2ZZ6A

Covalent complex of orotidine monophosphate decarboxylase from m. thermoautotrophicum with 6-azido-ump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz6A00
3UWUA 2Z6IA 4OE7A 5FI8A 3FJLA 1LORA 2DZVA 2RDTA 4JTFA 5K9CA 3RNDA 3WK1A 3M5VA 2OZ0A 4YL2A 3O6CA 1C29A 1IXNA 2V9DA 4LC8A 4ICNA 1EEPA 2FLIA 3EX4A 3G1VA 5IBXA 5LHEA 4WOZA 4JIPA 4JICA 4OT7A 4Y9AA 3SY5A 1K7EA 3DU0A 4AWTA 1AL8A 4UR8A 4UFKA 4IPJA 1TQJA 4ML9A 3W7OA 1GWJA 4Q32A 2QDGA 5E93A 2ATMA 2Y70A 5HR7A 4JTTA 3MO7A 4AWUA 5D05A 2AAMA 5LSMA 4NVTA 1TV5A 4LNYA 2QCDB 3S5OA 2GOUA 1DKWA 2ISVA 1MXSA 2J9ZA 2YX0A 2DJLA 5TQLA 4UTHA 2Y7FA 2EAWA 2W6RA 5DBUA 4JY9A 2YW4A 2PCQA 4O18A 4O14A 1XUUA 4MY8A 5DXYA 3P81A 5D09A 3MHFA 2WKJA 4K36A 5LNVA 1OABA 3P84A 4IX2A 4LT9A 3DFOA 1LRNA 3W7NA 3PSVA 4UMAA 3P7YA 5KZMA 2VEMA 3NQ7A 2NWSA 4ORMA 3EWYA 3F4NA 4TMBA 3STFA 4C1KA 3M1ZA 1G6CA 4OU1A 2DZUA 2GPTA 1SQ7A 4YXGA 4H6KA 1TB3A 3P8IA 1ZALA 3W71A 1QOQA 5J5RA 5EKYA 5E1QA 1LYXA 2Y88A 2FFCA 1SFJA 3MI6A 4Y8FA 2FDSA 3W2JA 2HMCA 1G4EA 3GDLA 1YTKA 3W75A 2FB3A 1O94A 4X2RA 5C5YA 3G22A 5AC8A 4YCOA 2KZHA 1XDMA 1DBTA 1LROA 2FPVA 5HQEA 1HTIA 1LM1A 5MHBA 2FTPA 1FQ0A 1Z42A 1SZNA 4M6QA 1Q6OA 2PRHA 5L6UA 5CZJA 2B7NA 1OHLA 1YPIA 3LHTA 5FEPA 4UIOA 4I7UA 2NV1A 3W2MA 3NQDA 2ZCGA 3UXAA 1HO4A 1HFBA 1SW0A 3NDOA 1J2WA 1ONRA 1OX6A 1YXYA 5HWJA 2B7OA 3G24A 2GQ9A 2QCEA 2Q8LA 3CB8A 2J24A 4RKAA 1Q45A 3G3DA 1OX5A 2X1RA 2ZA3A 4N6EA 3TROA 2WQPA 2NLIA 2ZRVA 4HPJA 3DBPA 1JUBA 3W83A 4L4LA 1TO3A 1MO0A 3SECA 3M0ZA 4E2DA 1OJXA 3N3MA 2PURA 1OK4A 2BZNA 1LLWA 2PRMA 1KV8A 5G2HA 2C3ZA 5AHEA 3A23A 1H63A 2LLEA 3W7HA 1WYIA 5CPOA 4H3DA 3TCEA 2A7RA 1AW5A 4A29A 1CI1A 1NF7A 2XN1A 2QCMA 5G2WA 1I2NA 4O0ZA 3P60A 3VE7A 2ZZ5A 3W1UA 4NJHA 2V82A 1K03A 1F6PA 3W1NA 3UZ5A 1H7WA 5AHMA 1GYNA 2DJXA 3LHWA 1SU5A 1VYPX 4UTMA 2V5LA 4JTHA 3PF3A 3W2KA 1A5AA 5F2GA 1OYBA 2GQ8A 4N6FA 2C14A 3W84A 1CW2A 4FNRA 5GVJA 3NAVA 4MYXA 4KFPA 1VH7A 1Z41A 2HTMA 3DENA 3HGSA 2QCCA 4GWEA 2NX9A 1VR6A 3MHGA 1IXQA 2FQIA 4JTJA 3G18A 2ZDRA 4WD0A 1W31A 1FDZA 4FX6M 1OVDA 4FX7A 3NL6A 4AHPA 2QUTA 1QWGA 1LP6A 3ZR4A 1JCJA 3LCXA 3EXRA 1N7KA 2CLIA 2CLHA 3I68A 3L21A 2FPTA 2VOMA 4FX8A 3NNTA 4CNOA 1WAUA 3MBFA 5K9DA 3THQA 4HNVA 3GYEA 3TXZA 1YLVA 5DY2A 3SZ8A 2BWGA 3NQVA 1SO4A 2FPYA 4K8HA 4FB7A 3OVPA 1VCGA 3PB2A 3WJYA 4OQVA 5CZTA 4LWWA 3G1HA 1ICSA 2J9XA 4I7VA 4PL2A 5C54A 5H2ZA 5CZSA 3CU2A 2H8ZA 2VEKA 1L2UA 3TQKA 1PS9A 1ME7A 1IGSA 1TTPA 4DF1A 3DHDA 3MYPA 3PUOA 1DV7A 1GOXA 2PRLA 3LLDA 4GFSA 4XZ9A 1A50A 3P80A 1BKSA 1H7RA 2OT1A 1UJPA 3MP4A 1TPFA 1W5MA 3G3MA 4UFLA 3LTYA 2Z0IA 2QAFA 3FOKA 2W0UA 4AAJA 1P0NA 1OFBA 2VKZG 1GVFA 3NQ6A 1YDOA 2O7SA 3NPWA 3PAJA 3LTPA 4JTGA 2ISSA 1X6UA 5FF2A 4NNAA 3TNOA 2F84A 3FJ6A 3W87A 3FEMA 2TYSA 1D3HA 1H1ZA 3UY8A 1A5BA 4MY1A 4GNJA 2OJPA 3C4UA 2CW6A 3LHVA 3QZEA 1G4SA 3P5ZA 5G4EA 2X16A 3AJXA 3HG2A 3A9IA 3KVMA 2NV2A 1ALDA 2HS8A 1TPB1 4ADSA 6TIMA 1O60A 2ISWA 1H5YA 2J27A 4JTKA 3H54A 3OHIA 4U4MA 3RLUA 2XN0A 3BG5A 2QF7A 3RMJA 3NO5A 5I3HA 1TPC1 2A21A 3GAYA 4KWWA 4N9BA 3NR0A 2DZXA 3W73A 1H7PA 4FIQA 1X8FA 2CZ5A 4ZL1A 3KX6A 5J5DA 1V5XA 4E38A 3TUUA 3B0PA 2YCEA 4IMGA 2ZZ6A 1P4CA 3FS2A 3W1LA 1F74A 4Q33A 4ZZ9A 2NXIA 3GIYA 2C15A 5HJLA 2E1DA 4OGZA 2EF9A 3TIMA 4O11A 4DELA 1NVMA 3MI2A 5CSRA 1KFBA 1TTQA 3HPZA 4HT3A 3W23A 2Y89A 1H7XA 2RH9A 1O5KA 2YZRA 1GQNA 4A2RA 3O6YX 1JUKA 3O16A 1XUZA 5G1YA 3TDFA 2RKXA 4U28A 1F05A 1NEYA 4MZ8A 5F2MA 1KFLA 3S5NA 3FYOA 3ABSA 4WQ6A 3KOFA 3V1PA 5DY3A 2NX3A 3I7RA 1K8XA 2GQAA 2RDUA 1B4EA 2WV8A 4XBKA 4DO5A 1YADA 3C2FA 3GAKA 4O4WA 4DPPA 5HUPA 2AQWA 3TFCA 2V2CA 2GUUA 1UB3A 2YGYA 4CLMA 4WXYA 3TAOA 3E0IA 4EVZA 1I4NA 3WK0A 1KFCA 3N9RA 2F7FA 3QQ1A 1RPXA 3E9AA 2CZDA 4DO6A 5BRBA 4BWLC 1VS1A 1ZAIA 4WXZA 3T44A 4KFNA 1ZNNA 3DKJA 3S9YA 3A5VA 1PCWA 2CLFA 2VELA 4O4VA 3PR2A 1VCFA 4WJEA 1KM2A 1F7BA 1FCBA 1K7FA 1W5PA 4WY0A 1ZENA 2V8ZA 3EX2A 2NWRA 4DBDA 3N73A 2V0TA 3HBLA 4N9EA 3B8DA 1J4EA 3TV8A 3HGJA 3Q58A 4PL1A 3W1RA 3LERA 3TMQA 4JYFA 3QF0A 3GVGA 4JIQA 5D2VA 2NUYA 3IV3A 4RZ5A 1SW3A 3NA8A 1KM6A 3A24A 3VNDA 4R33A 2GJLA 2TMDA 3G1SA 2WSRA 4EIVA 4EWND 1KTNA 2NX1A 4QSHA 4X22A 1YDNA 5I3FA 3STEA 1W8SA 4JX6A 3DHFA 1H60A 4PC8A 3NQ8A 3LCWA 1QPQA 2OX1A 3ZFHA 4LTSA 5LNWA 2E6AA 4OBTA 1PE1A 3MMTA 3E02A 3KHJA 4O17A 4JYEA 2YFOA 2AGKA 5KMYA 3LLFA 2E6DA 1GYLA 3IGUA 3LXCA 1VRDA 3HPXA 3T4CA 4O10A 1JR1A 2Y62A 1ADOA 4WZHA 1TJRA 4LVBA 2H8XA 3EWXA 3JR2A 3O6DA 1VC4A 3IGXA 3I7QA 3LTSA 5G4WA 3W1TA 4A3UA 2WOQA 1JQVA 4CQ9A 3LV5A 4S2CA 5D2YA 1VPXA 1GEQA 1W37A 2A2IA 3E96A 3RK8A 1YTDA 2Q3OA 4LVGA 2V5BA 2QAPA 4FIRA 4HNTA 4IGHA 3NQFA 4WY0B 3GLCA 4LUIA 3H53A 4HSOA 4TIMA 3DFNA 3S5ZA 4UC5A 4IUOA 1S5VA 5D2XA 1BEUA 1X1ZA 5SWUA 1PCKA 1QO2A 3TK7A 4CQ8A 2QJIA 1XBVA 3IIPA 4LS1A 3FKRA 4UNKA 3PG8A 2QCGA 2WNNA 3A5FA 3IRDA 3PC0A 1TTIA 1KM4A 5AOUA 1L6SA 3GXTA 3F03K 3M41A 3GKAA 3AO0A 1X7FA 1JJKA 2GJNA 1NAL1 3NVTA 4IX0A 1ZHAA 3BPWA 3MJYA 3W7MA 2OCZA 5CPMA 5DXXA 3CM4A 5BNKA 3UPBA 3W7IA 3CEPA 1S5WA 3C2EA 4QJ1A 3P62A 3IVSA 2CFFA 1ML1A 4PA8A 3W86A 2G96A 1U5JA 1RD5A 2PC4A 4AHQA 3L5LA 2Y7EA 3NQ2A 3O06A 