2ZZ5A

Orotidine monophosphate deacarboxylase d70a/k72a double mutant from m. thermoautotrophicum complexed with 6- cyano-ump
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
213
structure length
213
Chain Sequence
MDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAFAVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 82
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz5A00
1LBFA 4XZ9A 4JTFA 4M6PA 1FY6A 1ZY9A 5LKYA 3S5YA 1TJPA 5D2XA 1VH7A 5C54A 2X2GA 1OFAA 3OIXA 3QF0A 3E12A 1IXPA 4LT9A 3HB9A 1TV7A 3A9IA 3NQ7A 5LNVA 5LSMA 3P8IA 1KFKA 4FX8A 4EWND 3LBCA 4M7SA 5HWJA 1SU5A 1VYRA 5DCEA 3CIXA 2HSAA 1TPVA 5I3HA 1M5WA 1W8SA 3W88A 3MYPA 4CNPA 3W72A 4MZ1A 2E68A 2OZ0A 5K9DA 3W23A 1YTKA 4MLRA 2CZEA 1KTCA 4P2VA 1TPDA 5KSWA 4JX4A 7TIMA 4IPIA 4JYFA 3H54A 3PB2A 1SZEA 1HTIA 3BG9A 4LS1A 4UTHA 2ZZ6A 1ME9A 3QC3A 4WX2A 2JKAA 2W6RA 2FLIA 1C29A 2Q8ZA 5K4ZA 4FB7A 3HG2A 2E6DA 3CIWA 2XN2A 2V8ZA 1KM5A 1DBTA 1FXPA 4GUHA 3W76A 1VLWA 5AOUA 5HMSA 1TV5A 2Y88A 1GG1A 3PB0A 1DKWA 3QQ0A 4X2RA 3IIXA 3IGUA 1FCUA 4Q4KA 4TIMA 4HNUA 2V30A 4ADSA 3LHWA 3W7MA 1ADOA 3NQ6A 3PS7A 2JK2A 3LCFA 1KFCA 4CQAA 4O12A 1HO1A 1PV8A 3PUEA 4K8HA 2GJNA 3VE9A 1GVQA 4QAIA 1MXSA 3MI2A 1AW1A 1TTIA 1GZGA 3NA8A 3IIPA 1QPQA 2TPSA 3GXTA 3M5XA 4LUIA 1BTMA 4NJHA 1JUKA 5I3IA 5HR6A 3F1QA 1WOBA 3QMRA 1MEIA 2RDTA 5U7SA 1F7BA 2O7QA 3G24A 5HJLA 1R47A 2V2CA 5EL1A 4N9CA 2JBMA 2EHHA 3V1PA 2J6XA 1DQWA 3OVQA 3SY5A 3LCIA 4Q32A 4Q33A 3KVJA 3W2LA 1X6UA 3LB0A 4N6FA 3L67A 5J5RA 3A5VA 3DU0A 1YADA 4S2BA 3GDKA 3MW7A 4GUJA 3UNDA 1UJPA 3EWWA 3QSRA 3ANYA 3FFSA 2IQTA 1BWKA 4HN4A 5F2MA 3SFKA 3E0IA 2G96A 2E6AA 1CX9A 2JGQA 2ZZ4A 3NXFA 3EKZA 3MP4A 3VKJA 3CM4A 1AW5A 2DZPA 1B4KA 2AQWA 4X22A 2C3ZA 2NX1A 4HNVA 1FXQA 2I9EA 1L9WA 1VCGA 4XTDA 1ZFJA 4HHPA 4ZQNA 2BX7A 1A5AA 3LHVA 3DH7A 1H63A 1I2OA 3O6DA 3VE7A 2H3BA 4EIVA 5FI8A 1UUMA 4JR5A 1GG0A 1I8JA 1OX6A 4YXGA 3HPXA 3DKJA 1DJQA 4IMDA 5AHLA 4YCOA 1ZAHA 3M41A 3M16A 2QAPA 3TA6A 3E02A 4UFJA 4Y96A 3KRZA 4JEQA 2NUWA 4OGZA 3VFLA 3FA5A 1LLZA 1TTQA 1GVRA 3R13A 4WXYA 1TYGA 4GNJA 2OCZA 2GQ9A 3STCA 3LRLA 3THAA 1SPQA 4O11A 3BG5A 3CTLA 1RR2A 3S1UA 4TMBA 5TBOA 1HL2A 3AO0A 3G8EA 1LRQA 5C55A 4H3DA 1TIMA 3W1PA 3RLVA 4FNRA 3M6YA 1H1YA 5LGZA 1KM6A 1I2NA 1NSJA 4K38A 1X1ZA 3LI1A 3TW6A 3W1QA 4JTKA 2GUUA 4PFMA 5BMWA 1O95A 1AK5A 3LCXA 3W74A 4MJZA 4YMZA 1NF0A 3G1VA 5AC7A 5EY5A 1K8ZA 3NPUA 4FO4A 3DFPA 2CLEA 3LTYA 1PCKA 2Y62A 3LXCA 4AH7A 3M9YA 1O5XA 4NX0A 2A0NA 3NYZA 3F4NA 3NQGA 2NV2A 1DV7A 2ISVA 1AL7A 3NVTA 1XCFA 4LS0A 4QISA 3VI2A 1VGAA 2E5BA 3LBMA 1UBSA 1W0MA 2C0AA 4K36A 3GR7A 3TCEA 2VFDA 4OWGA 1OF8A 1P4CA 4O8RA 4RV8A 1ICPA 4IX2A 2YYUA 4RZ4A 2PC4A 2DZXA 3STGA 4PL1A 2ZRXA 4BI7A 3BW2A 2E5DA 3TAKA 1QAPA 3U8GA 3ZR4A 4O10A 3G0SA 2CZ5A 2DU2A 4O50A 3INPA 2QF7A 4NUWA 1TTPA 3GK0A 2CFFA 3TMLA 3HGRA 4WUIA 3DGRA 3W1AA 1H7RA 3KRSA 1H1ZA 1NVMA 1EA0A 3PBYA 4ADUA 4EF9A 4AAJA 3NL3A 3GIYA 1DOSA 1J5TA 1OX5A 1EP1A 3P60A 1K03A 2A7NA 3P74A 3LCHA 3W7QA 5G4WA 2Z6JA 3N3MA 3IRDA 4N9DA 1KM4A 3L0KA 2FQIA 3DKLA 3CQ0A 4HPJA 4O18A 1TRIA 1A5BA 2RFGA 1LOQA 5EPDA 2X1SA 4Z1DA 3O06A 4HKPA 1WQ5A 3LV5A 3TQVA 1KFEA 4BK9A 1H50A 4GJ1A 8TIMA 3ZWSA 1VS1A 1P1XA 2CLIA 1XUUA 4ZQOA 2CLFA 2VKZG 1G7VA 3QMTA 2Q3RA 2F84A 3PUOA 1F73A 3N14A 1FDZA 5T26A 1S5WA 5D38A 4RZ5A 1ZENA 4IXHA 3BARA 1X7FA 1KM2A 3M43A 1SQ7A 3LCWA 3HG4A 3W7EA 4UC5A 1V7YA 3UY7A 5FEZA 3W9ZA 5AHIA 3O6YX 3OHIA 1XC4A 3IVUA 5L6UA 5G1YA 5CZSA 4IUOA 3S0CA 4LC8A 3W73A 1FWRA 4DELA 1IIGA 3ZFHA 3DHFA 4CCCA 1JCNA 1G69A 3W1RA 3TUUA 3NNTA 4JTHA 4OU1A 5TIMA 4XBSA 2HTMA 2PURA 1K3UA 1KFBA 4M19A 2NZLA 4NJJA 4WXZA 1MEHA 2FB2A 3C2FA 1GVFA 2WQPA 4O15A 5A8GA 1WV2A 1Q45A 4EF8A 1BKSA 1OFRA 3MJYA 3W7HA 4Z08A 2YR1A 4K7YA 3C2EA 5BNKA 4BI5A 3AJXA 4NJGA 2OT1A 4LY8A 1H62A 3FKRA 3C2RA 4O1BA 2ZTKA 1N55A 5D09A 3TJXA 1OJXA 2TRSA 4A29A 3EWZA 1ZAIA 3P81A 3SR7A 1LP6A 5G1TA 4BWLA 3WJXA 2C19A 5FF2A 1DHPA 2CWNA 1FCQA 1GTEA 1H61A 3HJZA 3PF3A 3L2IA 3MP3A 4MPQA 3TKFA 1FX6A 4DXVA 1EWEA 2DZVA 4UCGA 5D2WA 1GTHA 3BV4A 4DQWA 2V2HA 4DBEA 2A2IA 2FB3A 1K8YA 4UFMA 3C4UA 4OE7A 3OA3A 3DZ1A 2H3DA 1SZFA 2NV1A 1OFBA 1I4NA 1WAUA 1I2RA 1Z44A 4NT0A 1RPXA 1W37A 1TCDA 4RXFA 4NZFA 2HMCA 5AN7A 1DVJA 3Q94A 5KZMA 1T0OA 3LHZA 3NAVA 1PE1A 3LXAA 4HPXA 4A2SA 3C2OA 3WFAA 3EX6A 1RD5A 1F74A 4KFOA 1H7XA 1TMHA 1O94A 3USBA 4UMBA 1KFJA 4RCXA 5F4WA 1VPXA 1PS9A 5FEPA 2P1FA 3B03A 5BOOA 4QITA 2VFHA 1AW2A 3CHVA 4CLMA 4NNBA 2V82A 2YYTA 3LLDA 2QCCA 3UPBA 4LOCA 4FHAA 5G5IA 4PL2A 4ZQRA 3OBKA 4OBTA 1LOLA 2AGKA 3CWOX 5C5YA 1EPXA 2VXNA 1ICQA 2ZRUA 3BGGA 3SW6A 3B4UA 4Z0SA 1XDMA 5DY3A 1M6JA 1TSIA 1H7NA 2DZSA 3GVGA 3QW4B 3S1WA 3BW3A 4MZYA 4O53A 3B05A 1GQNA 1H60A 2WSRA 5KZDA 3UZ5A 4QJ1A 1TO3A 2I14A 1M7OA 1JUEA 2NUYA 2G5WA 1S5TA 3NM1A 2ZRYA 1FBAA 4M6VA 3LX9A 1TPEA 2YCEA 2WSYA 1PHWA 1JJKA 1W54A 1EP3A 2RDUA 4ORIA 3HO8A 4K7VA 4W9TA 4XTIA 4AF0B 4AEOA 1LRNA 2C16A 4TX9A 3N2XA 2CZFA 4MOZA 3TXVA 2KZHA 3G0XA 4DEFA 3PC0A 5AHMA 3WK0A 2QDHA 2ZDRA 2PCQA 2Y7EA 3DENA 4H6KA 5K7JA 5IBXC 1B57A 1MZHA 2R8WA 2NLIA 2Y89A 3W7DA 3KVMA 3K30A 3TC7A 4O19A 5CG7A 5AYYA 3CPRA 