2ZZDA

Recombinant thiocyanate hydrolase, air-oxidized form of holo-enzyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
PVWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Catalytic Activation of Thiocyanate Hydrolase Involving Metal-Ligated Cysteine Modification
pubmed doi rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase subunit alpha
total genus 26
structure length 119
sequence length 119
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zzdA00
2CZ0B 1IREB 3QXEB 2PU9B 1UGRB 2PVGB 2PVDB 1DJ7B 4FM4B 4OB3B 5L8RE 4ZGEB 2DXBA 4ZGJB 1QP3A 2WSFE 2PUKB 3A8HB 2PUOB 3VYHB 4XK8E 1GXIE 3X28B 2ZPGB 4RKUE 3HHTB 2CZ1B 2ZPEB 1QP2A 3X24B 3WVEB 2CZ7B 3QZ9B 2PVOB 2DD4A 1JB0E 2CZ6B 2ZPHB 3QZ5B 1PSEA 3X25B 1AHJB 1UGSB 2WSCE 2CYZB 1V29B 3QYHB 3A8MB 3QYGB 4OB1B 2ZPFB 2QDYB 3WVDB 3A8GB 2DPPB 2ZPIB 3A8OB 4KT0E 4L6V5 3X20B 3VYGA 2DD5A 2AHJB 2WSEE 2ZCFB 2ZPBB 1PSFA 3LW5E 4OB0B 4OB2B 2ZZDA 2DXCA 4Y28E 3X26B 4ZGDB 3A8LB 1UGPB 2D0QB 2O01E 1UGQB
chains in the Genus database with same CATH superfamily
5KYYB 4RTTA 2DETA 4PNOA 4WCIA 4OMPA 4DEXA 1QVGP 1R0CB 2ZPEB 2OTLA 2LDMA 2PZ1A 2WSCE 3OYAA 2RD1A 4OB1B 1Z9ZA 1MGQA 4DBHA 3JCMX 5A0GA 2L3RA 3TREA 3OYGA 4J6YA 5AYFA 1YBYA 1I5OB 1PCXA 1JXOA 5IHIA 1LJOA 2LT1A 2VKNA 2L3SA 2FPEA 3OYDA 3UPUA 1RUWA 3CCST 2K4YA 2RQUA 3L2VA 4N0AC 1X01A 1I1JA 1UECA 3G6EQ 1R0BG 3CMEA 1U8RA 2R57A 2K7AA 3VS7A 1B07A 5GJVB 2LJ3A 1Y0MA 2DVEA 2EGAA 1QVGS 1Y71A 5LJ5h 4M77E 2QEXQ 2QEXA 1IGQA 3ASKA 2YUPA 1I4K1 3CCVT 5CQXA 1QCNA 1B34A 2X35A 3CXCA 3VRZA 2RI3A 1BI0A 2XD0A 4GY5A 1X2QA 2RH2A 1M90R 2EW3A 2W0ZA 3VS4A 1JQQA 4EMKC 1SSFA 2JMCA 1G2BA 2KEAA 1ZUUA 3OYIA 1M1KU 3CCEQ 3PGGA 3PE0A 3JCMf 4AFSC 4BACA 2FG0A 3BDUA 1KQ2A 3RIRA 4J9EA 1IZ6A 5A2QE 5KH6A 1AZGB 5GJWB 2DJQA 2CP6A 1X6BA 3JB9D 3LW5E 3CCRA 1RAIB 3EG2A 1AZEA 4HT9A 1R8OB 2KXCA 2FYKA 1WLPB 1AT1B 1KFZA 3P8HA 2DXBA 3CCUA 4CRIA 2NUZA 4FIBA 2BE9B 3QZ5B 2CYZB 1RABB 2LQWA 2OTLT 1JEGA 2J06A 2DAQA 2G3RA 4DA4A 2E10A 1N8RU 3VUZA 1GCPA 4J9BA 3OSVA 2RI5A 3V8KA 5KYUA 3M0TA 3V7RA 3PFSA 2MAMA 3R6NA 3G4SA 3HSBA 5CO7A 2CP5A 3H6ZA 2DA9A 4Z89A 4ZGDB 1NJIC 1ZSZB 2OTJT 1PG5B 1VQMT 3NGPA 5D6XA 1RI0A 5IN1A 2K3BA 1GCQA 4PJOF 3HHTB 2QTXA 4WTOB 3OBWA 2BKDN 5I21A 2FVUA 1OOTA 3BW1A 2LVMA 2LMJA 4M7DG 1M3AA 2AK5A 2I2LA 4C5GA 1I0CA 2QQRA 3CBMA 2HZYA 