W76A 1H60A 4B4FA 3VC5A 2ZICA 1Q4WA 3SSZA 5FJPA 2CYGA 4DQWA 2IQDA 1W56A 4JIRA 4PMDA 4B90A 3S2MA 4MWAE 4JTGA 2EPKX 3MY9A 2R24A 3UZWA 3VZZA 4PB5A 3S83A 5FSDC 3MV01 3KOXA 4FNSA 4UZSA 4JIHA 4S2CA 4DXKA 1GWJA 3QMSA 2PLKA 1SUXA 1W3LA 5HAOA 1ZP4A 1LOQA 4XV0A 3S5YA 3VGEA 4GFIA 1NDZA 1OIMA 1LWIA 2BFGA 5DFAA 2OSYA 3ZYZA 4I5XA 3LRKA 2O7SA 1JF6A 3MDWA 1DWAM 1HP5A 3W1NA 3QQWA 2PWGA 1EYWA 3PZMA 3VA8A 2VJXA 3L4VA 1EA0A 2Z1KA 2OWXA 2Y7DA 4ZENA 5I00A 2ISVA 2Q71A 1I75A 2AGTA 4XAFA 1AFSA 4MNJA 2X05A 2PDBA 4M51A 3RDKA 2PDHA 1MZRA 6REQB 4CNSA 3EOLA 3KVJA 2ZZ1A 5D03A 5AZ0A 1FXPA 2ZIDA 4LFYA 3XIMA 5I3GA 2C71A 4AZIA 1LJYA 4XG1A 3RXZA 1UZ1A 4H7CA 3NSXA 3UJ2A 1DXIA 1NOFA 4M8UA 4DUWA 3VD7A 3AJ7A 4AU0A 1Q7ZA 1VFUA 5LA1A 1LWHA 3CZGA 1UWSA 3WO8A 4IPLA 2REQB 4P7OA 2W61A 3CU2A 2BMBA 5DLCA 3RMEA 4C90A 1KM1A 3BANA 1WOBA 4ZB2A 3S2CA 1DWIM 5DCDA 2Y4SA 4DWSB 1FKXA 1IXNA 2BOEX 4GFSA 3QFEA 5EYWA 3GG7A 4PUJA 1ITXA 1AW1A 1IXOA 1A3XA 1LBFA 3I6TA 1EHAA 4UTIA 4PSPA 3U2EA 1FWGC 5AHNA 5J8LA 1J96A 5EKYA 1EL3A 3VABA 1RBOB 1UIOA 7ENLA 2GJXA 1XXXA 1N55A 4NY2A 3KFTA 2F61A 1BXBA 3TSBA 2CC0A 4TV5A 1VH7A 4HJWA 2C7FA 3POCA 2GSJA 1EIXA 3INPA 5G1TA 3TKFA 3I3EA 3VKCA 2W79A 3QM3A 1PCWA 5KZMA 1EX5A 1TQJA 2FZ8A 3MYPA 2WO5A 3S5OA 5L9FA 1U1UA 1THFD 3MP3A 4IM4A 3E0FA 1QPKA 2QXWA 5D8WA 4B9ZA 3S6DA 5CQ1A 3S9YA 2CXEA 2E6AA 4NNBA 2ESCA 3W82A 1TPFA 1QU4A 3GIQA 1S2TA 3S3GA 1SFSA 4HNOA 2UV8G 1L8PA 4E8GA 3W7JA 3AMGA 2DW7A 2OSWA 3IUHA 1E3XA 2HV5A 3NZ1A 3B9NA 4MY9A 5AC8A 2DSVA 2OGJA 3UETA 4K2SA 1RP8A 1G9HA 4YLWA 3LGDA 3O2LA 3WLTA 1FWCC 1BYDA 4DWSA 3BCDA 1AD1A 4DRSA 1CGXA 4ALDA 3N34A 1FH8A 3SDOA 2ABAA 3UZZA 3QPEA 5IFPA 5M1TA 1TWZA 2UY5A 3WD4A 1UD4A 3KW3A 1QPQA 4LF1A 5FEPA 3JRKA 2E09A 1ZFJA 3N2TA 4KMQA 3H2NA 4GQ0A 2WZIA 4GYPA 5ABHA 1TPDA 1UUQA 3KRZA 4GC4A 1LDCA 3O63A 1GEHA 1VZWA 3PG9A 3IGXA 1BWVA 