3ABRA 5E0KA 5FF7A 1DHPA 4H4IA 4O1CA 1QPRA 2ZQ0A 4WUIA 3W2LA 3DFSA 4O1BA 3EX3A 1FY6A 3G1AA 3GR7A 3CIXA 4NUWA 5AHFA 4JN6A 3KRUA 5KSWA 4QAIA 3L9CA 4K6AA 1LBFA 2JKEA 4MZ1A 1RQBA 5G5IA 5D32A 4ZQRA 5G2IA 5CGQA 3WJZA 4E2BA 4O28A 2A85A 1MZHA 3HGOA 1AK5A 1OF6A 1OX4B 4IWWA 1B9BA 3OIXA 1K8ZA 2J6XA 3CWOX 4ONVA 1NSJA 5D04C 4EF8A 3BO9A 5CSSA 3HO8A 4HPXA 2ABAA 1TPVA 4OWGA 3T7VA 3GDRA 4DBEA 3C52A 4JTLA 3G0XA 3LV6A 4MIMA 3S6DA 3U8GA 4O52A 1RR2A 3KVLA 5EPDA 3QEZA 3W7JA 3BG9A 3MW7A 3PSWA 4WX2A 1XM3A 4K38A 2TPSA 1D3GA 1BWLA 1XI3A 2X30A 4FNUA 1RV8A 3W70A 4BFAA 1C8VA 3LCHA 3YPIA 4JY8A 1EUNA 4O16A 3TE9A 4IMEA 1HUVA 2Y7DA 3BLIA 4K7VA 4Z1DA 1B4KA 3CQ0A 1ZFJA 2E77A 4Y90A 4P2VA 4XTDA 5AB3A 1LOQA 2XN2A 5F4SA 1UBSA 1M6JA 3B4UA 4XWUA 1OFEA 1E51A 3HGRA 1BTMA 1KM0A 3NGJA 4JEQA 5AC7A 2G5WA 2A0NA 4BWLA 4P61A 2JGQA 2E6FA 4BI7A 3NEVA 1QPNA 4FO4A 4PCFA 3S1UA 5D37A 5FEZA 3GXPA 4K39A 2VFEA 5AYYA 1RVGA 4PEKA 3EWUA 4MUZA 4MFDA 3L0KA 4PTNA 4CNPA 2ALDA 5D33A 4N02A 5K2ZA 3ZWTA 4POCA 1GVSA 2NUWA 1FWTA 4M6PA 1WOBA 4S2BA 3LCIA 1W5NA 4N4PA 3GDKA 3KRSA 5BOOA 4RV8A 2ZA1A 5H91A 4RZ4A 3USBA 4MVAA 3K30A 3KRZA 3LX9A 1TQXA 2IQTA 3NM3A 3W88A 5KZEA 3BVJA 2DZWA 4LVDA 3W72A 3GNNA 3PY2A 2V81A 3MP5A 1WXJA 3NYZA 1H1YA 2HS6A 3DFTA 1ZY9A 3MHUA 1L6YA 3LGEA 3W85A 3R13A 1EWEA 5AHNA 2BLEA 1AW1A 3F4WA 1GJPA 3PWAA 3MI3A 2P10A 1M7PA 1QR7A 4JTIA 2R91A 3GDMA 3GNDA 3HIJA 2OMAA 1VLIA 1M7OA 1THFD 3N14A 2JGYA 3P74A 2OT0A 3W6YA 5C6MA 4ZQCA 3OVQA 4MJMA 3Q37A 2VENA 1H50A 3W7CA 2C18A 4TX9A 4GUHA 3V75A 2QEZA 4O19A 3O05A 4LRSA 4EOUA 3R89A 3GZ3A 4UNLA 2X1SA 2BSLA 3FFSA 4JTEA 1XBZA 1KFEA 3W1AA 2A6LA 1GVQA 4O54A 3WFAA 2GVGA 4CCEA 2Y85A 5G1TA 2YFNA 1X1OA 4Z1AA 3RF9A 1LCOA 1A5SA 1H7NA 1EP3A 5KINA 3G1FA 5FF3A 3W7QA 5D02A 1QCWA 1QPOA 2ZTKA 1OFAA 2FB2A 5K7JA 4UMCA 3WJWA 1SSGA 3N34A 5CPLA 1RQHA 3LBMA 2ZRYA 3PUDA 5AHIA 3LI0A 2B0MA 5AFDA 2NXGA 4K37A 4UTUA 4G1KA 5FF0A 4AB4A 3G0SA 1W3IA 4N2YA 1UUMA 3CEUA 2ZBTA 2VEIA 4AH7A 3FIGA 4CCDA 1O5XA 1FWWA 2A1YA 2XFWA 1QO5A 1EWDA 3PUEA 3GDTA 3L0NA 1A5CA 1SSDA 2C1HA 4RR4A 3NPXA 5TIMA 3GXNA 4MLJA 3DAQA 4JX5A 2EGZA 2Y6ZA 3PB0A 3P82A 2GVLA 1FCUA 4JX4A 1XBYA 3CTLA 4O0KA 4QITA 3T55A 3D0CA 1I2PA 4UFIA 1AL7A 4DEFA 3HOJA 3IIVA 1EPXA 1QNVA 4BI6A 1R2SA 4M6VA 5F4XA 1GTEA 1W5OA 3L66A 4N4QA 4GUGA 4O8RA 1M5WA 3QH2A 4UFMA 4ZVJA 3O15A 1KFJA 5D30A 3E49A 1K3UA 4MYAA 4Z08A 4ZQNA 4NNBA 2NXHA 3C2VA 4FEZA 4NZJA 5F2IA 3SSJA 1R47A 1XBXA 4LW7A 4IJBA 4UXDA 4ALDA 1H51A 1AG1O 3PS7A 3W2NA 1KV5A 1YYAA 5F1VA 1JCLA 4O57A 4IXXA 1KM3A 3TSBA 5A8GA 3NZRA 1JCMP 5I3KA 1MSSA 4JDBA 1VCVA 1KBJA 3PBYA 4I9AA 3QMTA 4UR7A 3UY7A 3DH7A 3QSTA 4BK9A 1LBLA 4AWSA 1KLZA 3PVFA 2YXGA 4UFJA 1W56A 4XUGA 1S3HA 3A22A 3I7SA 2J9YA 8TIMA 4XQ6A 4XKYA 4NNCA 4UTIA 1B3OA 4Z0JA 3EWZA 2CLOA 1G7UA 5K9XA 3B0VC 5DCBA 5EL1A 3W7DA 1KM1A 1F76A 2P0OA 3DI1A 3ZWSA 1SO3A 2UV8G 1HL2A 1JQXA 1JUEA 2A4AA 3O63A 1L6WA 2QJGA 1XL9A 3NQEA 3PULA 4O53A 5FEWA 1Q6LA 3RU6A 1TCDA 1W5QA 3M43A 4LRTA 2JBMA 5HULA 3LRMA 3GK0A 4HSNA 3G8EA 3DXIA 4LVAA 5K4XA 3UPWA 2WO5A 3FLUA 1LOLA 3S0CA 4GRSA 1ZJIA 4MPQA 3A21A 3B05A 3MUXA 3C2OA 5LGXA 3TXVA 3M16A 4UMBA 4JS3A 1DOSA 4RXGA 4ZQPA 3ATZA 4AHOA 1W0MA 3SGUA 1TMHA 3W22A 4TMCA 5LNSA 3IIZA 1TYGA 3MWAA 4DF2A 3RFAA 4CNNA 5I3IA 3ATYA 3GB6A 3LXBA 5K4ZA 1OFQA 2ZRZA 1G67A 1T96A 4GBUA 1JULA 3R8RA 1VHNA 3LBCA 2ZZ3A 3EX6A 1ME8A 1ICPA 3KVJA 1R2RA 5CPNA 4JTUA 5D03A 4AMAA 3NPUA 1KM5A 4FXSA 4MY9A 1F6KA 3QPYA 4MKNA 3LRKA 3SFKA 2ATSA 3INPA 3LB0A 1FCQA 2QCNA 5CKSA 4LV9A 4A22A 1DJNA 1KLYA 3B06A 1K7XA 4RXFA 4MJZA 3S8HA 2GVJA 1KW1A 1CX9A 3LXAA 1IXPA 1KTCA 1W3TA 5HWNA 3F1QA 4PFMA 3S1VA 4LVFA 3UXDA 1Q6QA 4JD4A 3EWBX 4NJJA 1AMKA 2B7PA 2B4GA 1PVNA 2QUUA 5CZ0A 2C6QA 3W7EA 3W74A 1KA9F 4UTTC 3B0UX 3DZ1A 1T0OA 2CLEA 1OYCA 5F4WA 3LRLA 4MLRA 2CLKA 4JXCA 1OFDA 4ORIA 4JGDA 5C55A 1OFRA 2BX7A 1H62A 1JRCA 3VI2A 3UYCA 1TPDA 2TSYA 5K3VA 4JDYA 3ZS4A 1P0KA 2QUVA 1GG1A 1XXXA 1PHQA 3M9YA 5I3GA 2HSAA 7TIMA 1OFOA 1YXCA 2Y7GA 4R7JA 4YMZA 4ADUA 2YYTA 2QCDA 3B03A 1VJIA 4WY0F 4L4MA 2DZPA 4S1FA 4HN4A 1DJQA 2I14A 3W9ZA 2A7PA 3CIWA 3LCGA 4ADTA 4JR5A 1B57A 4NJGA 3W3OA 5EA9A 1XDLA 3N19B 3TC7A 1FXPA 1G7VA 1LRQA 2VFIA 3PBVA 4YCPA 2QR6A 3Q2DA 3S5YA 4BI5A 3BGJA 1SZEA 2I1OA 3TW7A 1LDCA 1GTHA 4TU1A 5BW6A 1G4PA 1EB3A 3NQMA 3VE9A 3BLFA 3QJAA 3VFLA 3LHYA 1TREA 1XC4A 3NQAA 3LDVA 1P1XA 4KFOA 2ZRUA 1SW7A 4GJ1A 4N9DA 4TR9A 3W7GA 4Z0SA 1TPEA 1WDWA 3GR8A 4RCXA 2WPBA 1R30A 3G1DA 2A5HA 1FXQA 1SO6A 4LY8A 2ZTJA 1DL3A 3NL2A 4UTWC 4ZQOA 2YDAA 5HNRA 2WJZA 3M47A 1OF8A 3NXFA 2QKFA 3KXQA 3LHZA 1SO5A 3OEXA 3TW6A 1SFLA 3QSRA 2ABBA 3TX9A 2QCLA 3KFTA 4LV4A 4XBSA 3W7RA 3EKZA 3EWWA 4TO8A 3NQGA 3IIOA 2R8WA 3L67A 5T26A 1IIHA 3IVTA 4B5NA 2C16A 3SJ3A 2O7QA 3CWNA 5IM51 3CT7A 2H90A 1DQWA 1MEIA 3E12A 4NXSA 1W54A 2EKCA 1TTJA 4CCCA 1F73A 3STGA 3W7KA 1VYRA 3DI0A 4JNMA 3TMLA 3STCA 1ZCOA 1QOPA 1VGAA 2W79A 3NQCA 4FXRA 4ZQMA 1AW2A 4I7WA 3QW3A 3MP3A 3IIXA 3WK3A 5D2TA 5LKYA 1GT8A 1WV2A 3SR7A 3TA6A 4UCGA 4IMFA 3KVKA 2WSYA 2Q8ZA 4WOQA 4RZ6A 3IEBA 2E09A 3WJSA 1Z48A 1K8YA 1TRIA 1NF0A 4C1LA 3U2OA 