4JIQA 3IIOA 3G1DA 2A85A 3HG5A 4Y8FA 4Z0JA 1N8FA 3I7SA 3W1MA 4NXKA 4HSNA 1DJNA 3CWNA 1RQEA 1RV8A 1G4SA 3R5EA 3BLIA 2H90A 3BGJA 1DORA 2I1OA 2X16A 2ISSA 4JTTA 4UFHA 3MHGA 1OYBA 2FDSA 1YPIA 3RU6A 1GEQA 1S5VA 3VNDA 4A3UA 3TR2A 3W70A 3QZEA 4LS2A 1QPOA 1KV8A 3C56A 1YPFA 1OK6A 2VFFA 2WSQA 3P5YA 3DAQA 1TPFA 4O1CA 5LHFA 3CEPA 3NG3A 3WJWA 1W3TA 3L0GA 3P62A 1HUVA 1EUAA 4QM1A 1GVOA 4CQ9A 3ABRA 3W75A 1Y0EA 1EEPA 4IJBA 2E77A 5I3FA 1PL9A 3H53A 4NVTA 1JCXA 4JYDA 5C6MA 4O52A 2QCFA 2G95A 1QO5A 3HMJG 4RX0A 5L9FA 5FF3A 3GAYA 3QSTA 4WY0A 3G18A 1O4UA 3W7IA 2WNNA 4JX5A 5FEWA 4R53A 3NQFA 4AMAA 3FJLA 1W3NA 3HOJA 1SSDA 3W1TA 4AWSA 1O60A 5LNUA 1F2JA 2A21A 3W83A 3EWXA 4R33A 2V9DA 2X30A 2DZWA 4A21A 4NNCA 2ALDA 2QCDA 1JRBA 4GUIA 2OT0A 3NZRA 1TJRA 3IGXA 3HPSA 2C6QA 3Q2DA 3FOKA 3T44A 1UASA 2YPIA 1LORA 1MO0A 3LRMA 4N02A 4PH6A 1SZNA 1TV8A 5HINA 3NQ2A 3W71A 1GPWA 1LBMA 1TREA 4TU1A 3HPZA 1GT8A 3JR2A 4IGHA 1I45A 3NQCA 4POCA 2WNQA 4NQ1A 3LI0A 4Z1CA 5I3JA 3T40A 3NZ1A 2QAFA 1A5SA 2R91A 4OV9A 3GKFA 3GZ3A 2Y7GA 2ZZ7A 3DXIA 2QDGA 3TSMA 2XFWA 2GQ8A 3W7PA 2ATMA 1SZGA 4KWWA 4AXKA 4X3ZA 4ZQCA 3SGZA 3W2UA 4UTWC 2W0UA 2X1TA 4ZL1A 2E1DA 1LBLA 2C13A 5C2XA 4O54A 3L9CA 4GXMA 1ALDA 1QPRA 1W31A 3RLUA 3KOFA 1R2TA 3PAJA 1EWDA 2CLHA 3MHUA 3EWBX 1UUOA 3TV8A 1JQXA 4WY0B 5U4NA 3M5ZA 3GXNA 3UWUA 4CQ8A 2V0TA 1EUNA 4HNNA 1A50A 1YLVA 3NEVA 3NL5A 4IWWA 2GVLA 4FX7A 5AHEA 2J88A 3RK8A 2QCDB 3TFCA 1KA9F 3EXRA 3C0JA 4AHOA 2ZFAA 3S5ZA 3S5OA 2NX9A 4MKNA 1JVNA 3EWYA 2NWSA 3EEGA 5CPMA 1WBJA 2DP3A 4XQ6A 1Q6LA 1IIHA 3MYOA 3LCLA 3LHYA 3ABOA 3SZ8A 3LLFA 4ML9A 1ZJIA 3M7WA 3O05A 2GOUA 4MUZA 1V5XA 1LYXA 2Y7DA 2J27A 1WBHA 5LNRA 1D3HA 3V75A 5CSSA 3W2NA 1H7PA 4NXSA 4PEKA 3CC1A 2JKPA 4N4QA 4XUGA 3FYPA 4UTLA 3SJ3A 2TSYA 1OFDA 4JTJA 3W7LA 1G67A 4HIBA 3T4CA 1U83A 4GFSA 2GPTA 1TQXA 2JKEA 2WV8A 1VYSX 3B0VC 4GWEA 3P84A 5SWUA 3P5ZA 2ZTJA 3GAKA 1M7PA 3MO7A 4UTUA 3UYCA 1YYAA 2J9XA 3L5LA 4UFIA 3WJYA 5G4EA 1OFOA 1TQJA 2V81A 1H5YA 1VYPX 4IMFA 2BSLA 3GNDA 1TTJA 3QW3A 3O1NA 4FEZA 4JGDA 4NJKA 3W2JA 3WK3A 3EX4A 3HGJA 2E5CA 3LHTA 4Z1BA 5HR7A 2X1RA 5K4XA 2FTPA 2QJIA 1MEWA 2BXVA 4GC4A 2RHGA 3W7RA 2WJZA 4O4VA 5MHBA 1A53A 2BZNA 3N9SA 1VZWA 3O63A 4RR4A 3W1XA 3DBPA 1ICSA 4IMEA 1W56A 2VOMA 3UD6A 1XUZA 3FKKA 4YWIA 3W84A 3I68A 2QUVA 2DZTA 5DBUA 2C1HA 2DJLA 4K8EA 1H51A 5G2HA 3NM3A 4E38A 2PRLA 2VEKA 2A1YA 3BW4A 4BF9A 4Z1AA 3F03K 3P80A 5DN1A 3UXDA 1GOXA 1RVGA 3GDTA 3L5AA 5K9CA 1W5QA 3IIZA 4JXCA 2EKCA 1JCYA 5HWMA 4MFDA 3HBLA 3HG3A 3TFXA 1EB3A 2ISWA 3BO9A 5EBUA 2VC6A 3KRUA 3PSVA 3NOEA 2QCLA 2CW6A 1LDCA 1PIIA 4O4WA 1FQ0A 3NPWA 4DO5A 1ML1A 1FWSA 3WJSA 2CU0A 2X1UA 2XN0A 5F2LA 4WZHA 2G97A 2QCEA 3G0UA 2FPVA 1DQXA 3N9RA 4ZVJA 1WXJA 2ZBTA 2BLEA 1OX4A 2A6NA 1OYCA 3N2MA 4I9AA 3A22A 4UFLA 3SI9A 2NWRA 3R89A 1AL8A 4O13A 5G2IA 3NQ8A 4JTIA 4MLJA 2ZA3A 2LLEA 4UTIA 2QR6A 2B7NA 4LVBA 4S2CA 1LROA 2PE4A 1ME7A 3M1ZA 4A2RA 3PBVA 2VEIA 3C61A 3UY8A 1X1OA 1VHCA 3EB2A 2WOQA 3C2VA 3PSWA 4DO6A 2ABAA 1K02A 1QOPA 3FS2A 1TPUA 4GBUA 3MP5A 3TXZA 3RNDA 1F05A 4AHQA 3P61A 1T8XA 1W1ZA 3KVLA 5K9XA 4LVAA 1XM3A 1VC4A 3ZS4A 1WOAA 5AFDA 1HO4A 2YX0A 4XWUA 1OF6A 2PRMA 2Y63A 2NXHA 4QNWA 4LNYA 3TC6A 3LXBA 1PCWA 1E51A 4X9SA 2QJGA 1VR6A 1VLIA 2Y70A 1J2WA 1VHNA 1NF7A 4O28A 2YZRA 4JTLA 1ZHAA 3QH2A 3MI3A 2VEMA 3O07A 5AYZA 3NDOA 3W2MA 3W7NA 1D3GA 1SO4A 1L6WA 4JDYA 4CNOA 1K7XA 1CI1A 1YTEA 4RZ6A 1FDJA 1D9EA 1QO2A 3HGOA 1Z41A 3TJLA 3UWQA 1AG1O 4K39A 3N19B 4OV4A 5F2GA 4FXRA 1VCVA 2VENA 1F76A 4I7WA 5DCDA 1OHLA 4JTGA 3SSJA 4IX0A 3N34A 3NPXA 2ZYFA 4KFNA 1KM0A 4ZQMA 2ZCGA 3QEZA 4NU7A 1N7KA 2OMAA 3CU2A 4WD0A 5A5WA 3T78A 4CCEA 2WO5A 5AB3A 1MSSA 2EAWA 3G1AA 4MVAA 4PODA 4UTMA 3YPIA 2QUTA 5KMYA 2Z1BA 1W3IA 3HF3A 2TMDA 3NQVA 3B06A 3TW7A 1LM1A 1WYIA 3DFTA 3QFEA 4UR7A 2ZA2A 5DY2A 4TR9A 3STFA 3TNOA 5CZJA 3OEXA 3I7QA 3U6WA 1KV5A 2P10A 5F1VA 2O7SA 4DF2A 5GVJA 5EMUA 4UTKA 4CNNA 4AWTA 3EXSA 3NQEA 5HUPA 4RXGA 3W3OA 2CLLA 3T7VA 1GYNA 4UMCA 1YXCA 3S8HA 4RJEA 3NL2A 4D2JA 4O0KA 2B7OA 2ZQ0A 1Z48A 3C52A 1W5OA 4U28A 4JDBA 4Y6GA 4R7JA 1KFLA 2JGYA 1SO5A 5IBXA 2QEZA 3TDFA 3UWYA 3G22A 1XBYA 4M6QA 4AB4A 3PVFA 3TMQA 3WK2A 4UTTA 1LRTA 3G1XA 5HQEA 2HS8A 1P0KA 4K6AA 3PWAA 2VFIA 2NXGA 4ZQPA 4UNKA 1QOQA 1XBXA 3N73A 5D30A 4JY9A 2FPYA 4MZ8A 5CKSA 3M0ZA 4NJIA 2YW3A 3G3MA 3A23A 4C1KA 4MY9A 3PR2A 4JY8A 4LRTA 4DO4A 4R34A 2A7PA 3W6YA 1G7UA 4UTTC 5H91A 5D33A 3BVJA 4MFEA 1ME8A 4ICNA 5FF7A 2CZDA 5EA9A 3W7GA 4DPPA 4U4MA 2OX1A 3MMTA 3VCRA 5IM51 5KTLA 5LGXA 2TYSA 1F6KA 1QNVA 3TIMA 2GVGA 3KAOA 2CLOA 1C9DA 1ZCOA 3GYEA 2CLKA 2Y61A 3RFAA 1R2SA 5K3VA 4JNMA 3IEBA 1XBVA 5HNRA 2R14A 2YFNA 2Y7FA 3P82A 3W7CA 2A4AA 5D03A 1JRCA 4I7VA 3EX3A 3B0UX 1AMKA 3L68A 1FWNA 2WPBA 1KM1A 1YDOA 3EKLA 3W7OA 1KTNA 4TO8A 5AC6A 3QQ1A 3O8AA 1JR1A 4JICA 4E0CA 1FWTA 5DBTA 4O57A 3E9AA 5AYXA 3BLFA 6TIMA 1WX0A 5FESA 3GKAA 3F4WA 2VELA 5HUOA 1IGSA 3M44A 5F4XA 3QRHA 1GWJA 1HFBA 3A21A 4N2YA 3UWZA 1QDSA 1XI3A 1TPB1 3L65A 1UB3A 4FNQA 4LTSA 5CPNA 2RKXA 3SIZA 4UIOA 1Q6OA 2Q8LA 1L6YA 2H6RA 4QIUA 4MY1A 1G6CA 3D0CA 2E09A 2A7RA 4ADTA 3QJAA 4ONVA 1K8XA 3EX2A 1R46A 4RKAA 