4N0AA 3QDRB 5LJ3e 1AWOA 1S72A 1P92A 3EAEA 3CCJQ 5GANg 3OMCA 4ZGEB 1G5VA 3A1PA 2XU8A 5GMKe 3OBYA 3MJXA 5LJ3h 2KYBA 5LJ5j 2V1RA 3E9FA 4F04B 3VS5A 1I07A 4OMOA 4ZN1A 2MF2A 1VQ9T 5GANe 1Q86C 1VQ4A 4BE0A 4BD3A 5L8RE 4N4IA 5GANh 3E19A 1O9SA 1IO6A 1YJNQ 2DIGA 4ME7A 1RAFB 4QW2A 4JRPA 2O9SA 2D8HA 1WXTA 5GAMj 4E7IA 4M78C 3NFCA 2V8KA 3H0FA 3M5AA 1PWTA 1YNZA 2DXCA 3D7SB 4CI0C 2DJZA 1VQ8Q 1UGQB 5M9OA 4CC4B 1DJ7B 3VUBA 3EFOB 4DBQA 1XTDA 3QWXX 3TSZA 1KD1U 5GMKl 4M7AA 3E9GA 3JCMJ 3OY9A 3PIPA 2ZPHB 2VV5A 3JCMd 3A8MB 2OJ2A 1VQPQ 1BI3A 1JU5C 2P4RA 1Q81C 4PJOD 2HAXA 4LUEA 1YWPA 4A4EA 4BDYA 2YRDA 2NYSA 1G3SA 1KQSP 1RACB 3NTKA 2K5IA 1PRMC 3CBOA 3CMAA 5KE2A 1RL2A 3OYHA 4J9FA 1MUZA 4N4HA 1FMVA 2RPNA 1W6XA 3JV3A 2DXUA 3QZ9B 2DD4A 2KRSA 1V29B 2VXEA 4RTYA 2D1XA 1QVFA 2LQKA 4M7DD 5LJ3f 1E6GA 3QDFA 4F14A 1LVKA 4F7UA 4RTVA 4DBRA 3SHWA 2QI2A 2HQEA 2RHIA 2GNCA 3UDCA 3JB9F 4AFQC 2MOXA 2L8DA 2NUTB 3EG3A 3HL8A 4ELYC 2EIFA 2GFAA 4QQ6A 2IVWA 1IHWA 1HK9A 2K2MA 2RHUA 3JRZA 4F7UE 5GAN7 3G4SQ 4M77A 5DLQE 3L2QA 1YI2Q 3RMQA 3QSUA 1W2BA 4M75A 3I5SA 1X69A 2V26A 1QVGA 2ZAEA 2R5AA 3CCQQ 1UFFA 5IHNA 4QVCA 4UC4A 5CQYA 4JJDA 4Q5WA 2XDPA 4M75D 1H3HA 2ZPFB 2DM1A 2F69A 3PNWC 1KJWA 3HFOA 2O2OA 2YLBA 2BUDA 1S72T 2JOYA 4BE2A 4A4HA 4F7UB 2FPFA 2NWMA 2LC4A 4FW1A 1M90U 3VS2A 4QKUA 2YWWA 4KH0B 1TUCA 2HSEB 2QDYB 1K8AC 2XICA 3DLMA 4E7ZA 1Q82R 4J7FA 4J9DA 3ER0A 3RNJA 2GQIA 2E41A 4M7AB 1WJRA 5GAN2 2Y4YA 4J9GA 4A4FA 1RLQC 3EFOA 2MYSA 1KK7A 4BDZA 1VOMA 1AOJA 4E7HA 4C8QC 5FWBA 2DMOA 4EIKA 1I5LA 2A3LA 3FC3A 1ZBXA 2KK4A 1ZLMA 4M7AC 2L3PA 4JRQA 5GAOq 1YIJA 3MHXA 5KYWB 2K3XA 3EGUA 3CCET 4Z02A 4OB3B 4FYWB 3CMEQ 1X27A 4J9HA 4JUVA 3I55T 2XIDA 4M78A 2EQMA 2CSQA 2FEIA 3WVDB 4F7UG 4PJOG 1K73U 2LP5A 4IUQA 2DRKA 1KHIA 2JXBA 5HCKA 3SWNA 2XG8D 3CCVQ 2E1HA 2EGEA 3UA7A 1NYGA 4M7DC 4E47A 3AT1B 1N27A 2CT3A 2OTLQ 5LJ3j 4E7SA 3M55A 1QKXA 3RESA 4EPCA 5GAOr 1UUEA 2D9TA 2O4XB 1VQ7T 1TOVA 5FRMA 1G83A 3A8LB 4C8QD 3CC2T 4M77C 1JJ2P 2CGHA 2EQKA 2DBMA 4J83A 4BE1A 3EG9A 2SRCA 2HKNA 1Q86R 3REAB 2DTOA 1GFDA 5GAN5 3V7CA 2KMTA 4IUTA 1Q82C 1NJIR 4X1VA 3HRUA 4A53A 4B6MA 2NLUA 2DEQA 3CCMQ 2JN0A 1LOJA 2YT6A 3MEUA 1YJWQ 4FM4B 3C95A 5CK9A 4PFOA 4J6XA 2YUOA 5GAOp 5FROA 1VA7A 2KRNA 5KYUB 1YN8A 4D8DA 2FZCB 3KBGA 1G3TA 1NJIU 4EMKB 2RA2A 1G3WA 2ROLA 4OF1A 2HSPA 3HP9A 3GNFB 4FCYA 1FWZA 