4LAKA 1MEHA 1E5JA 2WKJA 3R58A 3U48A 1BKHA 1DJXA 2DZSA 3MSRA 1JYWA 1LLZA 4B5XA 4G6CA 3EKGA 4IMDA 1R46A 1EX1A 1RH9A 4R88A 2DH2A 4RNIA 4QEEA 2Y85A 1DJQA 2FVKA 2QUMA 4D6GA 5A3HA 2Z28A 1OCNA 1LG1A 3U4AA 4IPNB 2PDMA 1BPLB 3TIMA 4LEQA 3WBYA 4PSRA 4QR6A 5B7ZA 3S2JA 1UW9A 4QCFA 3WMCA 1JPIA 2FTPA 1WQ5A 3DHPA 6A3HA 4F2UA 2YKKA 3GLCA 3V7PA 5A6JA 4GXWA 4AZ7A 3NDZA 2PDCA 4O52A 3WELA 4X61A 5FF7A 4AZ6A 5G2IA 1D7KA 5I78A 3WF4A 4RPPA 4R7JA 4DJEA 5EFDA 2XIQA 4OBSA 4V1YA 4HKPA 3W1MA 3QV9A 4US5D 1ADDA 4MF4A 3KL5A 3UPWA 4J3SA 4A3YA 2F9RA 3XISA 1DXFA 1E1CA 5F7UA 3URBA 1ZLPA 2EQDA 1HW6A 4CNUA 2FMOA 3RCNA 1ICSA 3TLLA 1TJRA 3VIMA 3LLFA 9CGTA 1POJA 4MWAB 5CJNA 1VENA 2WQPA 1XFCA 2A6NA 1GOOA 2DZUA 2XINA 5DANA 4QFUA 1GOXA 4M80A 3BAWA 4BF7A 1V3LA 1WXZA 1IEXA 3L2IA 4F48A 2KX9A 1E1FA 4C6NA 2NQZA 2WNNA 1XPYA 2AQOA 4DNMA 3MMTA 3H7UA 3RIKA 4WVXA 4H8HA 4LYPA 4HU4A 1GZ1A 3H2AA 1WBJA 4QBXA 2YCKX 1XYMA 4N9DA 2VGGA 3RGTA 4M56A 1JPKA 2PCQA 2FHFA 4MUZA 3TW9A 4N42A 3B06A 4PMNA 4DBDA 2G3FA 1ZUAX 3HG2A 3PPGA 3W0KA 3C6CA 1XD0A 2PMQA 1IR1A 1GCYA 2Y7EA 2JK2A 4H4IA 2PTDA 2J62A 5AZ1A 1DHPA 5CZKA 5I3KA 3PTKA 3VFCA 2EG8A 1D9EA 4WGHA 1DWGM 3UYCA 3AU6A 3CPRA 4D72A 1WDQA 3CV1A 1Z3NA 1ISWA 4KEUA 3QZAA 4K68A 1QHZA 3BSGA 3K2GA 2J6VA 5C55A 3TYUA 3U6WA 4LYKA 3MMDA 4DBEA 3RG6A 3I6EA 4M7TA 2XIBA 4G7EA 3LXCA 5AYYA 4UR8A 1G1YA 1EQCA 2P8BA 3MMWA 1O4UA 3UCQA 2VFDA 6ALDA 1CDGA 3WLNA 3STFA 5DT5A 1IHIA 1AJ2A 4S3CA 2QVNA 5LIUX 3CZKA 2J8FA 2WKLA 2D24A 3LQGA 1B3VA 5AHLA 1GPFA 1BVZA 5IHRA 3OZOA 2OZ0A 2GOUA 2FB3A 1IYXA 4WLCA 1F6YA 4OWGA 3EKLA 2CWXA 5HNNA 1R3TA 4O28A 5E70A 5JH2A 4OECA 1M7OA 1XINA 2EO7A 1MDRA 2VDGA 5D2WA 3DUGA 4LV4A 4HN4A 2HRWA 3GG1A 4O50A 4XKMA 4J2MA 3PZ9A 3RM4A 3W2UA 3IJIA 4WY0F 4GI4A 4LGXA 2GGGA 4K6AA 4Q4MA 1FWRA 3BW2A 4HMDA 1E0XA 3OHMB 1EJVC 2A21A 4NXSA 3W73A 1ODZA 1UKSA 1DXEA 2CLKA