1FCVA 1R30A 1IXOA 3W07A 4E2DA 3M5VA 2NUXA 2R94A 1SO6A 3NPVA 4FF7A 1Q6RA 1EX5A 3PG8A 1TB3A 3QYQA 4WQ6A 1SW3A 4UTWA 2NXIA 2FPTA 4LU0A 2FIQA 3BK0A 3GDMA 4QQ3A 4YL2A 3PUDA 4FXSA 4Y90A 5I3GA 4LC6A 2ABBA 4AVFA 4LUJA 4JIPA 2E6YA 1W5NA 3ATZA 5CGQA 3NQAA 1OVDA 4PA8A 4JTEA 1K7FA 4IXXA 3OVRA 2ZRVA 5E1QA 3RF9A 3O6CA 2P0OA 2RDWA 4OT7A 3I6RA 3PBUA 3IVTA 5LZLA 3C6CA 5TQLA 3DHDA 2OJPA 4UFKA 1P5BA 3S42A 4HT3A 3CLMA 4LW7A 1KLZA 3L21A 2HS6A 1JCLA 1G4TA 4DF1A 3QMSA 3LCGA 3TK7A 5F2IA 2YSWA 3RMJA 5BW6A 1O5KA 4JTUA 3NR0A 4GUGA 1VQTA 3CT7A 3IIVA 2EGZA 1TPWA 2GVJA 3GX9A 4WOQA 4PCFA 2Z0IA 4UTJA 2EPHA 1SW7A 1SR9A 3KFTA 1KTBA 4PTNA 1XBZA 1U5JA 3HQ1A 4LV4A 1QWGA 2V2DA 4UNLA 4HNTA 1JUBA 3T55A 2DORA 1OG0A 1GYLA 3LTSA 3MWAA 5D02A 3S9YA 4JS3A 3UXAA 3C8FA 5KZEA 3KHJA 3B8DA 1F5ZA 1K7EA 4O1DA 1RZMA 3TX9A 2CLMA 2PRHA 3LRKA 2DJXA 1SFJA 4TMCA 3STEA 4A22A 4LVDA 1B9BA 3R2GA 2B7PA 2A5HA 6ALDA 4O1AA 1QR7A 5CZ0A 3TROA 2W79A 3WJZA 1XDLA 1YDNA 3LDVA 1R2RA 1XFBA 1KW1A 4N6EA 1LZOA 1IXNA 4M7TA 2F7FA 3W1NA 4B5NA 5DCBA 1JCMP 3TE9A 4MY8A 4RK8A 3PULA 3CEUA 4LRSA 4NX5A 5F4SA 1B3OA 1PVNA 3B0PA 3HGSA 3G1SA 2V5BA 1NFBA 4L4MA 5D2YA 4LVGA 3TSDA 2YDAA 5FF0A 2QUUA 2J24A 3BPWA 2J9YA 4FNPA 1W5MA 3O15A 1XXXA 4M5PA 3UWWA 5EYWA 3TAOA 1SUXA 2AAMA 5KITA 3R8RA 4BI6A 1S3HA 4Y9AA 2ATSA 3KVKA 3PBWA 3NQMA 3ELFA 2ZRWA 5F1UA 3FLUA 3O16A 4O16A 2BTMA 2QCGA 1LTDA 4G1KA 3ATYA 5HWNA 4DBDA 3IV3A 4FNUA 1FDYA 3GDLA 3DFSA 1DL3A 3H55A 3JRKA 4N9EA 3TQ0A 2YGYA 1L6SA 4L4LA 1W5PA 4MYAA 5H2ZA 3NGJA 2ZZ5A 4N9BA 3BG3A 3W85A 5AHNA 1ZAJA 2A6LA 3ZWTA 1I2PA 1H7WA 1QPNA 2V5LA 3IVSA 5CPLA 4PC8A 2B4GA 4DPQA 1YTDA 2Q3OA 3HIJA 2ZZ3A 1C8VA 3L0NA 1X8FA 1H7OA 5DLCA 3IGSA 3G1HA 2B7QA 3TSBA 4EOUA 4IQLA 3EWUA 3MBDA 5D2VA 4P61A 4GUFA 4JD4A 3MBFA 4ORMA 5EKYA 3DFNA 3UWVA 3DFOA 5LHEA 4MIMA 3QPYA 4UUIA 3Q58A 3W7JA 3DI1A 4FNTA 1SSGA 4RLIA 4WJEA 2YXGA 4YCPA 4HSOA 4KKXA 1GVSA 3OG3A 2WKJA 5FF4A 5FEXA 5D04C 3W7KA 2GJLA 1RQHA 2VEPA 2Y6ZA 1SO3A 3SECA 4ZZ9A 2QCHA 5D05A 3TQKA 3GXPA 2FFCA 4JYEA 3CB8A 4OQVA 1Q3NA 2C14A 1THFD 3KX6A 4NZJA 3P7YA 1LLWA 3FEMA 3LERA 1TRDA 3PM6A 4GE8A 2GQAA 4UXDA 2YFOA 2NX3A 2FJKA 1QFEA 4XKYA 4EVZA 1LCOA 5LNSA 4IPJA 1FCBA 2XN1A 3KXQA 3SGUA 4ZMGA 3NQDA 3EX1A 4BR1A 4ALDA 3WK1A 3B04A 3I65A 5E93A 3P67A 3NO5A 3G3DA 3LV6A 5DXXA 1Z42A 3E49A 4UMAA 5DXYA 2ZZ1A 3GNNA 3E96A 1NEYA 3S1XA 2H8XA 4XBKA 3W1LA 1G4PA 5LNWA 1A5CA 3ABQA 2Y85A 5G2WA 3C3NA 5CZTA 3G1FA 3GLCA 5KINA 2VFGA 2J9ZA 2ZA1A 4H4IA 1OABA 3LGEA 4DF0A 1UCWA 4WOZA 1L2UA 3P8JA 4QNEA 5BMXA 1G4EA 4KWVA 5I3KA 5HULA 3LOTA 1HG3A 1I2QA 1QCWA 3MHFA 2QCMA 4AWUA 3G8RA 1YXYA 1KM3A 1WDWA 2QJHA 1QMLA 3FYOA 4N4PA 3UQNA 2Z2UA 1IF2A 2DZUA 5AHFA 1J4EA 3OVPA 4WY0F 3G1YA 1JCJA 4IMGA 1BWLA 3GB6A 4FNSA 3UPWA 4E2BA 3QM3A 2H8ZA 3U2OA 1EP2A 1OFEA 1EIXA 4XKYB 1OX4B 1Q6QA 1ZALA 4CCDA 1SW0A 3FJ6A 4C1LA 3ABSA 3W86A 3W22A 3M47A 1ZNNA 3PY2A 4S1FA 3PG9A 1OFPA 1BEUA 3UZJA 1NAL1 1VCFA 4LV9A 3S5NA 5CSRA 4MJMA 4J9JA 1VJIA 3W87A 2RH9A 3LM7A 4GRSA 3EXTA 4O0ZA 4OHQA 2Z6IA 3S1VA 2YW4A 2E6FA 4IMCA 4BWLC 4O17A 1T96A 1LOSA 2C15A 1FWWA 4AF0A 4LVFA 2ZZ2A 1KBJA 3LHUA 1XKYA 5ABTA 1JQVA 1TPH1 4YLWA 3S6DA 4IOTA 4LWWA 5K2ZA 3DI0A 1TPC1 4K37A 5BRBA 3DFQA 4KFPA 4QSHA 3L66A 3L5MA 2QKFA 1XL9A 3W1UA 1ONRA 1GJPA 2ZRZA 3MUXA 3MI6A 4JN6A 4AHPA 5J5DA 3I7RA 1F6PA 2BWGA 3M5YA 3GDRA 2D73A 2EF9A 5AC8A 3TH6A 5E0KA 3LTPA 5D37A 4NNAA 5CPOA 4JTSA 3W2KA 4FX6M 1RQBA 4FIQA 1CW2A 2C18A 3R12A 1OFQA 1T99A 3QPZA 3BLEA 3THQA 1SFLA 1VRDA 1OYAA 2QCNA 3TU9A 2UV8G 3JS3A 1WA3A 3Q37A 4I7UA 5D32A 5DELA 1JULA 4MYXA 1KLYA 4FIRA 3A5FA 1IXQA 1OK4A 3NL6A 1YDVA 2B0MA 1P0NA 5D2TA 3A24A 1PHQA 1FUYA 4JX6A 3FIGA 1B4EA 1KBIA 1YXDA 2WNZA 3GR8A 4BFAA 4O14A 2VFEA 4UR8A
chains in the Genus database with same CATH superfamily
1IWBA 4NRSA 4JTFA 3WEOA 5EFDA 3S5YA 4O0QA 1VH7A 4MG4A 1R85A 5HQMA 1IXPA 3HB9A 1TV7A 3A9IA 1H0GA 3P8IA 3WY1A 3WFZA 4M7SA 1SU5A 3B9EA 3FGCA 1ODUA 3CIXA 1M53A 4YIWA 3A6OA 1UP0A 3ICJA 3WBXA 1JNDA 3SRDA 2A3AA 4D9PA 1UKOA 4JFTA 3GVRA 4LUSA 3DG3A 2CZEA 3AU6A 1EZ2A 2QIIA 1GUVA 5FJPA 2IW0A 4MSSA 1OG6A 2F61A 5KSWA 3S83A 4IPIA 4L1XA 2TAAA 1SZEA 4C90A 4X61A 4W84A 2VGBA 1V08A 4UTHA 3IJQA 1QI2A 2GVEA 2ZZ6A 2ZUWA 2FLIA 2DSKA 4AZ5A 5K4ZA 1OIMA 1SFSA 1R9YA 2IQ0A 4QP0A 4CU7A 3CIWA 4MNJA 2V8ZA 1SYTA 1FXPA 3RYSA 3V5CA 2PDYA 5HMSA 3PB0A 3QQ0A 4X2RA 3IIXA 3PZMA 2R1NA 4ATWA 1O6IA 1CXKA 2I7GA 2PWFA 4ADSA 2ZUMA 1PIGA 3NQ6A 3PS7A 1YRRA 3P6LA 1P6WA 3N2OA 4CQAA 4O12A 3PHAA 1GVQA 4EACA 3VNZA 1UQYA 2TPSA 3M5XA 1BTMA 1UD8A 1JUKA 5HR6A 3N2CA 3F1QA 4EE9A 5U7SA 2Z26A 1IR1A 5HJLA 3WX7A 5EL1A 2PDNA 2EHHA 3V1PA 2WSPA 3WDRA 4AC7C 4M6UA 2XG9A 4HSHA 4Q32A 3DERA 3IWPA 3WNMA 4S3FA 3CMJA 3A5VA 3GDKA 3MW7A 3CJPA 3AIBA 3ANYA 1LQAA 1PX3A 4W89A 4HYWA 3SFKA 3E0IA 5GPRA 1CX9A 3PNUA 2ZZ4A 1KGUA 2PDLA 2QJJA 3EKZA 3MP4A 3AMLA 1HXJA 5HATA 2C3ZA 2NX1A 3FXGA 2QPUA 1YE6A 2I9EA 4HJWA 3LPOA 1BG9A 2FJUB 4LPCA 1HT6A 1A5AA 3LHVA 1V6TA 5LXXA 3CS2A 5FI8A 5EMKA 1OX6A 4YXGA 3DKJA 4IMDA 5AHLA 3UVAA 4A8LA 4Y96A 2NUWA 3P0XA 4IJCA 4OGZA 3VFLA 1TTQA 1GVRA 3R13A 1KKRA 4K2SA 4KWOA 3STCA 3VNJA 3LRLA 