3X20B 5IXFA 1PSFA 4OB0B 2CP0A 3META 4XTUA 3DB4A 3M0RA 4MMKA 4HCCA 3QBYA 3WXMB 5C6SA 3JB9J 1WQWA 1OX8A 1C0MA 4PJOA 3I9QA 1D1BA 4OMNA 4M78E 5GAMh 1OQKA 3ZEHA 3RKYA 3OYYA 4PFPA 4RG8A 5KCHA 1UHCA 2KY9A 4HA8A 1HSQA 3OW2A 3G7ZA 2HQHA 4LD6A 4R56A 1O75A 2RJDA 4HKEA 4A63B 5DM7R 1VQNQ 2CUDA 2M1HA 3NHNA 2KI7A 1Q7YR 2X9HA 4GLMA 2C0TA 3M57A 1SG5A 1D3BB 2EQIA 2DIQA 3QG1A 2KVQG 2QDLA 2F5KA 4X9CA 3CCLT 2V8JA 4IUPA 3VYGA 2L89A 2HEQA 2ATCB 2EJGA 4C8QG 3EHRA 5D6YA 5FU6C 4R55A 2E64A 1AEYA 4HVWA 3SWNC 2FZKB 3CMAQ 3EHQA 4LD9K 4JJBA 4LXCA 2KDSA 3OYLA 1NZ9A 1QVPA 2MCNA 1KC8C 4DBFA 2QASA 4GLKA 3OW2P 3KUFA 2ROTA 1VQ4T 3MEWA 2EPDA 1EFNA 5FWCA 5KE3A 2DO3A 4HVVA 3VS1A 2EYQA 3CCMT 1QKWA 3I55A 4NOYA 4X9DA 2AT1B 5GMKm 4OMMA 1RAHB 2MIOA 3OQ5A 3EGDA 4OVAA 1JJ2A 3CCLQ 4NL2A 3SEMA 3G71A 3BE3A 1G8XA 4J8OA 1M90C 1BB9A 2RN8A 1B34B 1KD1C 1W70A 3EFRA 1GXIE 2E12A 1YHQA 1H641 5CKHA 1VIFA 1K0XA 3S3MA 4C8QA 2P0QA 1HD3A 1VQPT 3ZBDA 1VQ4Q 1PNJA 3BY7A 3M0PA 1D0ZA 4K11A 1K0SA 4IKFA 1MHNA 1Y7XA 1UG1A 3EG0A 1OYXA 5KYYA 3JB9H 3OYFA 4JLIA 4XTXA 1SHGA 1C1AA 1VQOQ 3L1AA 5GAMf 2EQUA 4XU2A 4KGVB 2A7YA 1NEBA 4AFUC 3PIOA 2CKKA 1VUBA 4JRIA 2CS7A 1QW1A 2DX1A 5LJ3g 3SDZA 2AHJB 3T9NA 4Y28E 2RQWA 2LCLA 2DK3A 4M78B 3CPFA 3C94A 4XTWA 1WFWA 2P0KA 4FYXB 2EKHA 2KQWA 2F2VA 4FSXA 4C8QF 2M9UA 2YHTA 1EZZB 2O88A 1TU0B 2DILA 1MV0B 2QG9B 1FMKA 3JCMP 2D6FA 2AIRB 3OYMA 2F2WA 1KG1A 4M75F 1W2BP 3CXCS 1F1BB 1WXBA 2ED0A 1D1AA 2JTMA 1YCSB 4EMGA 1M3BA 2H3EB 3J7AF 4EMKA 3Q1JA 1UJ0A 2GQVA 1TUGB 1WJQA 4M7DE 2EVRA 4HCBA 4AT1B 3FB9A 2FHDA 2H3JA 1VQKT 3L2WA 1IHVA 2CP7A 3EGDB 2HQXA 3M0SA 4M77D 3LWIA 4OP0A 4AFZC 2JZ2A 5D7UA 3MP1A 2E65A 2B8AA 4E7JA 4O6JA 2OTJQ 4RTXA 1Y96B 1M4ZA 3V7SA 3ZFJA 5GANf 1MNDA 3GP8A 3ME9A 2NUPB 5A0DA 2X3WD 3MP8A 3NPFA 4JPBW 4BY6B 2RF0A 2ABLA 5IT9E 1SRMA 1NBEB 2BZYA 2V8IA 2X4WA 1SRLA 3H8ZA 1X6GA 5GMKi 2HKQB 1VQKQ 4QQDA 2ED1A 9ATCB 2CH4A 2OAWA 1VQ5Q 3PMTA 4BI3A 3CC7T 2VGNA 2A28A 1NLPC 3CCUT 4EMHA 1M8MA 5CAIA 2A08A 1T0JA 3RERA 3QWYA 5KYNA 3FJPA 3M54A 3M59A 1K73R 1OEBA 4HCZA 2Z0WA 2RK2A 2OAUA 1FYNA 1NG2A 2EJFA 4C92E 3CCQT 2LX7A 2OI3A 4M7AG 3JAME 1Z9QA 2RK1A 1QP2A 3LGLA 4XQ3A 2XKOC 3LX7A 2VVKA 5IAYA 2JUFA 1K1ZA 1YHQQ 1VQ7Q 2QAZA 2R5MA 2ZZDA 3VS3A 1TWBA 3QO3A 4XU0A 3SFMA 4C0DC 1GFCA 2MPXC 5LJ5d 2KR3A 5I2SA 3CC4T 5D6WA 1MMNA 1OPKA 3TVTA 3H9NA 2EYZA 