1VZWA 3CHVA 1MEHA 1WOAA 1C9DA 4IMCA 1ZAJA 1N8FA 1EP2A 3BW4A 3S1WA 2VXNA 1UUOA 1I2RA 4EF9A 1WBJA 3THAA 4O13A 3PG9A 3O8AA 5HWMA 1PV8A 1JCXA 1EX5A 3C2RA 1QDSA 1FDJA 2D73A 1I45A 3M6YA 3HG3A 1A53A 3HF3A 1WX0A 2VC6A 4UTJA 5U7SA 3R5EA 4NJIA 3NG3A 4HNUA 1DORA 1IF2A 4RJEA 3TAKA 3W1XA 5EY5A 3U6WA 4DF0A 3QMRA 3HG4A 2P1FA 3M7WA 1GZGA 5TBOA 3LHUA 4FHAA 3UQNA 3G1XA 3T40A 3CPRA 3QRHA 4UFHA 4NZFA 2VFHA 4ZMGA 3RLVA 4OV9A 2WSQA 1TV8A 1UASA 4OV4A 2WNQA 1XFBA 4QISA 1IXOA 1BWKA 3GX9A 3HMJG 3IVUA 4Q4KA 4DPQA 3HQ1A 2A6NA 5KTLA 1FWSA 4HIBA 4N9CA 1LBMA 4UTLA 1KBIA 4UTTA 3UNDA 3UWQA 4JTSA 1FUYA 1SZFA 3M5ZA 1PL9A 3W76A 2RFGA 3BV4A 3W7LA 4Y96A 5D2WA 4O50A 1YDVA 3BGGA 4A21A 5HR6A 3FYPA 1P5BA 3L0GA 4FNTA 1Z44A 1T8XA 3FKKA 4LS2A 1EA0A 3BW2A 3QPZA 4X3ZA 3MBDA 3SGZA 3B04A 4K8EA 3T78A 1QMLA 1RZMA 3NL5A 3LOTA 2G95A 4AF0A 1EIXA 3QW4B 1DQXA 2FIQA 4LU0A 1D9EA 2X1TA 3HJZA 1V7YA 1TIMA 2BTMA 3P61A 3TQVA 2EHHA 3ABQA 2CU0A 4MZYA 4FNPA 5CG7A 4QQ3A 2H3BA 5LNUA 4KKXA 1LZOA 3M44A 3NZ1A 2R14A 1S5TA 2C13A 2CWNA 3LCLA 4RX0A 3LI1A 3C3NA 3TSMA 1GVOA 3P67A 4O1DA 3UD6A 3EEGA 1QAPA 5DLCA 2E68A 2VFFA 3PBUA 1FCVA 1JVNA 4GUFA 4QIUA 4KWVA 3QM3A 4M7SA 4GE8A 1EP1A 3L2IA 5AC6A 4DQWA 1K02A 5LHFA 4K7YA 2ZRXA 1FDYA 1LTDA 3KAOA 4R34A 1O4UA 4BF9A 1F2JA 4UTWA 1L9WA 2PE4A 6ALDA 2DU2A 5F1UA 1F5ZA 4MFEA 3TJLA 3SI9A 2B7QA 1QFEA 4MOZA 5FEXA 1SPQA 3W07A 3DFQA 3S42A 4IXHA 1TPWA 4NX5A 5DCDA 1YPFA 2YYUA 3EXTA 2CLMA 3QC3A 1SZGA 4FNSA 2YW3A 1VHCA 4DO4A 5DELA 1H7OA 2JKAA 3LM7A 4PH6A 1HO1A 3SIZA 5ABTA 2NUXA 1FWNA 3O07A 2ZA2A 3W1MA 3WJXA 1XKYA 4HNNA 3N9SA 4AVFA 4O12A 2DZTA 3C61A 4AF0B 3L5AA 2CZFA 1LRTA 2ZZ7A 2QDHA 1GPWA 3C6CA 1TSIA 1XCFA 5U4NA 3N2MA 2A7NA 5IBXC 1Q6RA 2JK2A 1VYSX 2BXVA 2Z6JA 4O1AA 4YWIA 1WA3A 3W7PA 1JCYA 5KZDA 1W1ZA 3DGRA 1VQTA 4NQ1A 5KITA 3QFEA 3N2XA 2QCHA 2G97A 2QJHA 5L9FA 3G1YA 1H61A 1G69A 2E5DA 3TR2A 1W3NA 3QMSA 1U83A 5DBTA 3L5MA 4Z1BA 4J9JA 1OK6A 2V2DA 1O95A 2X1UA 2ZZ1A 3TFXA 1I8JA 3S1XA 3UZJA 4RK8A 3R2GA 3C8FA 3PM6A 4QNEA 2CLLA 4E0CA 5BMXA 2Z1BA 2R94A 3HB9A 1R46A 1HG3A 5LZLA 4LUJA 4X9SA 4QM1A 4GUJA 2VEPA 3R12A 3UWZA 3ELFA 1ME9A 4R53A 5LGZA 3QQ0A 5EMUA 1I2OA 1ZAHA 3FA5A 4CQAA 4D2JA 1TRDA 1PIIA 3BK0A 5FESA 1G4TA 3M5YA 2Z2UA 3ABOA 1EUAA 4IPIA 3NL3A 2Y63A 2E5CA 5AHLA 1YTEA 3BW3A 3BG3A 3C56A 3G0UA 1GVRA 4BR1A 1JRBA 5C2XA 4LOCA 1Q3NA 1WBHA 3QYQA 3W1QA 5FF4A 3Q94A 2J88A 4O15A 1PHWA 2RDWA 2JKPA 2V30A 1GG0A 4NXKA 1FX6A 2DORA 4HKPA 4AEOA 2VFDA 5LNRA 4LC6A 4FNQA 1ICQA 2TRSA 3OBKA 2E6YA 1N55A 3W1PA 5AYXA 2WNZA 5D38A 4DXVA 5EYWA 3P8JA 2ZZ4A 1MEWA 3L68A 4XKYB 1R2TA 3ANYA 3CC1A 1I2QA 3BLEA 1Y0EA 5HUOA 4NT0A 3EB2A 3SW6A 2Q3RA 3C0JA 3IGSA 2ZZ2A 1LLZA 2C19A 2YPIA 3BARA 3P5YA 2C0AA 2DP3A 4IMDA 4AXKA 3O1NA 3WK2A 4GUIA 5HINA 1TJPA 5HMSA 3NOEA 3TJXA 3TKFA 3PBWA 1SUXA 4OHQA 1FWRA 1J5TA 2DZSA 3VCRA 1UCWA 5EBUA 3UWWA 2Y61A 1IIGA 3UWYA 4HHPA 3VKJA 3HPSA 3TC6A 2E5BA 1VLWA 3M5XA 4FF7A 3MYOA 1RQEA 4Z1CA 4M19A 3CLMA 3DKLA 3L65A 2X2GA 5I3JA 3OG3A 1YXDA 3LCFA 2NZLA 1LOSA 4NX0A 4NJKA 3I6RA 4RLIA 3EKLA 5AN7A 4IOTA 4UUIA 5AYZA 1SR9A 1TV7A 1OYAA 5A5WA 1KTBA 2QCFA 5F2LA 3JRKA 1TPUA 2EPHA 1NFBA 1OG0A 3HG5A 4IQLA 4M5PA 4YLWA 1JCNA 4JYDA 3TSDA 2YR1A 3OVRA 2ZFAA 2VFGA 4UTKA 4GC4A 2H6RA 3OA3A 1TPH1 2CZEA 1FBAA 1OX4A 3NM1A 3UWVA 3TQ0A 4QNWA 2I9EA 4NU7A 5BMWA 2YSWA 3TH6A 3EXSA 4XTIA 1KFKA 5DCEA 1OFPA 3EX1A 3G8RA 3NPVA 4GXMA 4LS0A 2ZRWA 2RHGA 1WQ5A 4M7TA 3TU9A 4Y6GA 3DFPA 3H55A 3I65A 4PODA 1T99A 2ZYFA 2V2HA 4W9TA 2FJKA 4A2SA 3JS3A 3W2UA 5DN1A 1DVJA 3GKFA 2H3DA
chains in the Genus database with same CATH superfamily
4H9VA 2Z6IA 3OTRA 2DZVA 1HX0A 2RDTA 4PMXA 1E9ZB 2XH7A 2BY0A 1C29A 4LC8A 1Q4NX 3B8UA 1EEPA 2FLIA 2WW5A 3EX4A 5IBXA 5LHEA 4WOZA 4JIPA 4JICA 4B5VA 4CD5A 5M5DA 4OT7A 5I2UA 3SY5A 4D6JA 3URNA 3TONA 4IPJA 3SCOA 3D46A 4ML9A 4RNHA 5E93A 4Q32A 4MNJA 3AMKA 2ATMA 3DFHA 4AWUA 1TV2A 2AAMA 2DZBA 4PUEA 3UR2A 1TVNA 5LSMA 3OO2A 2GOUA 1XYLA 3SADA 4F0MA 4GMEA 1AJ0A 1D3CA 5HMDA 2Y7FA 2HROA 3QZ6A 2G4JA 4F0KA 4O14A 3R0UA 5DXYA 3P81A 2XFFA 1BRLA 2CEQA 3MHFA 1DEDA 2WKJA 2BGNE 5CCZA 5LNVA 1OABA 4IX2A 3WYZA 5BCAA 4LT9A 1OCBA 3CL7A 5CJNA 5A8NA 3TLLA 1POJA 4DI8A 1ZCCA 1NWUA 3LM3A 3VX1A 1RH9A 3M1ZA 3R94A 2EO7A 5EBAA 1ZPTA 4GPNA 1OCJA 2D2JA 3W71A 2XVNA 2QPUA 1F8IA 1JGMA 4AZGA 3VD9A 3NSXA 3PZUA 3ARQA 1LYXA 7CGTA 2FFCA 2BHUA 2Y24A 2D24A 4QE1A 1CCWB 2OLSA 4W84A 2FB3A 1O94A 3H7UA 1S2VA 4PTWA 1UPPA 1ISWA 4X2RA 3G22A 1TWIA 2YXXA 3AALA 1XDMA 1LROA 5HQEA 1LM1A 1R7AA 1M1BA 2FTPA 1Z42A 3MU7A 5TNVA 1E72M 2YOCA 3SN4A 4K68A 2VHLA 1OHLA 3OGSA 1ZLPA 4I7UA 4IPLA 4TXEA 3W2MA 4GYFA 1UR1A 3NQDA 2BV9A 2ZCGA 1HO4A 1SW0A 5KEZA 1OX6A 2B7OA 1AA1B 2Q8LA 3GDBA 3GS6A 1EZWA 2WHMA 4N6EA 1RP8A 2VI0A 4GO8A 1Z69A 4DBUA 3AWNA 3BAJA 2GWNA 4XK2A 4S3DA 4NG3A 1V8EA 2EJ1A 5MKGB 3Q65A 2BZNA 1LLWA 2PRMA 4JTAA 3BSMA 1KV8A 1XIMA 5G2HA 7TAAA 3R11A 3A23A 4XD3A 2LLEA 1WKEA 1CPUA 1CI1A 1NF7A 2XN1A 4O0ZA 4W4QA 2Z2BA 3PTQA 3VE7A 3W1UA 5T8GA 4CEUC 3F5JA 3UZ5A 2HJPA 1H7WA 1TFVA 2XZ7A 4YYFA 2P3ZA 4UTMA 4JTHA 3PF3A 2AL1A 3VOHA 3MWCA 1YE4A 1RBLA 2GQ8A 