1PTDA 1C8XA 3S1UA 2WHLA 4GIYA 3P14A 4DWDA 5C55A 1TIMA 1HKMA 5A6SA 4JIRA 1H1NA 4DZAA 3VD9A 5I3DA 2PTYA 4KBXA 2EXOA 3SM0A 3UJRA 1X1ZA 1XH1A 1BPLB 3N11A 2QQ6A 4PFMA 2YL8A 1WKDA 3LCXA 4JFWA 3W74A 2W66A 3VINA 4K1WA 5EY5A 3NPUA 2CLEA 1PCKA 3LXCA 1GJUA 1O5XA 4GNKB 2XIBA 1AJ2A 1MI3A 3E3HA 3NVTA 1XCFA 4X2PA 5AVHA 2V67A 3VI2A 3DEQA 3H2CA 3LBMA 4AIOA 3EDDA 1W0MA 4K36A 1OF8A 2HNHA 1WXZA 3H7UA 1ICPA 3ZSTA 3V7PA 3PN8A 1VBGA 2ZWZA 3BW2A 3WDPP 4S38A 3O9NA 3U8GA 3ZR4A 4QJ4B 4O50A 2ZADA 4NUWA 3TMLA 3RRAA 3LQLA 2GDQA 4G7EB 2G4FA 2ZKMX 5BXRA 2YA0A 1H1ZA 2XU2A 1U30A 4AAJA 1LLOA 1XLEA 3NL3A 1HZYA 1WNOA 1C7SA 5E6YA 4HK6A 4O8AA 3OA5A 3QGKC 1PZ2A 2QDDA 2J7EA 4Q8TA 4U3CA 3F4CA 2OKTA 3ZJ8A 3P74A 3QKZA 3LCHA 4HMCA 3TYEA 1XFCA 2FQIA 3GG1A 2ZIDA 4E2VA 3EDKA 1BRLA 2RFGA 1LOQA 5EPDA 4R9XA 5AYIA 1P7TA 3O06A 4HKPA 3FAWA 1WB0A 3LV5A 2CITA 1KFEA 3B0YA 4BK9A 3FW6A 2CLIA 2CLFA 1P6CA 2VKZG 1EO7A 3KDNA 1V0KA 3GTHA 1VD6A 2RDXA 5T26A 3MCOA 2REQB 5D38A 1ZENA 5BWFA 4RV3A 1X7FA 1KM2A 3M43A 1XLDA 3EA2A 1GPFA 2PI6A 3UY7A 5FEZA 3W9ZA 4LF2A 3O6YX 1XC4A 2DDXA 4GH3A 5G1YA 1DIEA 5CZSA 4IUOA 3LNMA 3S0CA 3RG6A 4DELA 2E9LA 3ZFHA 3ONBA 3W1RA 3TUUA 4FR1A 4XBSA 3MCNA 3BOXA 4FF5A 4DJDC 3E2QA 1MNSA 1MEHA 3MY9A 3THUA 3STPA 1UH4A 4H41A 3ARTA 2VD9A 2WMHA 1Q45A 4EF8A 3AS3A 5CCZA 1BKSA 1OFRA 3OHMB 3I3DA 3V0SA 4BF5A 4Z08A 2DFAA 2FHBA 4BI5A 2WANA 1XS2A 3IS4A 2DQXA 2VYOA 1K9FA 3WNLA 4HGXA 4D6JA 4LGXA 3VKKA 2WMIA 2TRSA 4A29A 5REQA 2DVXA 1UA3A 2BDQA 4XO7A 1TMLA 5CPQA 1M41A 2Z1XA 2CWNA 1H61A 4MPQA 1OADA 2IPGA 3TKFA 1PB0A 1V6XA 4DXVA 1EWEA 2OEMA 1KWGA 1LUCA 4WKFA 3O0KA 2F6XA 5D2WA 1QATA 4QG8A 1YQ2A 1DP0A 1K77A 2WKGA 2IPWA 4DBEA 4PMVA 1K8YA 3UPMA 4YTQA 3C4UA 3K4WA 1RUSA 1OFBA 1I4NA 3IV8A 1YNYA 1RPXA 4PMZA 4RXFA 5AECA 5KZMA 4M0XA 2WK2A 4WHBA 1FWBC 3ZVIA 2VD8A 3NAVA 1PE1A 1QHOA 2A3HA 1F74A 4PTVA 1S1PA 4UMBA 1KFJA 3VZZA 1VPXA 1NELA 1E1EA 3CHEA 4AZ6A 5FEPA 5HMDA 4ZODA 4QITA 5CC6A 3QN3A 3ITGA 1AW2A 3CHVA 3MSRA 1CXHA 4B91A 4L6OA 3RR4A 4AD4A 3CWOX 3C3UA 4LBRA 5C5YA 4WRHA 4ZOCA 1KGXA 7XIMA 1WDDA 3MU7A 3PZNA 5CPTA 5DY3A 1CIUA 1M6JA 2DZSA 3S1WA 4G7FA 3BW3A 4WF7A 4U3AA 3O7UA 4LYQA 3B05A 4G1NA 2WSRA 5KZDA 4Y9MA 1TO3A 2I14A 4PTWA 1V3JA 3RIKA 4QQUA 3C0SA 3CMGA 2YB1A 3T0TA 4M6VA 3HQNA 1TPEA 1RA5A 3VNKA 5GJNA 3V16A 1XCXA 1OZQA 2FZNA 1PHWA 1V79A 2RDUA 2X8RA 1AVAA 4AF0B 5CC5A 4HNCA 4AEOA 1LRNA 1LWIA 3E6EA 1CGVA 3AISA 4MOZA 2VC5A 4WSHA 5AHMA 1GZJA 5AYBA 4J3ZA 4H6KA 5IBXC 1B57A 1YX1A 4AW7A 4CN6A 2YDQA 4O19A 1J2BA 4S3KA 4UNIA 1J0YA 3G1DA 3QR3A 3TYZA 3DC8A 4NXKA 3G6LA 4KQNA 1AQHA 1VRXA 1QNQA 1RV8A 4Q6JA 4IP5A 3BGJA 2VCCA 3TP4A 1YDYA 2BG5A 4GVHA 3FHQA 1GOWA 1OYBA 3EAUA 3VUPA 1S5VA 5A1AA 3G77A 5D8ZA 3EDFA 3W70A 3QZEA 1YPFA 2WSQA 3P5YA 3UZZA 8A3HA 3AYTA 2PDJA 3WH7A 3LZ5A 4DXKA 5LHFA 3GQYA 3HA1A 3NG3A 1W3TA 4WLCA 3PWGA 1EJVC 4E2OA 3N2BA 4D71A 4ATLA 4E4UA 1JCXA 3S3GA 4JYDA 4O52A 4XO6A 1UR8A 3ISIX 3ZYZA 1O1HA 1SJAA 4E3VA 4WY0A 4AEEA 4CU8A 1O4UA 1OBAA 4DAIA 4HOXA 4AMAA 1UWUA 3MVTA 1SSDA 3G6MA 5LNUA 3OGSA 2PEVA 4HOWA 2WJFA 3GRIA 1TJRA 1JL8A 2Q6ZA 4DXXA 3HPSA 4JCLA 4Q8PA 2EG8A 3V18A 3MWCA 3T44A 4ZGYA 4MWAE 4KEMA 2YPIA 3LRMA 1JYWA 1SZNA 1VEOA 4QLJA 5D9NA 5HINA 4ZE4A 1UMYA 3HN3A 3W00A 3W26A 1I45A 2C1GA 2CZVA 1R86A 5I79A 3EZ4A 2QAFA 1UWSA 3GZ3A 2Y7GA 2QDGA 3TSMA 1CGUA 3W7PA 3XINA 1SZGA 4X3ZA 1F07A 3LGGA 4H2HA 1LBLA 4US5A 3POHA 1ALDA 1QPRA 1W31A 3KOFA 1XD1A 3VK5A 2XVKA 1JQXA 3LBOA 3VDBA 1Q66A 5U4NA 4REQB 3JZEA 3UWUA 4CQ8A 1DTNA 3L12A 4HNNA 1XYBA 1YLVA 3B8SA 3NEVA 4M82A 3NL5A 2J88A 2XIOA 2QCDB 3TFCA 4MKVA 2EG7A 2ZFAA 4C6KA 3S5ZA 4F0KA 4MKNA 3SUTA 2NWSA 2BGSA 2MNRA 3EEGA 3IUDA 1AQ0A 2XVPA 5LA1A 3W82A 3USZA 3OYXA 1MW3A 1E0XA 2V69A 4RPQA 4D6HA 3OGRA 5JBFA 3M0HA 3V75A 3W2NA 4PTMA 1J8VA 4NXSA 1D7FA 2WBKA 4Q6XA 4IISA 3U7BA 2ZUVA 4N4QA 1DEDA 3ZIZA 3CGTA 3PJUA 3SJ3A 3GO2A 4Q8VA 2JIEA 1OFDA 2BHUA 1TQXA 3UU0A 4U2YA 2DIJA 3A64A 3U3HA 4H9VA 3P84A 3ITLA 1YMYA 4KIRA 2H9AB 2CESA 4QX4A 1YYAA 3HV9A 1CTNA 1ECQA 4X9YA 1FWCC 1TR1A 1HJSA 4JIEA 1F9CA 3ITYA 3RR1A 3TYAA 4GPNA 2OU4A 1J6PA 4OIFA 1TTJA 4H7CA 2DT3A 1S2CA 3EX4A 1JPDX 4G8TA 3CZLA 3LHTA 3CZEA 2FVMA 1OC6A 2DT1A 3GTFA 4Z1BA 2QIWA 3ANUA 1Y5VA 2X1RA 2QJIA 5BU9A 4GC4A 3H2NA 1VF8A 4O4VA 1UOKA 2WCAA 2Y8VA 2OQYA 4WK9A 1A53A 4AD0A 3DBPA 4GIEA 1ICSA 1VFFA 4KCVA 5E0CA 4Q8OA 3FKKA 2D1ZA 4YWIA 3W84A 1HX0A 2DZTA 1F3TA 4TX8A 3E5PA 4UQDA 5A6AA 4BHYA 3GU1A 3QQWA 2PRLA 4RDYA 1UYQA 3BW4A 3Q65A 4MWAC 4BF9A 6REQA 3MKKA 4AZCA 3F03K 5KEZA 3GDTA 3IIZA 1C8YA 2Y4SA 4PMYA 1A5OC 4MFDA 4Q8NA 2ISWA 2OO0A 2FMNA 3PSVA 3NOEA 3R1ZA 3EGJA 1PIIA 3F4DA 3EDJA 3ARPA 1PWLA 1B1YA 3QBUA 2J7FA 5DRCA 1SFTA 2PLJA 4HCLA 2XN0A 2NSOA 4WZHA 2G97A 3WQDA 4Q22A 3WQGA 5DQPA 4DJDA 2YA1A 4ZVJA 1G1YA 3UF9A 3TC3A 1G0CA 3FN9A 1XYLA 3N2MA 5BROA 3OLIA 5M2FX 1W1VA 3CL8A 5HPOA 3TTOA 3TNBA 1AL8A 4EWJA 1VP5A 5G2IA 4JTIA 1VFOA 4MLJA 2ZA3A 2LLEA 3CXOA 1HP5A 2WZEA 2PE4A 2ACUA 5LIWX 1RA0A 1X1OA 4AD1A 2WOQA 3PSWA 3RO8A 4DO6A 5FKYA 2ABAA 3AZSA 1TPUA 3QPEA 3VC6A 4C7GA 3EPNA 3RNDA 1JD7A 2NQLA 4WIWA 1F05A 2W4XA 4AHQA 3H26A 2OGJA 4L65A 4UB9A 1XISA 1T8XA 