3X28B 1WHKA 1WX6A 3JCMb 2GFUA 1VQLQ 1CKBA 4EDUA 4JJNK 2HMAA 1XJWB 2QGGA 4J9CA 1AWWA 2GF7A 4M78G 1Q82U 2A37A 2P0PA 4M75C 1BKBA 4PJNA 4BI4A 1UGPB 3CCSQ 4C0ZA 1D0XA 1U06A 1WHJA 2E6ZA 5CCAA 3O8VA 2RNAA 4RMOA 3JB9I 1TSFA 1TTHB 2KNBB 4KH1B 1GBQA 3M0UA 1GBRA 4FL6A 1IRXA 2NUTA 1IB8A 2KAFA 1OI1A 2KSSA 5C0MA 4JS5A 3VJPA 3CD6A 3VRYA 2CP3A 1N8RR 4X34A 5GAMg 1ZUYA 1BCMA 2K3YA 3TEEA 1PKTA 2HD0A 4QVDA 5CR2A 5GAN3 1TUDA 1ARKA 2XMFA 2DXTA 4PJJA 2COYA 4M4ZA 4C0FA 1M1KC 2JJ9A 5HK3A 3OS1A 1VQLT 1U5SA 4O5VA 1VQMQ 1K4US 3QYHB 3E2UA 2B86A 2AKLA 3GF5A 4JZ3A 4DEYA 1XNIA 2DTHA 1JJ2S 4AG1C 4CC2A 2EAYA 4P5NA 1YJ9A 5I11A 2LJ1A 5LJ5g 2PU9B 2RB6A 1WGSA 1QP3A 4QT7A 5GAMe 3G6ET 4FW2A 2ZPGB 2EKOA 2XK0A 4J5YA 2KT8A 4AMCA 1YJ9Q 2HNIA 4XTZA 3CCRT 3PT9A 1S1NA 4M7AD 1ZSZA 1HJDA 2ENMA 4OB2B 3J81E 2CUBA 3M9QA 1K9MU 4R0KA 1VQMA 1PD0A 4JLGA 8AT1B 3CC2A 4C5HA 4B9XA 4M75G 7AT1B 3MEVA 3LWHA 2EQJA 2QGFB 3PVLA 5CIUA 2BZ8A 2F5TX 3FRNA 5J26A 1K8AU 2L2PA 2NUPA 1SPKA 4OGEA 1WJSA 4IUUA 5J3BA 2BIVA 1PKSA 1TG0A 4MZMA 1VQ9A 1ZBJA 1YJWA 4C8QE 4KGXB 3CCMA 1U1SA 3BDLA 3I35A 2PVGB 3HPWA 4C92B 1JXMA 4JZ4A 5HKCA 4M7DA 5LJ3d 3VS0A 3OA6A 2X51A 2O31A 3MKDA 5L23A 3CCSA 4ORZA 1D3BA 2J6KA 5FU7B 3CBPA 1MV3A 4XU1A 1IXDA 3RMSA 4L6V5 5LJ5e 3CMET 4FT4A 1EIFA 1M1KR 4MZTA 5GANd 1VQLA 2PVDB 3AHUA 5FU7C 1PM3A 2QQBA 1BI1A 1E6HA 2VUBA 2JM8A 4M7DF 1ZUKA 1X75C 3GPLA 2EYYA 4LUDA 2HL5C 1K73C 4M77B 4RG2A 1UEBA 2DL4A 2IG0A 2GTOA 2M51A 3GNGA 2QYZA 3H41A 1VQ7A 2ECZA 4BUGA 2CDTA 2O01E 1RAEB 3DB3A 3M56A 3VYHB 2W10A 1XQHA 3RDVA 4II1A 3M53A 2R58A 1N6AA 2BTTA 5EC7A 4LDUA 2QA4T 1KHCA 1WA7A 4JRKA 4Y92A 4FU6A 5KCOA 2ZPIB 1BU1A 1E7OA 4KRTA 2ZCFB 3NMZC 4MDXA 4Z8AA 3QJ6A 4L59A 1SSHA 2X4YA 4KUIA 3C4SA 1YIJQ 1M2VA 3CPWP 4CC7A 4WF2A 3N5BB 2D0NA 4VUBA 1OPLA 1VQ5A 2MWPA 2LX9A 2JNGA 4FT2A 1TH7A 2Y90A 1J3TA 8ATCB 4KGZB 2E5QA 1NYFA 1YJWT 3MPUB 4DOWA 4C8QB 1QVFP 2HDAA 1YFNA 2PQWA 2CZ0B 2JS0A 1BI2A 3QXEB 1WHGA 2MMPA 2L5QA 2COWA 1Q7YC 1M2OA 2CZ1B 1WZOA 2XDBA 2MI6A 1OZ3A 3S3NA 1W1FA 4C5IA 1MNEA 2EYWA 4M77F 2M0YA 2RJEA 1N9SA 1BIBA 2AZSA 3PMIA 2OTJA 2CREA 2VGMA 2LNVA 1I81A 4IIOA 2RI2A 2PUOB 5CKDA 1UGVA 3SB2A 4J9IA 1D0YA 4OGCA 4XTVA 3U23A 1Y96A 1LNXA 4IURA 3G4ST 1RI9A 1VQNT 1M1GA 3UF4A 5LL6S 1WYXA 2LRQA 2I0NA 3MCAB 1RADB 4J7IA 1YI2A 2WSFE 4ZTFA 1SF9A 3L2UA 1YITT 5CKEA 4IUVA 2DERA 