4N6FA 2DEPA 3G5EA 1XLBA 4KFPA 1KBKA 2HTMA 2ACQA 1F3EA 2NX9A 2D2GA 4LQ1A 3MHGA 3NZPA 1VKFA 3UGVA 1IXQA 3G18A 4WD0A 4NYUA 4WJ8A 4TVCA 1R9XA 4JKKA 4CNSA 1I0DA 2QUTA 1TWWA 1QWGA 3LPFA 3WH9A 3V36A 4QDMA 3FY1A 4GH1A 2CLHA 3CAWA 1JDDA 4E8GA 3SZ8A 3NQVA 4K8HA 3EPMA 4JQ3A 3ZSSA 2AAAA 1VCGA 2G37A 4OQVA 1IEWA 4LWWA 1EYWA 1O7AA 3E0VA 1PB0A 4HTBA 5IXEA 4LEFA 1L2UA 3TQKA 1ME7A 4XAFA 4WKAA 1EOKA 3L4ZA 1DV7A 3LLDA 1XH2A 2PRLA 3GIQA 2BVYA 3QPEA 1UJPA 4ZO8A 3MP4A 3N9KA 2OO6A 4UFLA 2NQLA 1U1UA 2Q09A 2Z0IA 3T05A 3DG3A 4DHGA 1V6VA 4QE5A 1Y5XA 4JTGA 1E1FA 4JTDA 1MWOA 3CBWA 1A5BA 5DEZA 2Z1SA 1G4SA 3P5ZA 2E8YA 3AJXA 3HG2A 3A9IA 1TPB1 3QGVA 4ADSA 2ISWA 1H5YA 4MNKA 4RNFA 3EA3A 4DZIA 4FA3A 2QF7A 3RMJA 2W63A 2A21A 3GAYA 3U9IA 1E4IA 2GOKA 1ADDA 2BFGA 1QNRA 1J79A 3K8MA 4C6KA 4ROQA 3KX6A 1V5XA 1X96A 3K1DA 3B0PA 2ZZ6A 3FS2A 3LK6A 3MSRA 4GVHA 2WZTA 3RR1A 3BAIA 1K8CA 2WVVA 4FLRA 3TIMA 1PO9A 4P7RA 4DXXA 4DELA 1V6TA 4JCMA 5CSRA 1KFBA 1TTQA 2V63A 5CSUA 1KXHA 1FTXA 1H7XA 1JZ4A 4NI8A 3ZLFA 1TZZA 5A2BA 2ZUSA 2CXGA 4U28A 2XGIA 3FYOA 3ABSA 1K8XA 3G1RA 2C79A 4DO5A 4G5DA 4PUDA 4O4WA 2PP3A 3TFCA 1X97A 3A64A 4WXYA 3TAOA 4CU8A 4FR1A 1Q6EA 4HMCA 3N9RA 4IGNA 4J3XA 4HA0A 2G8ZA 1JD7A 3E9AA 1UD2A 4BWLC 4IP5A 2ADAA 5C7VA 4AY1A 3DHPA 1ZNNA 5BRQA 2VDIA 2P5NA 4LJ3A 4XIAA 2CLFA 5H1WA 3H4XA 4Z2HA 2BOEX 2WBGA 2WB5A 4B92A 3QFWA 1U5HA 1F7BA 1W5PA 1U22A 1LG1A 3CLWA 2F38A 4DBDA 5CBIA 3N73A 1NQ6A 3WLKX 2V0TA 4YPJA 4N9EA 3AC0A 4GC3A 3B8DA 3BCFA 3TV8A 3UJRA 3HGJA 3Q58A 4JYFA 2OLAA 3QF0A 3GVGA 4JIQA 5IFPA 2V5KA 3IV3A 5BZAA 3H8AA 3G1SA 2PLMA 1EJTC 4QSHA 3ABZA 1H60A 4RV3A 6REQA 1QPQA 5LNWA 2RGMA 4OBTA 3WLMA 2PDCA 4EWJA 1X6LA 3K1GA 3KHJA 4O17A 3WBXA 3KW3A 1IWAA 4AC1X 5ABFB 1MRAA 3LLFA 1CENA 1XLKA 1GYLA 3S2MA 3LXCA 3DC0A 5T9CE 1V7AA 1M68A 1ADOA 4LVBA 3EWXA 3O6DA 3JR2A 5AVNA 4NAEB 3LTSA 3U5UA 4CQ9A 1KXTA 4IL0A 1GEQA 5FJRA 2A2IA 2VT0A 1IR2A 3E96A 3RK8A 1YTDA 3AXHA 2V5BA 4YWSA 1EC8A 3H53A 5A69A 4U5IA 3DFNA 3HA1A 5DMNA 4IUOA 1S5VA 5SWUA 1PAMA 1QO2A 3TK7A 1FWJC 1Q13A 1FWCC 4EXAA 1LT8A 5RUBA 4XAYA 3PC0A 3KRBA 1AUSL 3M0YA 3UNTA 4GACA 4IX0A 1JJKA 1J6PA 3BPWA 3MJYA 3W7MA 1F6YA 2OCZA 3WEOA 4L6OA 3T81A 1L8PA 3W7IA 3CEPA 3CUGA 4L9ZA 3C2EA 4AYGA 3JUGA 3P62A 1OY0A 2NVCA 4R3UA 3HPAA 2CFFA 1ML1A 1A0DA 3SQSA 1E6PA 1GORA 1RD5A 4S3AA 3SURA 2HWGA 3FW6A 1RJPA 2DW7A 3AIRA 1W8GA 4WHBA 1FHLA 4H4IA 4UQCA 1A5NC 3W2LA 2L5HA 5AHFA 3CB3A 5KSWA 5D32A 3TTYA 1J8VA 3WJZA 4O28A 1EBGA 3VCCA 5CC5A 3M6DA 3TYZA 1OF6A 1B9BA 1EQCA 1X38A 1KBBA 2J6XA 1G01A 3PP7A 3TQPA 3T2OA 3VDAA 2EG6A 1RCXB 2DSUA 4HPXA 4ZSTA 1XW8A 4M29A 3LV6A 4UOQA 3I6EA 4MIMA 1RR2A 3BWWA 5EPDA 3KBWA 3CUIA 1TJ2A 5XIAA 3PSWA 3HU7A 1XINA 1M04A 1XI3A 2X30A 2QJNA 3AROA 4JY8A 2FZBA 3TE9A 2G3NA 2OZTA 3BLIA 4Z1DA 2J13A 3EOSA 1B4KA 1YMYA 1E9LA 3B8WA 1YW1A 1BGAA 3UA4A 3VKKA 4KIEA 1UBSA 4XWUA 3VIOA 3UYIA 3NGFA 1K9DA 1GOKA 1E51A 1J0IA 2ZADA 4GYKA 4PMJA 3KOYA 4JEQA 4ZFMA 5I00A 4P61A 2CERA 1OCQA 4Q3MA 2OTDA 3S1UA 4IFOA 5D37A 3ZT6A 5DRIA 4K39A 5ENLA 4S3KA 4CQCA 4PEKA 1M7XA 2PU1A 4QGCA 3KBSA 2ALDA 5K2ZA 3ZWTA 3N2OA 4POCA 3H4GA 1GK8A 3FN9A 4S2BA 3UVIA 4DBWA 2YCJA 1JPHA 1H0IA 1NOUA 4RV8A 2XFYA 2NVDA 2JF6A 1ZBCA 4MVAA 3K30A 3LX9A 3WQOA 3PY2A 4ILSA 3MP5A 4QFUA 1H1YA 3NYZA 3W85A 3IPWA 4R5EA 4ERAA 3F4WA 1GJPA 3PWAA 3VOCA 2WMFA 2VC7A 3ARTA 1EO5A 3GDMA 3HIJA 2NQJA 1NFPA 2UY3A 4XZMX 1M7OA 2JGYA 3GYCA 3KOZA 4MJMA 3Q37A 1HJQA 3V75A 1BVWA 4LRSA 2QVHA 2QXWA 2RAGA 3GZ3A 5A6SA 1DIDA 1XBZA 1J9YA 4H7VA 4JIEA 2GVGA 2Z2AA 1HL8A 1TJ1A 3HQPA 2INFA 1EP3A 5KINA 3G1FA 4QX4A 3CYVA 5K7JA 4UMCA 4B3ZA 1SSGA 2Y8UA 3AU2A 2TAAA 1RQHA 5AHIA 1VJSA 1XLGA 2B0MA 3GXFA 2NXGA 1ZU8A 4G1KA 3BZGA 3VYLA 2ZBTA 4WVXA 8RUCA 1LL7A 2PTDA 3E3HA 4B9YA 3WUGA 3FHQA 4RE3A 4CCDA 1O5XA 3MCOA 2H9AA 3LQLA 2D3NA 4QEHA 3DYOA 1XP3A 2QZRA 2VC5A 4CEXC 4KRZA 2XFWA 1BHGA 1EWDA 3PUEA 3GDTA 1ZZMA 4HMNA 3NPXA 4GQGA 3RYSA 4MLJA 4FALA 3PB0A 3P82A 2GVLA 1PPIA 3BGAA 1BPLB 3I3EA 1FCUA 3CZKA 4QS5A 3D0CA 4UFIA 2ZUTA 1AL7A 2I5GA 3BLDA 3IIVA 4EXQA 1DJXA 1UP0A 4HU8A 1F4HA 1XGZA 4N4QA 3WLIA 3L4XA 4GUGA 1U33A 1M5WA 1S38A 1Z3NA 3ARSA 1RAKA 1E6ZA 4CD7A 2PU0A 3SB0A 4QSFA 5D30A 4Q8WA 4Z08A 1QNPA 2OYKA 5F2IA 3OLGA 3UJSA 3F2DA 4IJBA 4CU6A 2WSKA 1AH4A 4HBKA 3W2NA 1YYAA 2BXYA 4S38A 3WCZA 1JCLA 4O57A 2HV5A 1KM3A 2OU4A 1UH2A 3TSBA 5A8GA 1VBJA 1DWGM 4AVOA 4JDBA 1VCVA 4I9AA 1JEZA 4QP0A 3WO8A 3PZOA 3A22A 4PMQA 3EPNA 1V03A 3M4HA 2YCIX 3LBOA 2Y1HA 4UTIA 3OB8A 4JKMA 3REQA 1RD6A 4KGLA 1PIGA 4GQ0A 1IT7A 2Y5JA 2IKJA 5EL1A 4WK9A 1UPMB 1YBQA 3BMXA 3A4WA 2X8RA 4W8LA 2A3EA 1SO3A 4IGMA 3BLOA 4KWSA 2PF0A 1AQFA 1MMFA 1V3JA 4V33A 5FEWA 3LUTA 1Q6LA 3LGDA 3WY1A 1W5QA 4MWAC 4B9ZA 4GZIA 1ITXA 2PUZA 4LRTA 3CMJA 2DUAA 2JBMA 3GG1A 3WF4A 2GL5A 2VR4A 3F2BA 3VKBA 3AXMA 2ZUMA 3UPWA 1EZ2A 1LOLA 1S46A 3WD4A 2WK2A 4GNVA 4P8WA 3MUXA 5LGXA 1VD6A 2OLHA 1BXBA 3WDHA 3KCLA 3ATYA 5JQ9A 1OFQA 1ENUA 1G67A 4F0RA 4HD5A 4GBUA 3LBCA 1HL9A 1LQ2A 1XFCA 1WUEA 2OZ8A 4OBSA 3WLTA 5D03A 2OODA 3CS2A 3INPA 3R4IA 3IANA 3LB0A 4V27A 2FZNA 2Z7KA 2HE8A 1KCKA 3CUHA 4LV9A 1DJNA 1ZBWA 