1W1ZA 3KVLA 5JVLA 1RP9A 5K9XA 3H6OA 1VC4A 2PU1A 1WOAA 2YX0A 1CLXA 1TZZA 2PRMA 2NXHA 2JFEX 1JF6A 2NW0A 4ZBCA 5BOFA 2WZMA 1J2WA 1VHNA 4WDTA 1NF7A 4A8NA 4JTLA 3MS8A 3MI3A 5AYZA 2QXWA 5CEWA 2QV4A 4L80A 4CNOA 3PP7A 1YTEA 2P3EA 1BF6A 4RZ6A 4HD5A 3C0LA 2G3IA 3S6OA 5BOEA 2VENA 3GHUA 4C6FA 4GC3A 1OHLA 4JTGA 4GGHA 2I56A 2W67A 4DUXA 3F7JA 3WQFA 1K70A 4PMRA 2FTWA 2OZ8A 4H7ZA 3GC4A 3QEZA 4MDOA 1S5MA 2IKJA 1PYFA 4WD0A 3T78A 1TVPA 3U5UA 3GW0A 4UTMA 2YL9A 6XIMA 5A6BD 2W92A 2PGFA 2VEFA 3HF3A 2TMDA 1J12A 5C2GA 1YPXA 4XZHA 5DY2A 2WC4A 3TNOA 5CZJA 3OEXA 1OIFA 1KV5A 4BZYA 2E0PA 1BVZA 2VZUA 3D6NA 4ZB5A 4UTKA 3FJNA 3FJ4A 4RXGA 2FGBA 3RXZA 1R0MA 5BXSA 4RJEA 3ZT6A 1N8IA 4D2JA 2VUYA 3ZR5A 1Z48A 2VCBA 2BHYA 3L4VA 4Y6GA 1V3IA 5I07A 1BD0A 1RSCA 1N8WA 5IBXA 3UWYA 4M6QA 5F7UA 1XX1A 4C60A 1KCXA 5HQEA 1P0KA 1SZRA 2VFIA 2D2HA 2XINA 1UD3A 3AXMA 2WLZA 1P0EA 4MY9A 2D69A 4JY8A 1BYAA 1O1ZA 3OJGA 3AIQA 4R5EA 1P1MA 1R3VA 3W6YA 3VIGA 3BVJA 4MFEA 3VYLA 1H2JA 3AMDA 1ME8A 3BDKA 4ICNA 3AUOA 3D47A 3WLTA 4DPPA 4B15A 1DPMA 4C1NB 3MMTA 3SUSA 2YLAA 1IEIA 3GNPA 4IGSA 3TLQA 5ABFB 3RHGA 4D72A 3KAOA 1VBJA 1TWWA 4PSRA 2CLKA 2VGFA 3UFYA 4A3QA 3WD2A 3CQKA 5HNRA 3A4WA 4W85A 2R14A 2A4AA 5D03A 1JRCA 3EX3A 3IPWA 4N42A 4GVGA 3QV6A 4TO8A 1IQ8A 4RDWA 3PZ9A 2WSKA 4O57A 1ZRQA 3BLFA 2Q09A 4P8UA 3GKAA 3CHDA 2J74A 4XAFA 1IGSA 3A21A 1S39A 3UWZA 3R11A 2XH0A 2XSXA 3AWNA 4RW5A 3MV11 4FNQA 4LTSA 2RKXA 4RW3A 3NSMA 1A5KC 1Q6OA 1TJ1A 4QCEA 1TJ0A 3D0CA 4C6IA 4ADTA 1EF2A 2DIEA 1K8XA 5FSDC 4RKAA 3R10A 1FCVA 2XTKA 1IXOA 3IACA 4E2DA 1QNSA 3PJWA 4YN5A 4EPBC 1Q6RA 3VOIA 1TB3A 3MDWA 4CQCA 4OBRA 3BICA 1AJZA 1AMYA 4H6QA 4LU0A 2FIQA 4GY7A 3WQVA 4YL2A 5HNTA 2XH7A 1B9ZA 5IHSA 1J0KA 4LC6A 1JCTA 3ATZA 5CGQA 3NQAA 1OVDA 3W29A 1GQIA 3VIKA 4JTEA 1K7FA 3R79A 4IXXA 3OVRA 1MW0A 2ZRVA 3FVMA 3GHRA 3RF9A 3CUJA 3PBUA 3BQ5A 5TQLA 2OZ3A 2WJDA 4CD7A 1JI2A 1E71M 3TK7A 1KR0A 1EFZA 1XGDA 2D0GA 2G0WA 3NZPA 3WLKX 3GX9A 4GINA 2VX6A 2Z0IA 1UKPA 1SW7A 2CXEA 2CIPA 1XBZA 4LY4A 2Z7KA 2OLAA 3HQ1A 4AX7A 3KHDA 4UNLA 4HNTA 1JUBA 3T55A 2J25A 1OG0A 1EXBA 3GD6A 3LTSA 2AGTA 5KZEA 3TX9A 2PRHA 2HE5A 1E0UA 1SFJA 3STEA 1JF5A 2B7PA 2A5HA 4O1AA 1ISZA 1U2YA 5C9XA 3WJZA 3ZLHA 1R2RA 1XQKA 4G7EA 4XX6A 2D2JA 5LA2A 1DQUA 4RK8A 1XRSA 3DYMA 3PULA 4F3HA 4NX5A 4V1YA 5F4SA 1JAKA 3OZOA 1JFHA 2V5BA 4LVGA 2YDAA 2GL5A 2J24A 2QUUA 2J9YA 2WZTA 4DBSA 1XXXA 4Z2GA 1AH3A 3TAOA 5E9XA 4BA0A 3WLIA 5KITA 4KCWA 3U2ZA 1PDZA 1IV8A 3URBA 2ZRWA 5F1UA 3FLUA 3WF2A 4O16A 4JCMA 2CC0A 4DLFA 5IFTA 4AVNA 4PMNA 1HQTA 1R7AA 1UC5A 3XISA 2VJXA 4DYJA 4XG1A 3TQ0A 3TLLA 2YGYA 5LXEA 1V3LA 3UG4A 1WAWA 3NGJA 3V0UA 3W85A 1A49A 3TONA 3UXIA 2BNJA 3IVSA 2DV0A 2XDFA 3L4YA 3TVAA 1QT1A 2REQA 4MWAA 2X7VA 4A3HA 3BMVA 3VX1A 1VBUA 3GR4A 4ML4A 3IJ6A 3L0NA 4W8BA 1B31A 1HJUA 5DLCA 1Z6KA 1FHDA 1HIZA 2PWEA 4DVOA 1J18A 1XWYA 3N6JA 2YA2A 4PUDA 4P61A 1OB0A 2MUCA 5EKYA 2VTFA 5LHEA 5T8GA 2DSWA 4UUIA 2DSVA 2PDQA 1JZ2A 3CUGA 1FKWA 4OZOA 4V2XA 7CGTA 1MRQA 4WJEA 1ZP4A 2YXGA 4HSOA 1R3TA 1SJCA 3U2EA 4DZHA 2WKJA 4HU4A 5D04C 2GJLA 1RQHA 2VEPA 1SO3A 1CECA 4ZZ9A 1XLJA 1MUCA 9XIMA 3LENA 4GOAA 3CB8A 3KX6A 1QNPA 1LLWA 4NZ1A 5GJMA 1TRDA 3AALA 4UXDA 1J11A 3R0KA 2FJKA 4EVZA 3CO8A 2UWFA 5LNSA 5HAOA 3KP0A 6CGTA 8RUCA 4C5ZA 4IPJA 2XN1A 3KXQA 3SGUA 1UWTA 3ZQ9A 5J04A 4BR1A 4P7NA 3U0HA 3WK1A 1ISYA 3G3DA 4Q8MA 3LV6A 4F8XA 3E49A 1F8IA 1ZSXA 2H8XA 3W1LA 9XIAA 1W9BM 1V3HA 3C3NA 2PWGA 3G1FA 5JMUA 5KINA 5A3HA 3TJ4A 2ZICA 4H4IA 2XSAA 2XWDA 3AS2A 1L2UA 5BMXA 3V1HA 1JGIA 1Q6DA 1HG3A 3MHFA 1W6TA 2QCMA 3G8RA 1Q6FA 1LWJA 2QJHA 1QMLA 1SJDA 3FYOA 4AZ7A 2Z2UA 4L4PA 1JEZA 2DZUA 1J4EA 4WY0F 2PZNA 1JCJA 1X6NA 4U31A 3UPWA 4C7DA 1EHAA 9RUBA 2VVNA 2H8ZA 4H8UA 5C9UA 5HMFA 3U2OA 1QNOA 4S23A 2QZRA 4CCDA 1CB2A 4UQCA 2PTDA 3W86A 1EC7A 3SBFA 3W22A 3AJ7A 5FA5A 1DJWA 3AIUA 3N6QA 4ZEPA 3AFBA 2PGRA 1VCFA 4LV9A 3WF1A 4MMWA 4WKAA 3AYRA 1J01A 5CSRA 4IIGA 1XPGA 3LM7A 3ZLGA 3EXTA 1K9EA 3S1VA 3QGAC 4KEZA 4B92A 2QGYA 1HKVA 5I7GA 2C15A 1V02E 3BJFA 2PP3A 4AF0A 2VEGA 1UH3A 4LVFA 4M80A 3RCMA 4LWWA 4K37A 1XLBA 3L5MA 1ONRA 2ZRZA 1CWYA 3MUXA 5J5DA 4P8WA 4DI8A 3W25A 3WG6A 1F8MA 1WUFA 1BVNP 1SR0A 5AC8A 2ZX9A 2HXTA 2DVUA 4FOUA 4FX6M 3ID7A 5JQ9A 1CW2A 4MGGA 1GQJA 1T99A 3A13A 3QPZA 1GOKA 3THQA 2OLSA 1SFLA 3W27A 1OYAA 3LZ3A 8XIAA 2QPSA 2UV8G 2PF0A 3CO4A 3JS3A 3C5QA 2W5FA 4I7UA 5DELA 3B3DA 1ZJHA 4W86A 2VZTA 3BH4A 2PDPA 3F5KA 4LUTA 5DMNA 1OK4A 1U33A 3NL6A 2B0MA 3A24A 1PHQA 1XLFA 4ZXLA 4JX6A 1B4EA 3WQPA 4UR8A 1LBFA 2XPKA 4IL2A 1CXLA 2C91A 5D2XA 3RLGA 2ANUA 4OKDA 4AXNA 3QF0A 3CASA 3ZJ7A 3E12A 1TWZA 5A2CA 4DHGA 1R6WA 1KFKA 3WL0A 1TV4A 1PX4A 1AQMA 2WKLA 3GC5A 1ZGDA 1GVEA 3ES8A 1QUMA 3MYPA 4CNPA 2YKKA 3W72A 2E68A 5A2BA 3ARQA 3WEMA 1YTKA 1KTCA 3E0LA 4P2VA 5I78A 2P8BA 4IFRA 4US6A 3S1GA 1KQYA 3UW6A 5CAHA 4JYFA 3PB2A 4LS1A 4HPHA 4WX2A 5M3WA 1EBGA 4J3XA 2Q8ZA 1E3ZA 4ZSTA 5AVNA 1XLHA 3ARYA 3W28A 2F8QA 3HG2A 3SN0A 1BXNA 1KM5A 4HCHA 5LA0A 1JGMA 1TV5A 1FCUA 4Q4KA 4TIMA 1US0A 2V30A 4ILSA 3VDAA 4HU3A 3F2CA 3W7MA 2JK2A 5DT7A 4HK5A 5D4YA 1KFCA 1CBGA 4K8HA 1Y5XA 3KBSA 1HL9A 3WQ4A 1MXSA 1T7LA 