3LGFA 4F16A 5HK0A 1FMWA 1KQSA 4KULA 1YCYA 3R6OA 2QA4A 1SEMA 5EG2A 1BBZA 1IGUA 1NLOC 4PJOB 1YIJT 2HL3A 1D1CA 4MZPA 1KD1R 4KBMB 1OV3A 3V8JA 2YRVA 4QVZA 1VQ5T 5A0LA 3JCMg 1AWJA 1MMGA 4GBQA 3J80E 4LDWA 1N5ZA 5GAOm 2LZ6B 4PJOE 4DOVA 1QQJA 5IHKA 2COZA 3BFMA 1ABQA 4E7KA 2M16A 2K5FA 4Y91A 2PUKB 4XK8E 2K5LA 2FZGB 3DLLA 4LDVA 4RKUE 3UA6A 1HXDA 3ULRB 1CKAA 1Q81R 5KYXA 2QTVA 4HXJA 4FYYB 4PKCC 3JCMh 3GIBA 1UDLA 3OYCA 2MWOA 2KXDA 1WPYA 3NTIA 2FO0A 1VYTA 2LQ8A 3A98A 5I2MA 1K9MC 3DKMA 1SHFA 1VQ8A 2JMAA 1C6VX 3OS0A 4M77G 2RJFA 4ANJA 5KYWA 3SD4A 2RJCA 4JJCA 3OYNA 1UJYA 1YITA 2JS2A 2XHCA 1JB0E 1Q95G 1X6OA 3X25B 2KGTA 2LJ0A 1K76A 4E6RA 1QMCA 1LPLA 1YJNA 4LDXA 2DRMA 2XDDA 1GRIA 2YRCA 3OW2S 3G71Q 2VYTA 2AZVA 4PFZA 1AVZC 1M5Q1 5DY9A 3S3OA 2IIMA 4MDWA 5FW9A 4ELZC 5GMKh 3GOXA 4C0GA 4HCKA 2D8JA 2QQAA 3L2RA 3M58A 2PNIA 1K9MR 3CD6T 1Y07A 2HCKA 1RAGB 1TS9A 2CP2A 2VC8A 2X4JA 2QXFA 2FPDA 1M2VB 1MMAA 1S72Q 3FLGA 3EH1A 3CXCP 2M02A 3HRTA 3C0CA 3JCMe 1CSKA 1OU9A 1WNLA 1OULA 4PJOC 4LE9A 3TU4K 4RTWA 2GGRA 3CEYA 1VQ6Q 4A54A 1NE8A 4HT8A 3A8GB 5HY6A 4HVUA 5ECAA 3G71T 4LN2A 1RAAB 1Q7YU 1VQ6A 4M78D 2E6NA 3M4YA 5GAN6 5KYXB 3RKXA 2L0AA 5GAMd 2QQSA 3JCMc 1YI2T 3KXTA 3OYKA 5FRNA 3JCMV 2QEXT 1WXUA 2JVVA 2KT1A 1VYVA 1VQNA 1VYUA 4D8KA 3CD6Q 3M0QA 2KE9A 4ZN3A 2EFIA 2DD5A 3FIFA 3OMGA 5AT1B 1PRLC 3CMAT 4F7UF 1UGRB 3VKIA 1B7TA 2H8HA 1M9SA 4TVRA 2DYBA 4XTYA 2YUNA 2ZGWA 3KFVA 2CZ7B 4PK4A 3VU3C 1UGSB 3P8DA 1T3SA 2LCSA 3UWNA 3QYGB 1ZHIA 3A8OB 3JCMW 3JCMQ 3CCUQ 3GLXA 1KC8R 3UATA 2DZCA 2SEMA 2J6OA 1RLPC 2KRMA 3LH5A 4C92A 4M7DB 1PHTA 3G1JA 4RCBA 1IREB 4XU3A 1U1TA 3F70A 2GTJA 1JRIA 2AKKA 3CCRQ 4M7AE 2YXYA 1YITQ 1YWOA 2A36A 2RQRA 1NEGA 2DNUA 2PVOB 3L2ZA 3RKWA 5GAOl 4C92D 2E3HA 4BB7A 2CH4W 1OX9A 1GL5A 4PLIA 1QCOA 4E2FB 5CKBA 3CCEA 2VB6A 2K2VA 4PJMA 3IQLA 3X26B 1KQ1A 2RQVA 3MP6A 1QVFS 1W2BS 4JDSA 5GAOn 1KIKA 3HKSA 4N4GA 4LDYA 5GMKj 4CC3A 3RR6A 2C06A 3H0IA 1WHHA 1MMDA 3SWNB 4AG2C 4C5EA 1FX7A 3C12A 3NTHA 4BI8B 2GCXA 1NM7A 4Z88A 4C92F 3H0HA 2E70A 3ZL7C 1VQKA 3QPHA 2FB7A 2G6FX 4B9WA 2WACA 3G6EA 3CCVA 2K79A 3FEOA 4J6WA 1YHQT 3LH0A 3M4GA 3X24B 1AD5A 2A0FB 2YUQA 3EG9B 3CQTA 2DL7A 2K57A 3A5ZB 2QA4Q 1V76A 2J05A 2HBPA 4F17A 1ABOA 4PLLA 2P84A 3RUXA 4IIMA 5GAN4 3CPWA 5GAN8 1M8VA 4A4GA 4BY6C 1K8AR 4LNPA 1K9AA 3OYEA 2KYMA 2CSIA 2EJ9A 2X3XD 1AWXA 1W4SA 