3B06A 1D7FA 3TZFA 4OJYA 2IW0A 3WNNA 1IEQA 3SEPA 3MQTA 1REQB 4QG6A 3N29A 3E5PA 4AQLA 2WVUA 4RPPA 3OIHA 1E73M 3S1VA 4LVFA 3WL1A 1AMKA 4RDWA 6ENLA 4UZUA 3WQWA 1AZ1A 4I8YA 3W7EA 3BJSA 2ZUVA 1QTWA 3TEVA 2CLKA 2CNCA 5HNTA 3RX2A 2XH2A 4Q8MA 5C55A 1E3ZA 4ATWA 3VKDA 4HOXA 3OLEA 4D1IA 1Q65A 3UYCA 2W92A 4Q8PA 5K3VA 1P0KA 1W91A 3M9YA 4Q6XA 4DLFA 4ZB0A 1YXCA 4HVXA 2Y7GA 3UERA 3A9BA 4YMZA 2VZTA 4C6JA 3ENLA 2PTZA 2YYTA 4FI4A 7XIMA 4WY0F 3BL3A 1OSEA 5LIWX 3MTWA 1DJQA 4DXKA 4AX6A 8XIAA 1K4GA 4AG0A 5A2AA 1CLKA 1JDCA 4H7ZA 2VFIA 3PBVA 2PDXA 4HQVA 4BI5A 3L4VA 3D47A 3TW7A 1NJJA 4TU1A 5BW6A 4OOZA 3NQMA 3VE9A 3QLDA 1C8QA 2X0SA 1QRQA 3LHYA 4H00A 1XC4A 5TD4A 3PPGA 3NQAA 4KRTA 1P1XA 2DSKA 2ZRUA 4N9DA 3H2MA 3RPDA 2VOTA 3GR8A 4RCXA 1HKWA 2A5HA 1FXQA 4LY8A 2ZTJA 3SCVA 2GVYA 1W3HA 4MM1A 2HE5A 5HNRA 1V6XA 3ZYZA 3I6TA 4JTCA 2XIBA 1KC7A 2Y8VA 1C8YA 2QKFA 3FX4A 3KXQA 4XB3A 4NIRA 4PUJA 4PB3A 3TTSA 5FA5A 4URIA 4GG9A 2PDKA 1EIBA 1I1XA 4NRRA 1SFLA 1TWSA 3QSRA 4EP8C 4QQUA 5GJNA 1L8NA 3TX9A 2WCSA 1V79A 2JIEA 2XIJA 3MDUA 3W7RA 4XZLX 1B9ZA 3CPGA 3FVMA 1WKFA 1W1IE 3CNYA 1EEXA 2OVLA 3UF9A 1O66A 3CWNA 1XYBA 4M56A 1JZ3A 3GFYA 2H90A 2VCAA 1QW9A 1DQWA 5DQPA 3GR4A 1W54A 3EA1A 3NIYA 4CCCA 3M0MA 1QOPA 1NFGA 2VRJA 3NQCA 3BE7A 4ZSUA 2Z28A 1A5UA 1T6MA 3B97A 3S3GA 3IIXA 2OWXA 3WK3A 3T8QA 3TA6A 2GGIA 5MKGA 3B8VA 4PTVA 3N11A 1HF6A 1E4LA 1IEIA 2HRWA 5XIMA 4GY1A 1QJWA 3ZR5A 4BEQA 4HPGA 5KZ6A 3OG2A 3UG4A 4I6VA 5AKQA 3W6LA 1Q6CA 3BSHA 1AVAA 4XZNX 2NQ5A 1F4AA 3FGCA 3GHRA 5EMLA 3N6HA 1R5YA 1DWIM 4JL2A 1I2RA 4D6GA 3THAA 5HWMA 4LBUA 2D73A 1I45A 3GO2A 4LUYA 2R24A 3M6YA 2D3LA 4XG1A 4ZE5A 3SJNA 4NJIA 3VNKA 1DORA 3WLQA 4S3EA 2CBJA 3HG4A 1GZGA 3LHUA 4W7WA 3G1XA 3T40A 2WJFA 5HJYA 4NZFA 2BBFA 3DESA 4H83A 2DGAA 3QVQA 3CUXA 4ZA0A 1SM9A 3SQMA 3IVUA 4JOMA 1L6GA 4UQAA 4KF1A 2PWGA 3W02A 2A6NA 4H8UA 1FWSA 4HIBA 3RN6A 2JE8A 4UTLA 3VNYA 5BU9A 3IWPA 3UNDA 3UWQA 5LYRA 1QBAA 1SZFA 4DJFA 3M5ZA 2NQHA 4AW7A 3W76A 5DX7A 3BV4A 3SY8A 3RCYA 2VC9A 3QGAC 4L1GA 1JDAA 4JHMA 1YDVA 1Q7ZA 3VOIA 3ZJKA 3FYPA 2HBVA 1Z44A 5A6JA 3VGDA 1T8XA 1QK0A 3NO1A 4Y2WA 4QG9A 4QCFA 1EA0A 3BW2A 2ZX6A 4OUEA 3MMDA 4K8EA 1O1HA 3CO8A 1RZMA 4G1NA 4PCNA 3WBYA 1DQXA 3WLPA 2VUYA 1D9EA 3AIVA 1J0HA 3TQVA 1FH8A 1UKPA 4M81A 1ODZA 2CU0A 2IPWA 4FNPA 4DUWA 2H3BA 4ZTYA 4E4PA 5E9AA 3DYPA 3RXZA 3M44A 2B81A 3UJFA 1S5MA 1HVQA 2VJXA 1BYCA 1FH9A 3TSMA 4KPLA 3UD6A 3EEGA 1X39A 5DLCA 2POTA 4N0RA 1FCVA 4GUFA 4KWVA 4M7SA 4GE8A 3L2IA 4DBSA 2XH4A 1EGMA 1K02A 3EWDA 4K7YA 4Y9OA 1D2KA 1FDYA 4AIOA 5C2CA 1KCZA 3B8IA 1O4UA 2GDVA 4FSAA 1F2JA 4LCRA 1B54A 4O0QA 1U1HA 2PE4A 2DU2A 1K4HA 1F5ZA 3TJLA 2MANA 1E0TA 1TPWA 4NX5A 3OJGA 3EXTA 4OUIA 1O5RA 4GA8A 3QV7A 1Z8AA 2IS7A 4UCFA 2ZXQA 3XIMA 4F9JA 4LEQA 4YTSA 4F40A 1J10A 3VDGA 2GGJA 1FWNA 1K77A 3OQ8A 3W1MA 3WJXA 4HNNA 3WFZA 2ZOXA 3SRDA 4C6PA 3ARYA 3UJEA 2QDHA 1J11A 1OINA 3GU1A 1PXGA 5U4NA 4IQEA 5IBXC 3IARA 1VYSX 2BXVA 2Z6JA 4YWIA 4BZYA 1JCYA 2PS2A 4UQ9A 5KZDA 4LYQA 4NKCA 3DGBA 1P48A 3UR8A 3V4BA 4NQ1A 5KITA 3TN3A 2O4QA 3VXGA 3SN1A 3MB9A 2G97A 3W82A 1H61A 1UKSA 4JPGA 1NH6A 2E5DA 1U83A 1XJBA 4GI4A 4Z1BA 2YA0A 2ZXBA 2ZUUA 1SFSA 4RE2A 1I8JA 5REQB 3CT2A 4RK8A 3MT1A 1V6UA 3R2GA 1VF8A 3PM6A 1UYQA 3ZO9A 2BVTA 4E0CA 5BMXA 1R46A 1NWSA 1HG3A 4X9SA 2VEPA 1E1CB 5LGZA 1B1YA 4FS9A 3QQ0A 4R9OA 1I2OA 3TOPA 2DSVA 3ZZ1A 4PMOA 3KCOA 2O56A 4HA4A 4E8CA 5FAJA 2D23A 1HKJA 3ABOA 3NL3A 2E5CA 5AHLA 3WKZA 2OGYA 3BW3A 1E71M 2WMIB 3C56A 3G0UA 1JRBA 5C2XA 1Q3NA 2WJEA 1JYNA 2GGGA 1NARA 2J88A 4F66A 5ABFA 1PHWA 2RDWA 2JKPA 2OKTA 5BU6A 5LNRA 4LC6A 4FNQA 2FH6A 5ABEA 3VIJA 3W1PA 5D38A 3HPFA 2ZZ4A 2UY2A 3U4FA 4XKYB 4NAEA 3WLHA 5JIWA 3SW6A 5D8WA 3BANA 3IGSA 2Z26A 3OZOA 1LLZA 1NOFA 3P5YA 3IV8A 1XSKA 1IGWA 1PKYA 3VVGA 3MKKA 1TZ9A 3C0LA 3JZEA 3NOEA 4AZIA 1DJGA 4JTQA 3HTWA 1VIWA 3ES7A 1SGJA 4H8NA 4IF2A 2E40A 4H1ZA 4PMRA 1XH1A 1IIGA 2Y2WA 4Z2IA 2PSNA 3LGGA 3HPSA 3VIMA 1B3WA 2WXDM 2X2YA 1VLWA 1RQEA 3T09A 3DKLA 2ESCA 3CUFA 2X2GA 2FGLA 5ABHA 3W25A 2NZLA 2VD8A 4IOTA 4UUIA 1AQ0A 4QJ3B 1VRXA 4YU1A 5CEWA 3H22A 2QCFA 2NVAA 3JRKA 1XPGA 2EPHA 1NFBA 3HG5A 4M5PA 4V28A 1T40A 1FHVA 1HJXA 3OVRA 1W9UA 4JIRA 2ZFAA 1OIFA 5D9MA 1PKLA 4GC4A 3VM5A 3WIJA 1XCWA 2H6RA 3LENA 2CPUA 4L80A 3UWVA 3BUVA 4NU7A 3TH6A 3EXSA 4HK7A 1KO0A 3LNMA 4GY7A 2XM1A 5E6ZA 2OO0A 2E25A 1Y8BA 1WQ5A 1XIHA 3WUBA 5AC5A 1TCMA 3DFPA 3H55A 3I65A 3MY9A 5HANA 2ZYFA 2V2HA 4HHLA 1WP6A 1RLCL 1Z89A 1P43A 4DO7A 3CMFA 3GKFA 3AS3A 3FJLA 4JTFA 2PZ0A 1VB9A 3M5VA 4YL2A 3GVQA 1IXNA 4BF7A 3G1VA 3LMZA 2XUCA 4LF2A 1JYVA 4JFSA 4UR8A 1TQJA 3PNZA 1TA3B 2QDGA 3TR9A 3MO7A 5D05A 3A3HA 1RHCA 1NWTA 1MXSA 3B8SA 4HZMA 4AD0A 3VFCA 2EBNA 5TQLA 1YE6A 4UTHA 2EAWA 1EOMA 5JBFA 2PCQA 2OSXA 4O18A 3Q4DA 5IFTA 2GSJA 7REQB 4BQ2A 1XUUA 4MY8A 2AGTA 1J01A 3UR7A 3GNXA 1FKXA 5D09A 4X60A 4JQAA 3LN3A 4Q8OA 3VD3A 3S9IA 4GOAA 5HQMA 2HVNA 1EJWC 1JXKA 3PSVA 4UMAA 4W93A 2A3HA 1LF1A 2VEMA 4Z2LA 2X7VA 3GUWA 3ITLA 2ODOA 1UD4A 2GPTA 3TCSA 2IQ0A 1VJZA 1TB3A 3P8IA 1SR0A 3V0SA 5J5RA 1B3ZA 4AXNA 3ZOAA 2VTFA 4XAGA 4ACYA 3N2BA 2Y88A 1EGZA 2VNCA 