3MI2A 3M0KA 2YCJA 3IIPA 4LUSB 1WOBA 1XIGA 4HA4A 4W7UA 1UIPA 2O7QA 3G24A 1R47A 3WUBA 4FZIA 4N9CA 2JBMA 4GK8A 2GJXB 2J6XA 1ZJAA 1I1WA 3SQLA 4Q33A 4YWSA 4JNZA 4N6FA 3ERPA 3VTRA 4Q7NA 4KRTA 2PDCA 1YADA 3UNDA 1UJPA 2YJQA 1XYMA 2IQTA 1BWKA 4HN4A 2VURA 4J35A 2D23A 4ERGA 1JPIA 3NXFA 2VOTA 1OSEA 3CM4A 1XP3A 4WGHA 2DZPA 1B4KA 1R8LA 3KOWA 3KRBA 1GW9A 3Q4DA 4HNVA 1IR2A 2HVOA 4HZ8A 4UQEA 4GNVA 2CHRA 1TX0A 3FEQA 2H9AA 2H3BA 4EIVA 4JR5A 1GG0A 4AY7A 1PKMA 1Y65A 3DDMA 3HPXA 4L9YA 3M41A 3T09A 3M16A 2QAPA 3AXKA 3TA6A 3ARXA 3KRZA 4JEQA 4TVUA 2WHJA 2ACRA 3AMCA 2VC9A 1BVWA 1UOZA 3NTYA 5E9AA 2HCVA 4WXYA 2OCZA 5KZ6A 1SPQA 4O11A 3CTLA 2V38A 4CUCA 3KTXA 1HL2A 3DC0A 4P8VA 4ZO6A 3RLVA 3WQWA 4FNRA 1H5VA 5LGZA 1KM6A 1NSJA 4GO8A 4DYEA 2HQAA 4K38A 3EMQA 3KOZA 3PAOA 1CXEA 1O95A 1AK5A 1ZJBA 1Q7MA 1NF0A 3VMOA 5G4HC 4TV6A 3PWIA 2OXNA 1XR2A 3LTYA 3QY7A 2AQOA 3I6TA 2A0NA 3NYZA 3F4NA 1AL7A 4LS0A 4QISA 2E5BA 4F0LA 3QHNA 3GR7A 2VFDA 4OWGA 3THDA 1E0TA 3SRKA 1JZ7A 3MSYA 2DZXA 2XSBA 4DJFC 3E38A 1V03A 4EX4A 2G8ZA 3OQ8A 3WDQA 5IOBA 4KETA 3BLOA 4UOQA 2BXZA 1JZ8A 1ZBKA 2YDSA 1TTPA 2POTA 5CC7A 3GK0A 1CDGA 2CFFA 3K5XA 3HGRA 1H7RA 3PBYA 1HJXA 1WKEA 3GIYA 2X7WA 1ZTVA 2D22A 1EP1A 3P60A 4PMDA 1EEXA 1K03A 1UD4A 3UEQA 2A7NA 2FHFA 5G4WA 4PRTA 3N3MA 2D20A 3IRDA 4N9DA 1R7OA 1EQCA 3L0KA 4GQQA 4D8AA 2GZXA 3N17A 4JTDA 3EYPA 1LF1A 3KCJA 2X1SA 4Z1DA 1B5TA 3GE7A 2VR4A 5D9PA 1VKFA 3CHFA 4BEUA 3PJXA 2PGEA 4ZQOA 3RLHA 5T9BG 4RUBA 3PUOA 1F73A 2PBOA 2JF7A 4RDVA 5ECUA 3E2RA 4R27A 4B5SA 4RZ5A 4IXHA 4TOQA 3BARA 3L4ZA 1M7XA 2RUSA 3DECA 3LCWA 4EAYA 4PBEA 4UC5A 1EDQA 2XIQA 1NDVA 1VFHA 4HMNA 5AHIA 3OHIA 3S2MA 4AZBA 4ICCX 4CQDA 3W73A 1F61A 1IIGA 3DHFA 3LD5A 2BV9A 5C9RA 1XLAA 1NIUA 3VPLA 1A0DA 4JTCA 3DYPA 1KCLA 3QY6A 2OFJA 2NZLA 3BAWA 2YLLA 2BY1A 3C2FA 2WQPA 1YNQA 1WV2A 1XHGA 3G1RA 1PX8A 2XFRA 4AD2A 2PS2A 1QBBA 2YR1A 2ZXBA 2GOKA 3IK2A 3VCCA 1OCNA 3W01A 4MPKA 2O4MA 2G3NA 1H62A 3FKRA 3PZUA 2QHAA 4O1BA 1RJQA 2ZTKA 2D0FA 1E56A 2Z00A 3EWZA 1W1YA 3SR7A 5G1TA 4PRRA 3ITXA 4WCJA 2C19A 5FF2A 1DHPA 1FCQA 1FH7A 3PF3A 3MP3A 1FX6A 4W5ZA 4FPSA 4TV5A 1FP9A 4UCGA 3NFUA 1UWAA 4ZENA 4LFYA 1GTHA 3WQ6A 2FB3A 3OA3A 2H3DA 3ZT5A 1W37A 1TCDA 4NZFA 3O2LA 1W8GA 3Q94A 1I1XA 5JIWA 1T0OA 4OFCA 4US5D 3FA4A 2O9TA 3N15A 3MZNA 4MB3A 3SY8A 3LXAA 1Q6GA 3M4HA 1RD5A 5G1MA 3NSNA 2W3ZA 4TX6A 2XVGA 4L7ZA 2XFYA 4I9TA 5H6HA 1ZL1A 4FALA 1HF6A 2GDVA 4UQBA 5BOOA 3LN3A 4LCQA 3CH9A 9CGTA 2YYTA 1XYAA 2PLKA 3LM3A 4FHAA 5G5IA 3L4TA 3OBKA 2WMIB 2XYLA 4LYPA 1LOLA 2VXNA 2VDGA 5ABFA 1ICQA 4EANA 1F6YA 4U10A 1JPHA 4Z0SA 2HROA 2WZIA 1H7NA 3GVGA 2ZXAA 4GQBA 4I3GA 4PUEA 2OSWA 4QJ1A 1IT8A 4DNHA 3C86A 1GVYA 1Z32X 5GJPA 1S5TA 4RZBA 4XTIA 4W9TA 3WD1A 1UZDA 2AKZA 4AZGA 2C16A 4TX9A 2CZFA 1ITXA 1LJYA 2KZHA 3G0XA 4DEFA 3U7VA 3PC0A 3WK0A 3UESA 2Y7EA 2OVLA 5K7JA 4NAFB 2R8WA 4HBKA 2Y89A 3KVMA 3K30A 3TC7A 1JXJA 5CG7A 3KEHA 4JIQA 1ISXA 2B81A 4ACYA 3HG5A 3T0BA 1N8FA 3I7SA 1DJNA 1BHGA 8XIMA 3KLLA 2I1OA 3SQMA 3LMZA 2PA6A 1V93A 4PMXA 4UFHA 1H3GA 1GEQA 3VNDA 1QK2A 1NFPA 4OVXA 4A3UA 1NOFA 1UKSA 1QPOA 4W4QA 3VGHA 1JPMA 1GW1A 1XPYA 3H23A 1S3TC 4QAWA 3AROA 1GVOA 1CGYA 3LEPA 1Y0EA 1EEPA 2E77A 5I3FA 2P3ZA 1R5YA 4X0NA 3WH5A 4NVTA 4M24A 4JHOA 1M04A 5C6MA 4MHBA 5IFPA 3SB0A 2G95A 1QO5A 4PB3A 4GJIA 5FF3A 3D3AA 3QSTA 3G18A 4KPLA 4TUFA 3C0QA 4J2PA 3W24A 1FFRA 3URQA 3HOJA 4PUNA 4C6PA 2PD9A 4X0VA 3W1TA 3GHTA 4CNSA 3ITCA 4JTAA 2VDIA 4AWSA 2A21A 4HYRA 1IZKA 4NILA 1VJZA 4LCSA 1P0BA 4GUIA 3NZRA 3IGXA 3QVQA 1QI3A 4DJDD 4F0MA 2CHOA 1UASA 2O4QA 3GTIA 3C2YA 1QBAA 2O55A 1S2AA 4TU1A 2ACSA 4MAZA 3AZRA 4W8AA 7ENLA 3VMNA 3JR2A 2NQ9A 4OBSA 3NQCA 3WUFA 4NQ1A 3RJYA 4Z1CA 1A5SA 4OV9A 4CGTA 1IYXA 3R6IA 2GQ8A 1EJWC 2G37A 4ZQCA 4KWWA 4AXKA 4JN8A 1CCWB 5I06A 3SGZA 5I5RA 4GI6A 4F48A 2YCLA 2WVTA 2ZXDA 2CERA 4O54A 3KP1A 4GXMA 3VU2A 3GYCA 3QTPA 1ITCA 1R2TA 1VFUA 4GKTA 1O68A 2CLHA 4FMVA 3MHUA 5EB8A 1UUOA 4JFVA 4JKLA 3VVGA 4Z2HA 4WY0B 3WUGA 3GXNA 5E6ZA 2V0TA 2EPNA 2JEQA 3CT2A 5CBIA 3CAWA 2XGBA 4J40A 3GNXA 4L6DA 5AHEA 3WD3A 2GWNA 2FH8A 2EPOA 3EXRA 3EMCA 4KCTA 4MJ4A 2NX9A 2PDXA 4ZA0A 4V1XA 5CPMA 1WBJA 4XQ6A 5A8MA 3LCLA 3GHSA 1KCZA 2PDUA 6TAAA 1ZJIA 2PDGA 4XZNX 1XQLA 3TCSA 1V5XA 2J27A 3CHCA 1WBHA 4FLSA 1FHLA 4I8YA 1EH9A 4PEKA 1VFSA 4JTRA 3CC1A 3S2NA 4XUGA 2PC8A 4UTLA 2VUNA 2TSYA 3E0FA 4GKLA 3WH6A 4JTJA 4DJFA 1RBLA 1G67A 1A5MC 3CPGA 2JKEA 1XIMA 3N3TA 4GWEA 1JYXA 1FP8A 1R3QA 3WLPA 4UTUA 1RBAA 3VKDA 3PPCA 3AC0A 2Y0FA 1H5YA 1WP6A 3MMWA 4B5WA 3GNDA 3K1DA 2EPLX 3TEVA 3HGJA 2C79A 5CZKA 5IRPA 5HR7A 1UP2A 1XLCA 3DIPA 1XRVA 2PZ0A 1KXHA 3GVWA 3UYIA 4TVCA 3UCQA 3W7RA 1V3KA 5MHBA 1QXLA 1NWRA 1BYDA 1T5AA 3CK5A 5LIKX 4C91A 4RR4A 1W56A 3BMXA 1XDJA 3FA3A 3H4XA 5HJYA 2QUVA 4J5NA 1X39A 1TWIA 3S9IA 4K8EA 3LGDA 3N6HA 5G2HA 4E38A 5DRIA 2ONEA 3QGVA 3T2PA 2YXXA 1XKJA 3P80A 4F79A 3POCA 5DN1A 3UXDA 1RVGA 3L5AA 4J3TA 1GNXA 4IG2B 3HG3A 2C8NA 3SN1A 5FJJA 2PWDA 2G4JA 1U22A 3OLEA 2QCLA 2WAGA 1VIWA 1US3A 2YOCA 1OT2A 1DE6A 1JI1A 2WHMA 3UZYA 2CU0A 4IPNB 5F2LA 3D3FA 2VRQA 1X38A 2CBVA 2NV9A 1CPUA 4D6EA 1EGMA 2A3LA 3RCNA 4PMUA 2A6NA 4O13A 2PBGA 