4XAXB 1WIEA 4RTUA 2DTIA 3OYJA 3PTAA 4M7AF 2P4TA 3CPWS 1M27C 5CKFA 2GBQA 3S6WA 5DLOA 2QK0A 3JSCA 2DZ9A 2YDLA 4ZNXA 1YJ9T 1YP5A 3LYIA 2FRWA 4ZGJB 3QJYA 3REBB 5LJ5f 2YSQA 2E4HA 3CCJT 2IPOB 3EGXA 3I56T 2CZ6B 2FRYA 4M78F 3INZA 1OZ2A 4V2SA 3TSWA 1ZSGA 2CT4A 4PL6A 3OS2A 4ZTJA 4JS4A 2X4XA 4L5GA 3OYBA 4M75E 3CCQA 1NPRA 3HRSA 2BZXA 1BCOA 2RMOA 3CC4A 1D09B 4PJLA 2DL5A 3EFSA 2EBPA 1FXXA 1M3CA 2KROA 4OMFB 1VIEA 1YJNT 3EGXB 3P8BB 1JBMA 3O5ZA 2EGCA 1VQOA 3VS6A 3URGA 2DYIA 2RHYA 3GBQA 2OX7A 4ESRA 3L42A 3EG1A 1ZA2B 2FL7A 4NL3A 2RHXA 1T0HA 4A4KA 2Y4XA 2C0IA 2XI9A 1UHFA 2VWFA 4KUDK 1M30A 3MEAA 4OMLA 1ZA1B 3QIIA 4C92C 2J6FA 2MK5A 4ATOA 1UB4A 3QKJA 5IH2A 1LCKA 3A8HB 5GANj 3CC7A 1SKUB 4QQGA 2DL8A 2J7IA 2VXFA 1ZSZC 3FJ5A 3I56A 1AHJB 1JO8A 2L3QA 3CCLA 4YTLA 4C0DB 2DFUA 3V8LA 1T3LA 2DPPB 3MO8A 1BK2A 1VQPA 1XOVA 2DBKA 2QQ9A 5J39A 4E7LA 1H8KA 3I55Q 1H92A 3I5RA 2VASA 5I22A 4D6WA 1ACMB 1WDXA 1VQ8T 2EWNA 3LLRA 1WHLA 3E1SA 2JM9A 3TQ7P 1WI7A 1G3YA 2BE7D 1TXQA 3I56Q 2LTOA 2M0OA 1OU8A 3QHSA 2YLCA 2LT4A 1EX4A 1VQ9Q 1ZX6A 2JW4A 4MMLA 5FU6B 3RBBB 3CC7Q 2DLPA 1I8FA 6AT1B 2E5KA 1QCFA 1H3ZA 1QWEA 1Q86U 1KSWA 3OS5A 2DKGA 1Q81U 3PVQA 2RM4A 1ZQ1A 4OMQA 3HTRA 2E3IA 3OB9A 3CC2Q 1V1CA 4NS5A 1VQOT 1HYOA 2WSEE 2LCCA 2DEUA 5FLXE 4RTZA 1M1FA 1PC0A 2DVJA 4C92G 1UTIA 1NPPA 3JB9G 5IXBA 4FYVB 2PTKA 1X43A 3CCJA 2O9VA 1PSEA 2RO0A 2DL3A 3CC4Q 1B3QA 1KQSS 1WHMA 1VQ6T 2C0OA 4M75B 3THKA 1BIAA 1U3OA 1PD1A 2KBTA 2K6DA 2DE0X 2RQTA 1BYMA 1GCQC 4DQ2A 1KC8U 1QWFA 1WQ7A 2LNHB 3HFNA 1UE9A 2ZPBB 2K9GA 1N8RC 2JT4A 2D0QB 2RHZA 2O4XA 3UT1A 3TCJA 1N9RA 2DF6A 2ESWA 5CVIA 2V1QA 3VV0A 2EYXA 3OSSC 3WVEB 2HBWA 1X2KA 4RUGA 4KT0E 4RCCA 1Y57A 3QUIA 2JTFA 3EH2A 4FSSA 2F1LA 1R77A 2F2XA 3FDRA 1A0NB 2JTEA 2LQNA 1QLYA
chains in the Genus database with same CATH topology
3SWNA 3RKXA 2E6ZA 5GAMd 2QQSA 5CCAA 3JCMc 2XG8D 4PNOA 3O8VA 4RMOA 3JB9I 2E1HA 3JCMV 3OYKA 3KXTA 2QEXT 5FRNA 2JVVA 4M7DC 2ZPEB 4E47A 1VQNA 2OTLA 4FL6A 2LDMA 2KAFA 5C0MA 1OI1A 2KSSA 4JS5A 3VJPA 1N27A 3CD6A 2WSCE 3OYAA 2RD1A 4OB1B 4X34A 4ZN3A 5LJ3j 5GAMg 3M55A 5GAOr 3RESA 4EPCA 2EFIA 1MGQA 2D9TA 2DD5A 2O4XB 1VQ7T 2K3YA 3JCMX 5A0GA 3FIFA 5FRMA 2L3RA 3A8LB 2HD0A 3OMGA 3TEEA 3TREA 4C8QD 4QVDA 4J6YA 5AYFA 2DXTA 3OYGA 1YBYA 3CMAT 3CC2T 4M77C 4F7UF 2CGHA 1UGRB 2EQKA 1LJOA 2LT1A 3VKIA 4J83A 4C0FA 1M1KC 