2QUMA 4Y8FA 3W2JA 3GDLA 1YTKA 3SAZA 2G50A 4HB7A 3ANVA 5AC8A 2KZHA 1E0XA 3TWBA 1HTIA 2UY4A 3SRFA 2EQDA 2NT0A 3EAUA 3GHTA 1JAEA 4M6QA 1AZ2A 2PRHA 5L6UA 3SCUA 1QI4A 2P0IA 2A79A 2CHNA 3T1GA 5JUVA 3Q45A 4LFYA 2ZUWA 4DNHA 3BAWA 1BVZA 3EB3A 1CXFA 2OQLA 5HWJA 5I79A 3G24A 3PJXA 1BD0A 3VGEA 2IXUA 3DYMA 4FR6A 4GIRA 1DIKA 2J24A 4RKAA 2PDLA 5AYIA 3G3DA 1PBGA 3TROA 2WQPA 1ZQ5A 4HPJA 3DBPA 3W83A 1XLIA 3W24A 1B0IA 3HZ3A 4LNCA 1OJXA 3N3MA 1PTDA 3BAKA 2C3ZA 2YL6A 5AHEA 3EDKA 1RBAA 3U4AA 3V16A 1H63A 3W7HA 1OWQA 1WYIA 5CPOA 4PTXA 4H3DA 3RRAA 3TCEA 1AW5A 4QJ5B 3QLLA 4A29A 5H8MA 4YVXA 2QCMA 5G2WA 2I5IA 3OBAA 1C8XA 4NJHA 4EPBC 4GGHA 3W1NA 3M7SA 1UD8A 1NM9A 5AHMA 2HXTA 3WZ0E 1VYPX 1A5AA 2VZVA 3FHAA 3GU2A 1OYBA 3V7PA 3WLSA 1CW2A 2XH0A 9XIMA 1H49A 3HGSA 3GNPA 4XISA 2BOGX 1VR6A 3RGTA 1V4YA 1V93A 3VTRA 1HQTA 3IJ8A 2WCAA 3N4AA 1P6BA 1TVPA 2ZDRA 2QLYA 1HJSA 3PWGA 3ARRA 1XD0A 1CT5A 1OVDA 4N7QA 1JCJA 3ARWA 3LCXA 3EXRA 3GVWA 1N7KA 1UOZA 4NILA 2VOMA 4FX8A 1B5TA 5K9DA 3ITYA 3GYEA 2PDMA 2BWGA 1QI3A 2FPYA 4L7ZA 5A95A 1P6WA 1XIBA 1DJIA 1ICSA 1Q7QA 3MZ2A 2J9XA 1QHPA 5C54A 3NYDA 4A3HA 4ECLA 4C6QA 1GOXA 4GFSA 1A50A 4BKNA 1BKSA 1H7RA 4ATDA 4YHEA 3U48A 5HATA 1JNDA 1MVYA 2QVNA 1TPFA 5HBFA 4C7DA 3VGGA 5EB8A 3FOKA 2W0UA 4AAJA 2PGEA 2VKZG 4C6BA 4AD2A 1GVFA 3NQ6A 4L6DA 1FH7A 5CPTA 2GDUA 4NNAA 2F84A 1I0BA 4JQ2A 1AJZA 4J28A 3DEQA 2ZVIA 5A94A 3UY8A 2YL9A 4XZIA 1RUSA 2OJPA 3LHVA 2AOSA 1KKOA 5ECVA 4EAYA 3IJIA 2CITA 1GGOA 3WQEA 3KVMA 1GOMA 2FZMA 3SM0A 4HYVA 3TYEA 3E2RA 2C0HA 2YB1A 3H54A 3RLUA 2IPGA 3NO5A 3GXMA 4DYEA 1W1VA 3SIMA 3KBVA 2DZXA 1K9FA 4LAMA 3UCQA 1X8FA 2F61A 3PTMA 2WPGA 2HNHA 4IMGA 1F74A 4IISA 1REQA 4ZZ9A 4WLCA 2NXIA 4Y9MA 2XYLA 3GIYA 4P7QA 5HJLA 4OGZA 3S1GA 1S39A 3F7JA 3SN0A 2D2OA 2OX4A 3K2GA 1NVMA 3GVRA 2J62A 4FOJA 3HPZA 3W23A 1K70A 2D1ZA 5CBJA 1EDTA 2YZRA 1XUZA 1CECA 3TDFA 2NSOA 3UEQA 2CKSA 5F2MA 5IDIA 1KFLA 1PEZA 3N6JA 2XINA 3V1PA 1Y5WA 3WEMA 3BLPX 2NX3A 3I7RA 1LWJA 4A35A 3UG5A 4D8ZA 2XSBA 4XBKA 4Q6JA 1J0ZA 4HTYA 3QKEA 4DPPA 2NW0A 3TOYA 2V2CA 2GUUA 4CLMA 1E6XM 3E0IA 4PMZA 2CESA 2F7FA 3QQ1A 1HP5A 2CZDA 4DO6A 2DUXA 1ZP4A 1VS1A 4IIEA 3VAVA 4MJ2A 4E3VA 5JBEA 2Q71A 3MUZ1 3DKJA 3S9YA 5I0DA 4HSHA 2DIEA 3WBEA 2VELA 1V6WA 2KX9A 4WJEA 4MGGA 1K7FA 4WY0A 3GTNA 4QDPA 1ZENA 2JEPA 2NWRA 1XYZA 3H2AA 1KGWA 1J4EA 3BOFA 4GQBA 5EMMA 3KTSA 1Z7AA 2WVVB 4PL1A 3W1RA 3LERA 1A5KC 3B3DA 2NUYA 4RZ5A 3A24A 1B3XA 1G9HA 3HQOA 4E3TA 2GJLA 5AYBA 2BHZA 4M24A 4EIVA 1Q6DA 2ZKMX 4HHHA 3PZGA 3D3AA 1UWRA 4W8AA 4PC8A 4EX4A 1R0MA 3LCWA 2OX1A 1GPFA 4G9PA 2XVLA 1V0KA 3N1AA 2WZMA 1E15A 2E6AA 1PE1A 2J7DA 3DG6A 5AC4A 1MUWA 1RCOB 4PUNA 1BYAA 3CYJA 4JYEA 1B3YA 2YFOA 1ITUA 1A0CA 4B4HA 1Q63A 3FSTA 5HK4A 5KMYA 3VGFA 2W3ZA 5J8LA 1DXFA 1VIZA 4GINA 4Y7EA 3HPXA 1FFQA 1JR1A 2G3IA 4LPCA 1SFTA 4WZHA 2H8XA 3IGXA 3I7QA 1IYXA 4Q4MA 5G4WA 2WOQA 3E6EA 2PODA 3VGBA 2DT1A 4J3TA 4LANA 1W37A 3MANA 2QGYA 3RHGA 3PK7A 2Q3OA 4ERIA 3L12A 3IUHA 1QXLA 4CN4A 3NQFA 3MV11 1O68A 3KTCA 4HSOA 3S5ZA 4UC5A 5D2XA 1GKRA 3I4KA 4IL2A 2VWTA 4LS1A 4DJEA 4UNKA 3RX4A 3IRDA 4LUSB 1UHVA 5DMMA 1TTIA 1JG9A 3VOJA 5AOUA 1TZ7A 1DJWA 3M41A 4CU7A 2GJNA 1XLAA 3WQPA 3R1ZA 1QI2A 5CPMA 3TP4A 3V35A 5DXXA 3CM4A 5BNKA 2WJDA 2X41A 2OKOA 1S5WA 2DSWA 2FTWA 4QJ1A 3QY7A 1UROA 4AYSA 3I3DA 4FLQA 1U5JA 1HNYA 4MKVA 1T41A 4WGXA 1Y7VA 2Y7EA 1AMYA 3O06A 3ABRA 1DHPA 3VILA 4ZGYA 1UQZA 2ZQ0A 4EPKA 3EX3A 1FY6A 3CIXA 1NDWA 4ACZB 1LBFA 3L4TA 2JKEA 5G2IA 1CIUA 1BGGA 4HNOA 1P1MA 1UKOA 2WVSA 3THUA 4PMUA 4MB1A 1MZHA 3AFBA 4MPKA 4NY2A 1JGIA 2PDGA 1OX4B 4IWWA 1HJVA 5KETA 4LUTA 2YKKA 3CWOX 3ALGA 5I78A 1PWMA 3MV01 1NSJA 1UWIA 2Y8KA 5DT5A 2ABAA 1TPVA 5TF0A 1Z6KA 3C52A 4JTLA 3U8GA 3OLDA 1A4LA 4O52A 4JIHA 2XFRA 4QCEA 4FMVA 3U7VA 2PP0A 3OZYA 3BG9A 1GJWA 1E0UA 2TPSA 2ZXDA 5A6MA 2VVNA 3W70A 3FCPA 3WD1A 3LCHA 4WDXA 5IDZA 5CPSA 2WZIA 1T8QA 4K7VA 2E77A 1EYEA 2ZUNA 1YHTA 2XN2A 4GKLA 1WKDA 2Z1WA 3B4UA 1J0YA 4Q7BA 1OFEA 4ZR8A 3A4XA 3C3UA 1X6NA 3AJ7A 3AOFA 2WKLA 4PBGA 2E6FA 4BI7A 1MFVA 4FO4A 4PCFA 2PDJA 5FEZA 3GXPA 1KQZA 1I6NA 4C1NB 2VFEA 5HQLA 2PDHA 1RVGA 3TYBA 1HN1A 4MFDA 3L0KA 4N02A 1OGSA 2X7WA 3JU2A 4M6PA 3PTDA 2J7BA 2QGHA 1EC7A 3NEHA 4PCPA 1XSIA 1DXEA 3U3HA 5BOOA 4FXFA 1OQFA 3TZNA 4RZ4A 4IJRA 3USBA 3NM3A 1TQXA 3W88A 3WEZA 3GWQA 4LVDA 3ZLHA 3GNNA 1VBGA 4K1WA 1EA9C 4OIFA 1JDFA 2HEJA 2Z1XA 2BVDA 3DFTA 1ZY9A 3EMZA 3MHUA 3MZNA 3LGEA 5AZ0A 3R13A 1EWEA 5AHNA 3WLLA 1AW1A 3MI3A 3FSUA 3U0HA 2BVWA 3S6OA 2IQDA 2Q6ZA 2FTYA 2R91A 2OMAA 1THFD 1ITCA 1YX1A 3KCJA 2OT0A 2CHRA 2P3EA 2OQYA 3A6OA 5D9OA 3WBAA 2C18A 3TVAA 3W53A 3WFLA 3UCCA 4IICA 2V5JA 4H9YA 4UNLA 2X1SA 2OZ3A 2BSLA 3EMCA 1KFEA 4A8RA 2XSXA 5A6TC 1FKWA 4M51A 4Z1AA 3ARPA 1A5SA 1A3XA 1FOBA 5D02A 3MUCA 3PWIA 2FB2A 5CPLA 1HVXA 2ZRYA 1UZDA 4NZCA 5AFDA 3TYAA 4AMCA 3QHOA 1UUMA 1P0EA 3CEUA 3UWEA 2SFPA 3FIGA 2PDPA 2YIHA 4XZHA 4F4RA 1FWWA 2CBUA 1ISYA 1DJHA 4HHMA 4PSPA 2A1YA 3WDRA 2HQAA 1NDVA 1M9HA 1A5CA 3GHUA 3JVAA 4L9XA 4WDWA 1UC4A 2FH8A 3KTXA 4PZVA 3RUBL 4JX4A 1XBYA 3CTLA 4HOZA 3T55A 4DEFA 3HOJA 4BQ4A 2XU2A 3UJ2A 1EPXA 