1AODA 2QR6A 3R43A 4IGNA 1SM9A 1RD6A 2OEJA 4S2CA 1CYGA 3PZIA 1ME7A 1A3XA 2CKRA 4BQ5A 3C61A 3ALGA 3C2VA 4XZLX 6REQB 4AZCB 1QOPA 1RK5A 3IARA 4KMQA 3T8LA 3TXZA 1O66A 2PAJA 1I6NA 4GY1A 3P61A 2P0IA 7ODCA 4QEHA 4MB5A 1B3ZA 4Q7BA 2AMXA 5AFDA 3O0FA 1HO4A 2PDMA 4XWUA 1SMDA 3ZJKA 1E73M 4LNYA 1BKHA 1R3SA 3MDUA 1W1A1 1E51A 4ZCWA 2Y70A 3QV7A 3DOPA 1UA7A 4O28A 5DEZA 3CAKA 1RPKA 3L4XA 3WDJA 3NDOA 3W7NA 1TV2A 4YU1A 1L6WA 2P8CA 5M03A 4HA0A 3TTSA 1GKPA 3QYSA 4MUPA 3MCMA 2OSYA 3NQBA 2GDUA 3HGOA 2J8FA 5DFAA 3UWQA 2ZUSA 1BXBA 4K39A 1K4HA 4KRZA 2VZVA 1IEWA 1VCVA 2I16A 1IEXA 4ZR8A 4IX0A 4LANA 1V6YA 1NOUA 3NPXA 4N7QA 4DYKA 1MYRA 1HVQA 4XAPA 4QCFA 1KM0A 4ZQMA 2ZCGA 4I8DA 4NU7A 1N7KA 3LQGA 2WO5A 4GVFA 1GJWA 1JZ4A 2OQHA 1LQ2A 1MSSA 4MVAA 1OCBA 3BLLA 2QUTA 2Z1BA 2EPMX 3NQVA 2CBIA 1DWHM 4W87A 3B06A 1LM1A 4FK9A 4L64A 2ZA2A 4TR9A 3STFA 1OCJA 1XIIA 1DIOA 4UQAA 4RDZA 2EO7A 4GGBA 4JTQA 4CKQA 2ZE3A 5GVJA 1FWIC 3BUVA 1A0EA 4IQDA 4AWTA 3NQEA 3OZPA 5HUPA 3W3OA 3PTQA 3BAJA 2PTWA 2XGIA 3VIHA 1YXCA 3S8HA 4ZFMA 3QLDA 3M0VA 1S5NA 3BCJA 2ZQ0A 2QJNA 2NSXA 1E40A 2JGYA 1SO5A 2QEZA 2WC3A 4TTUA 1XBYA 4NI8A 2GJPA 3L4WA 3T4WA 5FAJA 1M3UA 1TUXA 5C7VA 4FLRA 4K6AA 4ZQPA 1K6WA 3F2DA 1BXCA 1VB9A 4MZ8A 3U5YA 3M0ZA 4NJIA 4QG6A 4D6FA 3QOKA 1RAKA 3PR2A 4LRTA 4JIHA 2ON3A 4DO4A 5A95A 5C9ZA 1G7UA 4GXWA 4UTTC 1MWOA 3MJMA 4AQLA 4H8NA 4U4MA 2OX1A 4J4KA 3OGVA 2CPUA 4DM1A 2E9MA 2ZX8A 3NO3A 2GGEA 2Z2BA 1XICA 1D3CA 1EJSC 4PCTA 3RM4A 2CLOA 1EZWA 2QDEA 3CZGA 1HL8A 2Y61A 4LNCA 1R2SA 5K3VA 2FVLA 4JNMA 4GX8A 4HU0A 4GH1A 1FH8A 1OGSA 3P82A 3ARSA 2GJXA 3WCZA 3WQ8A 4I7VA 1AMKA 1ITQA 2D2GA 3L68A 1FWNA 4PMQA 1UJQA 4H9XA 3TYDA 3W7OA 1PBGA 4I9JA 3VD3A 5AC6A 3N18A 2V5JA 3O8AA 4JICA 4A6GA 4DN1A 1ZBCA 5DBTA 4PBGA 6TIMA 1EJTC 5FESA 5HUOA 3M44A 1VJSA 1DWFM 2FFIA 2BGNE 3GG7A 4J28A 4N2YA 1DE5A 1VEMA 2IPJA 1KB3A 1QDSA 1C90A 3EWCA 1G01A 1Q63A 3K8LA 1OM0A 1A80A 4F4RA 3VZYA 4KS0A 4UIOA 1SJBA 3VGBA 3FCPA 1T41A 2Q8LA 1L6YA 5AC4A 4QIUA 4LYRA 3SAZA 4AY8A 4ONVA 1R30A 3EMZA 2W9MA 2OWCA 4OJYA 2NUXA 4ROQA 4FF7A 3NPVA 4ZB0A 3PG8A 3CZJA 3QYQA 2VX7A 4WQ6A 5A6JA 1SW3A 3GM8A 3N9KA 4MB1A 5I3GA 1YKWA 4MNKA 4PR4A 1NWTA 1D8CA 4AVFA 2E6YA 4E4PA 3RITA 1W5NA 3MUCA 4PMOA 4PA8A 1FKXA 2AOSA 4I5XA 2P0OA 2RDWA 4UFKA 3L2MA 4LF1A 3CLMA 3KOXA 3L21A 5FCZA 1JCLA 1PKNA 2J7BA 4DF1A 2PF8A 3WLHA 1ADDA 5HOSA 5H8PA 1O5KA 3NR0A 4GUGA 5DT5A 4L4OA 2EGZA 1V77A 2GVJA 3MUAA 1GCYA 4H6RA 4G9PA 1EXPA 3KZSA 1KTBA 4PTNA 2NVAA 1EGVA 3ARRA 3U2CA 2BOGX 1OEPA 2PWHA 2QMJA 5D02A 3S9YA 5CPSA 4JS3A 3UXAA 4GX9A 1K7EA 4HA1A 1RZMA 2CLMA 4XIAA 5DO8A 3LRKA 2A3BA 2DJXA 3CTTA 1UZ1A 2W27A 3NOYA 1TX2A 1B9BA 3WLMA 1QR7A 4WSJA 3TROA 3UJSA 3WMSA 2OYKA 1GOOA 3MV01 3UR7A 1IE7C 1XFBA 1KW1A 4HNOA 4WKHA 2VGIA 3TE9A 3QXBA 4ERAA 4PGLA 4LRSA 1PVNA 1TVNA 3SCVA 4L4MA 5D2YA 1MNZA 5FF0A 1L6GA 3H22A 1XCWA 3O15A 5AZ1A 3WNOA 4BJHA 3AWOA 1SUXA 2AAMA 1A3HA 3D5HA 4H8HA 3R8RA 4BI6A 3W37A 4D6DA 2ATSA 1LG2A 1AJ0A 2ZXQA 1XG3A 2F6UA 1UH2A 5CJNA 3KWSA 1UR0A 2QCGA 4UTFA 4G1KA 1UPMB 4DIAA 3AUJA 2XZ7A 4AC1X 4HZ7A 4XZMX 5HWNA 4DBDA 3CB3A 5DMYA 4H8VA 5CJ5A 3GDLA 4GISA 3T81A 4CVWA 1W9DM 2EEXA 2PU0A 3CYVA 1FWEC 1FOBA 1W5PA 3VNYA 4EXQA 1EKOA 4N9BA 1ZAJA 1EHNA 3BJSA 3LPGA 4K1GA 1QPNA 2FVKA 4AY1A 3UG3A 4CCZA 4PC8A 5DANA 2Q3OA 4B16A 3WF0A 1GHRA 3HIJA 1ONEA 3ZXWA 1C8VA 4J1OA 2FMOA 1X8FA 2AL2A 1C93A 1D2KA 4KF1A 3TSBA 4EOUA 3SCQA 1ZUAX 3EWUA 3XIMA 3VDGA 1E9YB 3SCSA 1F4HA 4QJ3B 3HU7A 1WDPA 1E4LA 3Q58A 2F38A 2FZ9A 3DI1A 6A3HA 4RLIA 4PTXA 3R4IA 3OTRA 4ZO7A 1X7IA 2E1WA 4S39A 3MUY1 4HOZA 4QROA 3GXPA 4JYEA 2OO6A 3BZJA 4OQVA 3LA4A 4JFSA 3ALFA 1THFD 3ITVA 3L2LA 1ONXA 3FEMA 4GE8A 4TQTA 3EWDA 4DZ5A 2GQAA 3GVVA 2AMGA 3PFRA 2DUXA 4NL1A 4B2DD 1QPKA 3UA3A 4R9OA 5HQLA 3SO7A 1V6VA 4XZWA 3NQDA 4RNFA 3EX1A 2YZ5A 3NDZA 4MWAB 1EJXC 3R7MA 4QE4A 3B04A 3M0MA 2RAGA 3GNNA 3V35A 3T0DA 2X05A 2Y5SA 2ESCA 3S1XA 2W63A 3APTA 4PE8A 2Y85A 5CZTA 3LUTA 4I9MA 1C9WA 2J9ZA 3LGEA 2WJEA 3VOFA 2QW5A 1KC7A 4J3UA 1QCWA 1I2QA 5FD0A 1KM3A 1WDWA 4N4PA 3UQNA 3CWHA 1IF2A 3VOGA 5AHFA 3G1YA 3WZ0E 3GB6A 3SCPA 4AZHA 3MANA 3RPTA 2R1LA 4YYFA 3JUGA 1Q6QA 1ZALA 5EMMA 3FJ6A 3GDBA 1UP3A 1PTAA 3SCOA 3M47A 1ZNNA 3PG9A 2VX5A 5M1TA 1NAL1 2NT1A 4NZ3A 3U9IA 3L23A 1A4LA 4IUGA 4RE3A 1TKKA 4GRSA 2QPXA 2WM1A 2Z6IA 4OHQA 2JQXA 3VXGA 2E6FA 4J3VA 4G5DA 2BVTA 4BWLC 5A6KA 4ZXOA 5MKGB 1LOSA 1S1RA 3R94A 1AFSA 5JUVA 1XYFA 3LHUA 5ABTA 3S6DA 5K2ZA 3N2TA 1CZ1A 1GOIA 1TPC1 1UKTA 1KBBA 3DFQA 4QSHA 3L66A 4NAFA 4GZ7A 4UOZA 2WMKA 2X2YA 3LSBA 1GJPA 4AHPA 3I7RA 3M5YA 2YL6A 3GDRA 2D73A 2UY4A 2EF9A 3TH6A 1G94A 5E0KA 3VKAA 4ZE5A 3WFLA 3LTPA 3W2KA 4FIQA 2C18A 5PTDA 2VZOA 3GG8A 1RJRA 3R12A 4QEEA 3AIRA 2MANA 4YJ5A 1VRDA 5BRQA 1Q2RA 2QCNA 1R87A 4HTYA 3TYCA 3DFHA 3OW1A 3MPGA 2FZBA 5HANA 1MQRA 3AHYA 4FIRA 1KD0A 2PGWA 5C70A 4ES4A 1YIXA 4HMDA 3OP2A 4E5TA 1FUYA 1YXDA 3R58A 2VFEA 3RLUA 2E25A 2BB0A 2Z7GA 2VQUA 4M6PA 1FY6A 5LKYA 3VM7A 3BOLA 4H9YA 2X2GA 1OFAA 3OIXA 1JXKA 4ACZA 1UHVA 1XIDA 1T6MA 5BYWA 1WKYA 5LNVA 4FX8A 3LBCA 5HWJA 1Q7QA 3UR8A 1XLKA 1VYRA 2OPJA 5I03A 4RPPA 2HSAA 3KLKA 5CSUA 3ZR6A 4R85A 