4BE1A 1M9SA 4TVRA 5HK3A 3OS1A 1VQLT 4XTYA 2ZGWA 3OYDA 2CZ7B 3UPUA 3CCST 3VU3C 1UGSB 4O5VA 2K4YA 3QYHB 3P8DA 3L2VA 2DTOA 3UWNA 5GAN5 3V7CA 2KMTA 3QYGB 4IUTA 1X01A 1ZHIA 4N0AC 1Q82C 3A8OB 3JCMW 4XU3A 3GF5A 1XNIA 3JCMQ 2DTHA 3CMEA 3GLXA 2R57A 3HRUA 4A53A 1U8RA 1JJ2S 2DZCA 2NLUA 2DEQA 2EAYA 4P5NA 1YJ9A 4C92A 4M7DB 2DVEA 1IREB 2JN0A 1LOJA 4RCBA 3MEUA 1U1TA 2PU9B 3F70A 3C95A 1Y71A 2RB6A 4FM4B 4J6XA 5CK9A 5LJ5h 1JRIA 1WGSA 1QP3A 5GAOp 4M7AE 5GAMe 4M77E 5FROA 3G6ET 2QEXA 3ASKA 1I4K1 3CCVT 5CQXA 2ZPGB 2EKOA 1B34A 2X35A 2XK0A 4J5YA 3KBGA 1G3TA 1NJIU 3CXCA 4EMKB 2RA2A 1G3WA 2PVOB 3L2ZA 3RKWA 4OF1A 5GAOl 2RI3A 1BI0A 4C92D 2HNIA 4XTZA 4BB7A 3HP9A 3CCRT 2XD0A 4GY5A 3GNFB 3PT9A 2RH2A 4M7AD 4PLIA 1FWZA 3X20B 4EMKC 1PSFA 4OB0B 4OB2B 3META 5CKBA 3CCEA 3X26B 2K2VA 3M9QA 1SSFA 3J81E 1K9MU 4XTUA 1KQ1A 3DB4A 1VQMA 4MMKA 4JLGA 3QBYA 3WXMB 5C6SA 3CC2A 4HCCA 3JB9J 3MP6A 4C5HA 1WQWA 1QVFS 1W2BS 4B9XA 4JDSA 4M75G 3OYIA 1M1KU 5GAOn 4PJOA 3PGGA 3HKSA 4M78E 4N4GA 5GAMh 3MEVA 3LWHA 3JCMf 3ZEHA 2EQJA 3RKYA 4BACA 5CIUA 3OYYA 4LDYA 3BDUA 5GMKj 2F5TX 3FRNA 4RG8A 1KQ2A 3RIRA 1IZ6A 5KCHA 5J26A 5A2QE 1K8AU 5KH6A 4OGEA 1WJSA 4IUUA 2KY9A 4HA8A 5J3BA 2BIVA 2C06A 3SWNB 3OW2A 3JB9D 3G7ZA 3LW5E 4LD6A 3CCRA 4R56A 1O75A 2RJDA 4MZMA 1FX7A 4C5EA 1VQ9A 1YJWA 3C12A 3NTHA 4C8QE 4BI8B 4HKEA 4HT9A 2GCXA 1R8OB 3CCMA 4C92F 5DM7R 2FYKA 1U1SA 2E70A 2M1HA 2PVGB 3BDLA 3HPWA 4C92B 3P8HA 5HKCA 4M7DA 2DXBA 3QPHA 2FB7A 4CRIA 4B9WA 2WACA 3G6EA 3CCUA 1VQKA 3CCVA 5LJ3d 1YHQT 3FEOA 4J6WA 3LH0A 3M4GA 3M57A 3OA6A 4FIBA 1D3BB 3X24B 2DIQA 1YI2T 3QG1A 2KVQG 2F5KA 4X9CA 3QZ5B 3CCLT 3CCSA 2CYZB 1D3BA 5FU7B 3CBPA 2OTLT 2V8JA 4XU1A 4IUPA 3RMSA 4L6V5 3VYGA 5LJ5e 2DAQA 2G3RA 2K57A 3A5ZB 2L89A 2E10A 3CMET 4DA4A 1N8RU 4FT4A 1EIFA 2HBPA 3VUZA 2EJGA 1VQ5T 4C8QG 4MZTA 3OSVA 2RI5A 5GANd 4PLLA 2PVDB 3V8KA 1VQLA 5D6YA 3AHUA 5FU6C 5FU7C 3RUXA 4R55A 3V7RA 2QQBA 1BI1A 2E64A 2VUBA 3PFSA 2MAMA 4M7DF 3SWNC 5GAN4 3CPWA 5GAN8 3G4SA 1M8VA 4LD9K 1X75C 4A4GA 3GPLA 3HSBA 4BY6C 1K73C 2KDSA 3OYLA 1NZ9A 1QVPA 4M77B 4RG2A 1UEBA 2IG0A 1KC8C 3GNGA 3OYEA 1VQ7A 5CO7A 4GLKA 3H6ZA 3KUFA 4BUGA 1VQ4T 3MEWA 1NJIC 4ZGDB 2OTJT 2EJ9A 5KE3A 1VQMT 2DO3A 1W4SA 2O01E 2EYQA 4XAXB 3CCMT 3DB3A 5D6XA 4NOYA 2DTIA 4X9DA 3OYJA 3M56A 3I55A 3PTAA 5GMKm 3VYHB 4M7AF 1RI0A 1XQHA 5IN1A 3OQ5A 3M53A 4II1A 