5REQA 4BI6A 1DP0A 1P6CA 3EA2A 1GTEA 1W5OA 1BYBA 3L66A 4H6QA 2PLKA 4O8RA 4X2PA 2WMJA 1CGUA 3CV2A 4LAKA 3RMEA 4GH3A 3E49A 1E1CA 1G0CA 4MYAA 1JYWA 8CGTA 2F6XA 2OG9A 3V5OA 3KL0A 3U5YA 9XIAA 2G41A 3ARUA 1UH4A 4DJDA 2POZA 3XINA 3JZUA 4LW7A 5IHRA 2XIOA 1H51A 3M0HA 4LAZA 1F8MA 4CQBA 2I9UA 4D6CA 4AU0A 3VIGA 3W28A 1S5NA 3KM8A 4A8NA 1JCMP 4S3JA 5I3KA 2WVTA 1BQGA 1MSSA 5D8ZA 1KBJA 3GHSA 2JFEX 1UD5A 1AQMA 4GI8A 4I9TA 2VCBA 4AWSA 3PVFA 2YXGA 4UFJA 1IWBA 5CLWA 1PZ0A 3K4DA 1KWKA 2R1MA 1TELA 4JKLA 3PPHA 3F4DA 4XQ6A 1CGVA 4XKYA 2G4FA 4NNCA 3S2LA 4ASTA 5BXTA 3OHMB 3T0TA 3QBUA 3JW7A 4R7WA 1A4MA 3SCNA 4HJFA 3DERA 4FZIA 4UQDA 2FVMA 3B0VC 5DCBA 3UGRA 1DYSA 4WRHA 3VA8A 3OVGA 3SUUA 2CCRA 2UV8G 3VZYA 3BAXA 1JQXA 3O63A 3MUAA 2HISA 3BLLA 3PPFA 3M43A 3AZSA 3NSNA 5LXXA 3GK0A 4HSNA 3G8EA 3WDJA 3WMLA 4GRSA 3WQ5A 3KS6A 4WKHA 1ITQA 1NIUA 3ONCA 4ZQPA 4RXGA 1DOSA 3SGUA 5LNSA 2RGLA 3IIZA 4XZWA 3RFAA 1KCLA 1PWLA 3GB6A 4PUMA 1JULA 2PC8A 3ORWA 3R8RA 4AD4A 3EX6A 3VD4A 1ME8A 1ICPA 4ZFCA 1KM5A 2ICSA 4MY9A 3BZJA 4D6EA 5LIXX 3SFKA 4JQ4A 4DWSB 2X09A 3K4AA 1DTNA 4RXFA 5M03A 3S8HA 3REQB 1KW1A 4PMNA 1CX9A 4AZHA 1IXPA 3S2JA 4QAWA 2CC0A 3L23A 1V3MA 4MNLA 4UOJA 1YBQB 3AXKA 1ZBKA 1Q6QA 4JD4A 4X0NA 4RL3A 5I09A 1PVNA 1DQUA 2C6QA 1UH3A 4WSKA 2BG5A 4MTVA 5IOBA 4QHRA 1T0OA 2CLEA 1RPKA 3OU8A 5F4WA 3LRLA 4DJFC 3IACA 4JGDA 2BX7A 3N15A 4GXWA 1JRCA 3VI2A 4R88A 1GG1A 1E1EA 4LF1A 5A6BD 4Z2JA 5C9RA 3PJTA 5I3GA 2HSAA 7TIMA 1TA3A 4QG8A 1TE1A 1OFOA 2A3CA 3QTPA 1H09A 3IJLA 1A5LC 3B03A 3WX7A 4HN4A 5FIPA 3QR3A 1WDQA 4ADTA 4JR5A 4NJGA 3GTFA 5T91A 1MQRA 3BXWA 1VEPA 4Q4PA 3RU8X 1E4MM 3MKVA 3S5YA 3BGJA 4HU4A 1SZEA 2YDSA 3C2YA 2HVMA 1QU4A 3KBMA 4MMWA 1G4PA 4PB4A 1UUQA 3BLFA 3VFLA 4HNLA 3LDVA 1IEVA 4FP1A 1SW7A 3W7GA 1W9XA 2WPBA 3G1DA 1SO6A 4W5UA 1NELA 1Q2SA 2P8CA 1WDPA 3NL2A 1KXQA 4DI9A 4ZQOA 2PI6A 3RAOA 2PB1A 1PSCA 1XHGA 2C1GA 1SO5A 4CNUA 4AZCB 3FXGA 4FPSA 2BOFX 4KT2A 2QCLA 4R7OA 1ZB5A 3KFTA 4XBSA 3AS1A 4NF7A 2PGRA 3EWWA 3GNRA 5I23A 2R8WA 2X0YA 3L67A 4RE4A 5T26A 2AKMA 1S2UA 3LA4A 3QYSA 1JL8A 3GTHA 3VX0A 2FDMA 1XRVA 2ZX7A 5C71A 1MEIA 2EKCA 2O9RA 1TTJA 3PFMA 5C9XA 1RY8A 1F73A 3OQEA 3TWAA 2IXVA 3STCA 4EE9A 1E9YB 2W79A 2R6OA 1UJQA 1AW2A 2WHKA 4EANA 4LCSA 5LKYA 5D2TA 1GT8A 3SR7A 3SCQA 1HGWA 4UCGA 3VUPA 4CN1A 3OBEA 1DPMA 1IZKA 3IEBA 5G4HC 3WJSA 2HZGA 1EL3A 3MSDA 1K8YA 1OM0A 4EKJA 1RK5A 3AAMA 3U2OA 4Y8EA 3CHVA 4B5SA 3AMGA 5CSYA 4GVFA 4IMCA 1N8FA 1OD0A 2OR2A 1EP2A 1W32A 4EF9A 1S3TC 1WBJA 3PG9A 1XYCA 3AZTA 3PN8A 5LIUX 1JCXA 1Q5MA 1OT2A 4KEZA 4J2MA 1NDZA 1KRBC 1A53A 1WDDA 3HF3A 2VC6A 4WKFA 2FGZA 3RR4A 3NG3A 2QDDA 3T6CA 1IF2A 3UQNA 4Q4OA 3CPRA 4UFHA 1EHAA 3WMCA 2VFHA 3AIQA 1ESWA 2ANUA 2O9OA 3CV6A 1XFBA 1Q85A 4HMEA 3SRKA 4WJXA 3GX9A 2XISA 1IZCA 2QW5A 3CHEA 3ARVA 4C6MA 3PZNA 5KTLA 1RVKA 1LBMA 4HZ6A 4BJHA 1UC5A 3MO4A 4Z2GA 3APTA 1C7TA 2HK0A 3CZLA 3GVVA 2PDFA 1PL9A 3HURA 3SCWA 4B4FA 1OG6A 3UZWA 3W7LA 2VGIA 2EJAA 1GZJA 4CCZA 5FD0A 2OOFA 3UBPC 4U10A 3BGGA 3SUWA 4A21A 3FEQA 1P5BA 4OZOA 3IUDA 3QKZA 3H2FA 3FGCB 3AMDA 3KZPA 1F61A 3KZSA 3GUGA 3QPZA 3SGZA 2OYLA 3T78A 1E3XA 4AF0A 1V77A 4LU0A 5D9NA 2CYGA 1NQKA 2HVOA 2BY3A 1V7YA 1TIMA 4PUWA 1U30A 1JNEA 1KQYA 4U3CA 2EHHA 1UKTA 2HPMA 5CJ5A 4PCTA 2F6UA 5LNUA 4KCVA 3WMSA 2D0HA 2W4XA 3NZ1A 3BLKA 3LI1A 2P53A 1MFUA 3VNJA 1XLHA 1KRMA 2ZICA 2VGBA 3E0FA 2VFFA 2C91A 1E6SM 1JVNA 1GKQA 1V02E 1EP1A 5AC6A 4H19A 3VIIA 5LHFA 1V3KA 2REQA 4GVGA 3KAOA 3KS5A 2FVKA 1J0KA 5BOEA 4IM4A 2B7QA 2Y5SA 4HU0A 5CJMA 3W07A 4CD8A 4H04A 3S42A 4IXHA 1GQIA 2A3AA 4MAZA 5DCDA 3UG3A 3CGTA 3VO0A 5EMYA 2YW3A 4KESA 1J2BA 1EJRC 1H7OA 1IZJA 1JZ8A 3LPGA 1UMLA 3H24A 3O07A 1XKYA 3N9SA 2GK1B 3R0DA 3M0LA 4C65A 2OEKA 4D71A 3C6CA 3N2TA 3N2MA 4MG4A 1PX4A 3ARXA 5GJMA 3UP8A 3W7PA 3BJTA 4Z1YA 2QPSA 3DGRA 3XISA 1VQTA 1US2A 3N2XA 1TUXA 4IIFA 2ACUA 1IEXA 2E8ZA 3OODA 5JBDA 1ECEA 4QEEA 3G1YA 5L9FA 2W27A 1H1NA 1G69A 4J40A 1W3NA 4K8GA 3A3XA 4P8XA 1RBOB 1WAWA 5G1MA 3LS9A 2PBOA 1WXYA 2X1UA 3BQ6A 2JEQA 3S1XA 3UZJA 1BYDA 1S2CA 4QNEA 1C92A 2PTYA 3KLKA 2Z1BA 3HB9A 5LZLA 4LUJA 3HJEA 4JHZA 4GUJA 1R3SA 3R12A 4OOUA 4WSHA 4ML4A 5A8MA 1C90A 3GNOA 3WLNA 1Y5VA 1UR0A 4KCWA 4D2JA 2E67A 1TRDA 4GCXA 3BK0A 1HIZA 4HZ8A 1XG4A 2Z2UA 2Y63A 1V3HA 2D0FA 1XF0A 1OZMA 1UR8A 3N4EA 5JH1A 4YTRA 4BR1A 1WBHA 3RILA 4HU3A 3W1QA 2AQVA 1SMDA 3C0SA 3Q94A 4B2DA 1XLEA 2DIJA 4W8BA 1VFHA 2EG7A 2DORA 2GSHA 4HKPA 2KAUC 1D8CA 1ICQA 3P8JA 3CC1A 3ID7A 3GQYA 5HUOA 4Q8TA 2VO5A 4NT0A 3VNZA 1OIMA 1LL4A 2ZZ2A 4MUPA 3H26A 5DMYA 3OLIA 4NI3A 1IHIA 5JIPA 3PPCA 3VKAA 4JZ5A 2NSXA 1G5AA 4AXKA 2PP1A 4KH2A 3WK2A 1GNXA 1MUMA 5HINA 1TJPA 2PDIA 3AS2A 2WMHA 2D20A 4J2PA 4GKTA 3TKFA 1SUXA 1QUMA 2GUBA 4C7FA 3UWWA 4UR9A 4LUSA 3UWYA 4JQ1A 4H8HA 3VKJA 4XV0A 2VEGA 3TC6A 2E5BA 3EDJA 4IQDA 3MYOA 4EXBA 3MCNA 2AMXA 3CTTA 3QOMA 5I3JA 2PTWA 3LNPA 4Q4RA 3DFYA 4I5UA 2WC7A 4RLIA 3A47A 1J18A 2Z24A 4K3ZA 5AN7A 1SR9A 1OYAA 4PBEA 5A8PA 1WPCA 5HA7A 5A5WA 4UNIA 3GG7A 1C91A 4JIIX 1KKRA 4W88A 1OG0A 4IQLA 1XC6A 4ACZA 3H7VA 4JYDA 3TSDA 1JPDX 2OEMA 5CZKA 1JYXA 3GC2A 4L1XA 2V3DA 1BSIA 