3AXHA 3TWAA 2ZX6A 3WMBA 3M07A 5DMLA 5K9DA 3W23A 1CNVA 2WM0A 2FZMA 3AIEA 1QASA 4DM2A 4QR6A 1TPDA 4GO9A 3VDCA 2INFA 4JX4A 7TIMA 3H54A 2OX4A 4FAMA 1HTIA 3BG9A 4DUOA 2OLHA 1EC8A 3TZFA 1FWHC 3DESA 4ENLA 2QYGA 2W6RA 1C29A 3GFYA 4OUEA 3KTSA 4LUTB 3HZ3A 3UGRA 2YBVA 2E6DA 3A47A 3MSGA 3RO6A 3W76A 3VIIA 3AHXA 1VLWA 5AOUA 4F40A 4Q3MA 2Y88A 1QWKA 1YHTA 2Z1KA 3WLJA 1B2YA 5HBFA 1FWDC 4QS5A 3LCFA 5H8MA 1R3RA 1IGWA 5TNVA 3UNTA 5CC3A 1HO1A 1E43A 1PV8A 3PUEA 3GTNA 4CNTA 4GY0A 5JU6A 4NAEB 4MNMA 1CENA 2J13A 1HN1A 3B4YA 2GWGA 1QPQA 2D0HA 1OY0A 2R24A 4NJHA 2WNWA 1MEIA 2RDTA 3VIJA 1F7BA 2EPKX 1KRCC 4RE2A 1MUWA 2P76A 1DQWA 3UCCA 3U4FA 3EOOA 3KVJA 1NWUA 1AZ2A 4TTGA 3I10A 3KTCA 4BQ2A 2PB1A 1J0JA 4WDWA 3WN6A 3DU0A 4S2BA 1E3XA 2UZ9A 3EWWA 3QSRA 2AL1A 3QR0A 2JIWA 2G96A 2E6AA 4M56A 4LAMA 3UP8A 2Z27A 3GBEA 4W8LA 1EF3A 3VKJA 1AW5A 5HPCA 1GONA 2BMBA 3VNLA 4H01A 1VCGA 4XTDA 1ZFJA 4HHPA 4D8ZA 2DT2A 3RM9A 4HVXA 5BRPA 2BX7A 3AXXA 3DH7A 1H63A 1I2OA 3O6DA 3KBMA 1UUMA 2VWSA 4Z2KA 4MJ2A 2QT3A 2F2KA 1ZAHA 3E02A 4UFJA 2CEQA 3FHAA 3FXYA 1TJ2A 3M0LA 1LL6A 1LLZA 1WZMA 2DIKA 4GNJA 2BOEX 2GQ9A 3IJ7A 2OOFA 5BU6A 3UJEA 4TMBA 3S9ZA 3WBEA 1XIHA 1BQGA 1MDLA 2IKGA 1S46A 2PWVA 3G8EA 1BQCA 1FFQA 4H3DA 4IQJA 1DJGA 3M7SA 1EO5A 2KAUC 1I2NA 1J93A 4PFHA 3LI1A 4GHRA 4P7QA 3W1QA 1IWPA 5I77A 3N12A 4MJZA 4YMZA 1GZ1A 1FWJC 2UBPC 4LEFA 1K8ZA 4EPEC 3ARZA 4FO4A 3DFPA 3AS1A 2PDWA 4AH7A 1P0DA 1S2UA 3SFWA 1W2VA 2NV2A 1W3LA 1DV7A 2ISVA 1I60A 5GNYA 1VGAA 2BY3A 2C0AA 3DG6A 1OC5A 4IG2A 4LALA 3TCEA 5CXPA 2YYUA 4RZ4A 2XUCA 3PPHA 1WPCA 1UR1A 4PL1A 2ZRXA 3TAKA 1XW8A 3AYVA 1NH6A 2F9RA 1HKJA 5CH9A 2C1IA 2IKHA 3W02A 2CZ5A 2DU2A 2QF7A 2R1MA 3ZOAA 1UZHA 2VDHA 4WUIA 3W1AA 1RLDA 4HYVA 4M8UA 4PZVA 3ECQA 1EA0A 4ATDA 2VGGA 1VAHA 3SIMA 3KDOA 2F2HA 1S2TA 4U33A 3T08A 4HCDA 4PULA 5A8NA 3AIVA 3CUHA 2VRKA 4IIHA 1KM4A 3AI0A 3DKLA 3BLKA 2E8ZA 3CQ0A 4HPJA 1C91A 4O18A 1A5BA 4NASA 3R0DA 5A8QA 4YS1A 3TQVA 1XF0A 4GJ1A 3ZWSA 1CB7B 3REQB 5I24A 5IDZA 3QMTA 2Q3RA 3HMCA 3QC0A 3TYUA 1FDZA 1GHSA 4HU8A 1MUMA 1S5WA 4A3RA 1ZLPA 1U5HA 3H2OA 4BY3A 4JHMA 2W91A 2WLYA 4UZUA 3SUWA 3W7EA 1V7YA 2HV5A 2GSJA 1XSIA 1W1TA 5GQBA 3WD0A 4D6IA 4LC8A 4CD4A 2HPMA 1G69A 1QU4A 1EL3A 3NSXA 1ODZA 2PURA 5A6TC 4KERA 1KFBA 4UBPC 4NJJA 2FB2A 3KL0A 2VC7A 1XRFA 3H24A 4O15A 5A8GA 1XH2A 3QLLA 4W7VA 2AKMA 3MJYA 4PUJA 3LSCA 4WR3A 4ICMA 2DY3A 5BNKA 4NJGA 4PCNA 2YCIX 1S2WA 4LY8A 3C2RA 3CNYA 1N55A 2CKSA 5E0FA 1OJXA 1Z89A 1ZAIA 3P81A 2OELA 1BLIA 4E8GA 1SGJA 3TR9A 4DJEC 1LP6A 3W6MA 4BWLA 1E6SM 3WJXA 4DAFA 2P53A 1PDYA 3CH0A 1GTEA 4C6JA 3L2IA 4Q4PA 3PTMA 3ES7A 2PDKA 2Q01A 2GGJA 3MT1A 3BV4A 4INFA 4DQWA 2V2HA 4RL3A 2AQVA 1JAEA 1SZFA 2NV1A 1IT0A 2PDBA 4HZ6A 3AQUA 1WAUA 1TZ7A 1I2RA 4KWSA 1DWJM 3ARVA 3SRFA 5HK4A 1XYZA 2HMCA 1DVJA 2ADAA 5MF5A 1A4MA 4RNHA 4JHZA 4HPXA 5BXTA 1UW9A 3EX6A 3WFAA 3F5LA 3NWRA 3BANA 4KFOA 5C7HA 1H7XA 1UIOA 3F5JA 3VZXA 4WJXA 4NKCA 3USBA 1LWHA 2I5QA 2YCKX 5F4WA 1RHCA 2ZOXA 4HMEA 3U4AA 2P1FA 3B03A 1EA9C 3NEHA 1UR9A 4CLMA 4MM1A 4NNBA 2V82A 3LLDA 3UPBA 4LOCA 3TN4A 1EPVA 1AZ1A 4PL2A 3ARWA 2AGKA 1QVBA 3RX4A 2VI0A 1Y8BA 2I57A 3OYZA 3BGGA 3SW6A 4IFKA 1E70M 1M01A 1XDMA 3QW4B 1EGZA 1DXFA 4MZYA 1T8QA 1H60A 1XC6A 4M29A 3OODA 3OLDA 3AMKA 1M7OA 2IKIA 2NUYA 3EKGA 3A12A 4GJJA 4YYCA 1FBAA 3LX9A 2WSYA 1EP3A 4DJFD 1XSKA 1J5SA 3HO8A 4K7VA 3GH4A 3BV7A 2QV5A 2CBUA 3OB8A 3TXVA 2J7GA 2KX9A 2J7HA 4DWSB 2ZDRA 2PCQA 1LT7A 4B9ZA 1NWSA 2QUNA 3W7DA 3AMGA 5AYYA 2A85A 1TWDA 4Y8FA 4C7FA 3W1MA 1R3YA 4K3ZA 1MDRA 4HSNA 3UJFA 2E67A 1OT1A 4XISA 1G4SA 3BLIA 3T6CA 2H90A 1DORA 1P48A 2X16A 2JALA 2PDHA 3T8QA 2ISSA 2YDRA 2HK0A 3W4RA 2FDSA 2GJRA 4DUVA 3I4EA 3M46A 4D1JA 3DFYA 3M0IA 1OK6A 2FKPA 1OQFA 2VFFA 1GQLA 1QHZA 3WLNA 3DAQA 3OOQA 1UWIA 1QW9A 3N25A 3BAKA 3CEPA 3WJWA 3P62A 3L0GA 4QM1A 4CQ9A 1XGEA 3W75A 2I9UA 2CHNA 2R6OA 3IUHA 1PWMA 4Y7EA 1TCMA 4ASTA 4K68A 2DPEA 2QCFA 3KOYA 4JZ5A 4IH3A 5IHRA 3GAYA 3W7IA 2PTXA 4R53A 3FJLA 4XD5A 1W3NA 3CUFA 3EWXA 2GSEA 3BOFA 2V9DA 5I2UA 3WNPA 2X30A 2BBFA 4M3PA 4NNCA 4R7WA 3E5BA 1CGWA 2ALDA 1JRBA 5FACA 4ERIA 3WD4A 1W9VA 2OT0A 3OO2A 3VNMA 3CV6A 1F3XA 3Q2DA 3FOKA 1XJBA 2HDJA 1LORA 1MO0A 1C8QA 4GBDA 2HBXA 1TV8A 5JIPA 3N04A 1LBMA 4IIDA 3HPZA 4Z2JA 4IGHA 4CVUA 3KM8A 4ZTYA 4S3EA 4RNIA 4B3LA 4CEXC 3DXIA 2XFWA 3PBMA 3VGEA 2ATMA 4GA8A 3NVDA 3W2UA 1E55A 3B9OA 1NY1A 4UTWC 4ZL1A 2X09A 4ZOBA 1Z8AA 1GQKA 5C2XA 1W91A 3P3BA 4UQ9A 1K6AA 4Q4RA 2PTZA 4PCSA 2Z28A 3EWBX 3SCNA 3TV8A 5H1WA 3VC5A 1J0HA 1ZZMA 4UOJA 5LIXX 1EUNA 1A50A 1TZ9A 1AUSL 4IWWA 3JVAA 4FX7A 3SUVA 4D6CA 2FH6A 5I00A 3RK8A 3WBAA 3C0JA 3RCYA 2WHKA 3T42A 3S5OA 2IXUA 1JVNA 1YE4A 2J79A 3EWYA 1IIHA 3MYOA 3SCUA 1J79A 2OYLA 3LHYA 3CL6A 3RU8X 3ABOA 3SZ8A 3LLFA 3T1GA 4MUZA 1LYXA 2Y7DA 2INZA 3VGDA 1D3HA 5CSSA 3RX2A 2BGQA 1H7PA 4B5XA 3A4JA 4GCXA 3HTWA 2JKPA 1K9TA 4HB7A 2XHYA 2JF6A 2ISDA 3SEPA 3W7LA 3LK6A 4HIBA 2YCLB 3T4CA 3UZWA 1E6RA 2GPTA 2WV8A 4KIEA 4YVXA 4P8XA 3P5ZA 2ZTJA 1L8NA 2D3LA 2VT0A 4MAVA 4A8IA 1NDZA 3HFTA 5G4EA 2V81A 5JH1A 2HPIA 4F0HA 4AMCA 4S3BA 4IMFA 2BSLA 4UZSA 4V28A 2VX4A 1OINA 3QW3A 3O1NA 4JGDA 1TA3A 3UT0A