4W7VA 2F2KA 5BXSA 1TPH1 5I5RA 1MNZA 4XO6A 4ZTXA 1FBAA 1OX4A 3QY8A 4QNWA 1NU5A 5BMWA 4HK5A 5A3HA 1OFPA 3EX1A 4GXMA 2RHGA 1J5SA 2I16A 4Y6GA 4GZEA 4LGXA 2JIWA 3GTIA 2HPIA 3RM4A 4A3RA 5LIYX 5H8PA 4W9TA 3CZGA 3WD2A 2XGZA 3W2UA 2J8GA 3WNPA 1DVJA 4OE7A 5FI8A 1EF2A 3SGGA 1LORA 1GW9A 3H7RA 2J7CA 3O6CA 1X7IA 2GJXB 2QMJA 2V9DA 4MKSA 4XIMA 2PAJA 1ONXA 4WDTA 3A4JA 3M0IA 4Y9AA 1K7EA 4OBRA 4RE0A 4IGSA 4AWTA 1AL8A 1CGYA 4UFKA 2VZSA 3W7OA 1GWJA 1TJ0A 2Y70A 4J3WA 4O8AA 1EF3A 2YL5A 4LNYA 2QCDB 3WNLA 2ISVA 1HT6A 2J9ZA 4KBXA 3ONBA 3T42A 4ICCX 2DJLA 4PRWA 1JPMA 4IZGA 4C1NA 4MB5A 2W6RA 1FWHC 5HJXA 2RDXA 3ITCA 2I57A 3ITXA 3BH4A 4V15A 3S83A 4MDPA 2Q01A 2PPGA 1FP8A 3P84A 4MSSA 3DFOA 1LRNA 5JU6A 1W6TA 3W7NA 4AZ7A 1WDRA 2FMOA 3BOXA 4WGHA 1DJZA 1FVPA 3P7YA 3GIPA 3NQ7A 4ORMA 3RG6A 3SO7A 3STFA 4C1KA 2QJMA 1GOOA 4XVEA 1SQ7A 3IJ9A 4US5A 3BOLA 2VURA 1V51A 4H6KA 4QJ4B 2PFHA 1ZALA 1QOQA 2INEA 1M53A 2YL8A 5EKYA 5E1QA 4AX7A 1SFJA 3MI6A 2FDSA 4Q8QA 2HMCA 4HCLA 1Q2RA 1UKQA 3KWSA 4YCOA 2FPVA 3SCSA 4DVOA 5MHBA 2AMGA 2Y0FA 3AICA 4EPDC 4US5D 1AH3A 5CZJA 3WD0A 2B7NA 5FSEC 1YPIA 3LHTA 5FEPA 2HNEA 4XSMA 1JFXA 3E74A 3NDOA 2BP1A 3A4AA 1SJCA 1ONRA 3TYCA 1PX8A 3CH9A 3OYZA 1OX5A 2X1RA 2DT0A 4B15A 1DE5A 2NLIA 3GC5A 7ODCA 4KCUA 1JUBA 4GZ7A 1BFNA 3W26A 2ZVRA 3SECA 4E2DA 2PURA 1OK4A 3VC6A 1IT0A 1O5QA 5MF5A 4IIBA 3B9DA 5CAHA 1A3HA 4LXFA 5GPRA 1G1YA 1I2NA 3P60A 2V82A 1K03A 2R1LA 3QHNA 3E2VA 5E09A 4AY7A 1GYNA 4B91A 1AJ2A 2DJXA 3LHWA 1SU5A 1QNSA 2V5LA 2GJRA 4ERGA 5M3WA 2NQ9A 3UESA 1FRBA 5F2GA 2C14A 4L4PA 3HFTA 4MYXA 3TTEA 1GKPA 1VH7A 3DENA 4FXJA 4GWEA 2JF7A 2F6KA 4GIAA 1ADSA 3AYRA 3KLLA 3CHDA 3U2EA 3EBVA 3THCA 4W87A 5HOSA 3M0VA 3NL6A 4AHPA 1RLDA 1A3WA 1BXNA 2DDXA 1BVNP 2CLIA 2PLCA 4S3CA 4AIBA 4B16A 3I68A 3L21A 3MDWA 1CGXA 3NNTA 4CNOA 3MBFA 1ZL1A 4HPHA 3W37A 2V69A 1MUCA 1SO4A 3WF0A 5CZTA 4PL2A 5H2ZA 5CZSA 3CU2A 3CK5A 2H8ZA 2VEKA 4Z42C 3PZ9A 1PS9A 5DF0A 1TTPA 4DF1A 3PZQA 4XZ9A 4DY1A 2PZNA 3D3FA 3ZJ6A 3G3MA 1Z9AA 5HDRA 2GGEA 1OFBA 1QHOA 4DJEC 3NSMA 1YDOA 4BA0A 1X6UA 1QVBA 2C7FA 1A5OC 3FEMA 4PRTA 3W01A 1W9BM 4AISA 3OP2A 2IPJA 3WELA 4GNJA 2CW6A 4MHBA 5G4EA 1PTAA 2NV2A 1ALDA 1H41A 5JXQA 2HS8A 2CLPA 1U5VA 2YA1A 1QBBA 1UR3M 3AIUA 3FK4A 3IGHX 4U4MA 2XN0A 4GX8A 4NAFB 1TPC1 4Z2KA 1CNVA 4N9BA 1NP2A 3W73A 5C7HA 4GISA 3F5LA 4FIQA 2XSAA 1CWYA 5J5DA 4DWSA 4E38A 3TUUA 2YCEA 2YBTA 2E7FA 3KWXA 3LQGA 4IG2A 2BODX 1R86A 2E1DA 4LY4A 1NY1A 1MZRA 3G2GA 4Q7NA 4CGTA 2I7GA 3MI2A 3OGRA 1TR9A 2Y89A 5C9ZA 2VDHA 4M6UA 4IP7A 2RH9A 4YNGA 4QR6A 2YB4A 1O5KA 1VBHA 1GQNA 4P7LA 1JUKA 3VU2A 2RKXA 4DWSD 5AECA 3CH0A 3KOFA 3EGJA 3WUFA 1WCGA 2GQAA 2RDUA 1B4EA 2QUNA 2WV8A 3B9OA 3LY0A 3GAKA 2YGYA 2GDQA 3QHMA 4EVZA 1I4NA 3OGVA 4JNYA 4MB3A 1KFCA 3VGHA 2EPNA 1RPXA 1XWYA 3WL0A 4JFVA 1IQ8A 5BRBA 4C6IA 1ZJAA 4KFNA 3DBNA 3A5VA 1V3LA 5HMFA 3LG3A 2WWDA 1PCWA 2J79A 4O4VA 1VCFA 2R1NA 1KM2A 3H23A 5FJUA 5CC3A 4LYRA 5C2GA 2V8ZA 3EX2A 1K1DA 4I90A 3ZJ7A 4DLMA 1QI0A 3USZA 1VFLA 2PLJA 1FP9A 1P0BA 3AIWA 2GYIA 5D2VA 1H0GA 1PZ1A 1SW3A 3NA8A 3S2CA 1KM6A 2WLZA 3VNDA 4R33A 4RDZA 1I9CB 3K5XA 2OEJA 1DWJM 4X22A 4GFIA 3M0KA 1XCXA 3WLOA 5I3FA 3CHFA 3STPA 4JX6A 3STEA 3UA3A 2YA2A 3U57A 4HYWA 4TV6A 3MMWA 2OQHA 1PDYA 2J66A 2BB0A 4XD5A 3MMTA 4AZCA 3EKGA 1UP3A 4GGBA 4RUBA 1LT7A 2AGKA 2ZIDA 3IK2A 3AI0A 4PYSA 3T4CA 3FNDA 4G7EB 3B9AA 2Y62A 1TJRA 1HGYA 3O3RA 4XBJA 5FL0A 4A3UA 5FJJA 1JF5A 5D2YA 1VEOA 3BCDA 4HPNA 1VPXA 4KERA 1F9CA 2P50A 2IPFA 4LVGA 3PANA 2NQZA 4E6MA 2VQTA 1PZ2A 2NLYA 4WY0B 3GLCA 4LUIA 4ROPA 3ZVHB 3MCMA 4YHGA 2G0WA 5BYWA 1X1ZA 3WNKA 1VBRA 5FSDC 5IHSA 4CQ8A 1GEHA 4X9YA 1XBVA 3PG8A 3A5FA 5E70A 4GD0A 4UQBA 1L6SA 3GXTA 4E4UA 4QLLA 3F03K 3L7RA 3GKAA 3AO0A 3NVTA 1NAL1 4YVPA 2GVEA 2WBKA 1OEPA 4CD6A 7ENLA 3UPBA 2EPLX 3IJ7A 4XD4A 3ERPA 1HKVA 1I1WA 3VNLA 2EPOA 3QV9A 4A3YA 4AHQA 4A3QA 1DWHM 3N25A 3NQ2A 4AC7C 2XGBA 2Y4SA 2TODA 5E0KA 5FF7A 4YVVA 4DJDC 1RJRA 4O1BA 3GR7A 4NUWA 4JN6A 1RA5A 3L9CA 4K6AA 2PDQA 2QPXA 4ZQRA 5CGQA 9RUBA 2QIWA 4P7NA 2VYOA 2YCKX 3DHUA 4DUOA 5B7YA 4W89A 2E9LA 2Z00A 1HKIA 1Q6GA 1E40A 5GQBA 4ONVA 5D04C 4EF8A 3BO9A 4AWEA 3ZT5A 4OWGA 1WDSA 3GDRA 1GQKA 3UZXA 3G0XA 3S6DA 3GH5A 2YLLA 1CLXA 3QEZA 3UZYA 4XSLA 4A6GA 3W7JA 3WMBA 1D3GA 5HAOA 1W1B1 1RV8A 2QHAA 2FHCA 2IKIA 1EUNA 1R87A 2QF8A 4O16A 2EXOA 2Y7DA 3D6NA 3O2LA 4RZBA 4GYJA 5C9UA 2UBPC 3CQ0A 1ZFJA 2O4MA 5HXMA 4XTDA 5F4SA 1M6JA 3W27A 1ELSA 3HGRA 1D7KA 1KM0A 2FHFA 4BEUA 1IWPA 1S1RA 5AC7A 2A0NA 3R79A 3NFUA 3NEVA 5AZ1A 4DUVA 3AYTA 2ZWYA 3EWUA 4MUZA 3LZ5A 1MQQA 4PTNA 4P7OA 4CNPA 2WYSA 5D33A 1L0PA 2V3FA 1GVSA 1XGDA 1WOBA 3LCIA 1W5NA 3GDKA 2J7HA 1VFOA 2ZA1A 4PB5A 5H91A 3WD3A 1RXOB 1Y65A 4LUTB 3BVJA 2VP8A 2DZWA 3W72A 3NJ3A 4RDVA 2J25A 3EWCA 4KIRA 1L6YA 3NCOA 3CO4A 1AFSA 2BLEA 1M7PA 4ENLA 1BF2A 1CXKA 1QR7A 1IT8A 3GNDA 3N14A 4H2CA 4V1XA 4KW2A 3W6YA 2UY5A 2XIIA 4MF4A 4ZQCA 4Q4SA 3OVQA 4R9XA 5C6MA 1TX0A 2VENA 3W7CA 3G77A 4IIDA 4O19A 3O05A 2IMRA 1EQPA 4H6EA 3PFRA 1MNSA 4JTEA 1GVQA 4O54A 1GUVA 2QQ6A 4X63A 2Y85A 5G1TA 2YFNA 1X1OA 1LCOA 5FF3A 3W7QA 1V08A 1QK2A 1QPOA 2GK1A