3HHTB 2P4TA 2QTXA 2R58A 1N6AA 4OVAA 4PJOF 3CPWS 3OBWA 2BKDN 4LDUA 5I21A 2FVUA 2QA4T 5CKFA 1JJ2A 1KHCA 4NL2A 4JRKA 3S6WA 3BW1A 3G71A 2LVMA 4FU6A 5KCOA 5DLOA 2ZPIB 4M7DG 2I2LA 4C5GA 2ZCFB 2QQRA 3CBMA 4MDXA 3QJ6A 3JSCA 4J8OA 2DZ9A 4L59A 1M90C 4N0AA 3QDRB 5LJ3e 1YJ9T 1S72A 1P92A 3EAEA 2X4YA 1B34B 4KUIA 1KD1C 3C4SA 5GANg 3OMCA 4ZGEB 1G5VA 2XU8A 3LYIA 4ZGJB 3EFRA 3OBYA 3QJYA 5GMKe 4WF2A 3N5BB 5LJ5f 5LJ3h 1GXIE 5LJ5j 2E12A 4VUBA 1YHQA 1H641 5CKHA 1VIFA 1VQ5A 2MWPA 5GAN6 2LX9A 3E9FA 3CCJT 3I56T 2JNGA 2CZ6B 4FT2A 1TH7A 2Y90A 3INZA 4M78F 1OZ2A 2MF2A 4ZN1A 3S3MA 4C8QA 2P0QA 4V2SA 2E5QA 1VQ9T 1YJWT 1VQPT 5GANe 3ZBDA 1VQ4A 1Q86C 4DOWA 4C8QB 4BE0A 3BY7A 4BD3A 4IKFA 1MHNA 1Y7XA 5L8RE 4PL6A 2PQWA 2CZ0B 1OYXA 1BI2A 3QXEB 4N4IA 3OS2A 5GANh 4JS4A 4ZTJA 2X4XA 3E19A 2MMPA 4L5GA 3OYBA 3JB9H 3OYFA 4M75E 4JLIA 4XTXA 1NPRA 1O9SA 2L5QA 3HRSA 3CCQA 3L1AA 5GAMf 2EQUA 4XU2A 1Q7YC 2DIGA 2CZ1B 4ME7A 2XDBA 2MI6A 1OZ3A 3CC4A 4QW2A 2A7YA 4JRPA 1QVGS 3PIOA 2CKKA 3S3NA 1VUBA 4JRIA 2CS7A 4C5IA 3EFSA 1FXXA 1QW1A 4OMFB 5LJ3g 1VIEA 5GAMj 1YJNT 3SDZA 4M78C 4E7IA 3P8BB 1JBMA 2V8KA 2AHJB 3NFCA 3M5AA 4M77F 3T9NA 2DXCA 2RJEA 4Y28E 1VQOA 1N9SA 3URGA 1BIBA 2LCLA 4CI0C 2DK3A 2DJZA 2RHYA 3PMIA 2OTJA 2VGMA 1UGQB 2LNVA 5M9OA 1I81A 4M78B 3L42A 1DJ7B 3CPFA 3VUBA 2RI2A 3C94A 2PUOB 1XTDA 4XTWA 5CR2A 2P0KA 1KD1U 5CKDA 2FL7A 3SB2A 5GMKl 4NL3A 2RHXA 2KQWA 4A4KA 4M7AA 3E9GA 4FSXA 4OGCA 4XTVA 4C8QF 3JCMJ 1Y96A 2M9UA 2Y4XA 2XI9A 3PIPA 3OY9A 2ZPHB 1LNXA 2VV5A 4KUDK 4IURA 3JCMd 3G4ST 3A8MB 1VQNT 2YHTA 3MEAA 1M1GA 3QIIA 1BI3A 5LL6S 4C92C 1Q81C 4PJOD 3JCMP 2HAXA 2LRQA 2D6FA 4ATOA 1UB4A 4A4EA 3OYMA 4BDYA 3MCAB 1KG1A 1G3SA 4M75F 3QKJA 3NTKA 3CXCS 2K5IA 3CBOA 4J7IA 1YI2A 3CMAA 5KE2A 2WSFE 3A8HB 4ZTFA 1RL2A 3L2UA 5GANj 3CC7A 3OYHA 1YITT 2JTMA 5CKEA 4IUVA 4N4HA 4QQGA 3LGFA 2DXUA 2VXFA 5HK0A 4EMGA 3QZ9B 2DD4A 3I56A 1KQSA 4KULA 1AHJB 1YCYA 4EMKA 3J7AF 3CCLA 3Q1JA 1V29B 2VXEA 4YTLA 4C0DB 3V8LA 3R6OA 2GQVA 2QA4A 1QVFA 2DPPB 2LQKA 3MO8A 1VQPA 5EG2A 1WJQA 1XOVA 4M7DE 4M7DD 4HCBA 5LJ3f 2QQ9A 3FB9A 5J39A 4E7LA 2FHDA 2H3JA 1VQKT 4PJOB 4D6WA 3L2WA 1VQ8T 4F7UA 1YIJT 2EWNA 2QI2A 2HQEA 2RHIA 3LLRA 3UDCA 5LJ5g 2HQXA 4MZPA 3JB9F 4M77D 3LWIA 3E1SA 4OP0A 4KBMB 2L8DA 2JZ2A 3MP1A 1G3YA 3HL8A 2E65A 3V8JA 2EIFA 2B8AA 2GFAA 2YRVA 4QQ6A 4QVZA 2IVWA 4ELYC 1HK9A 4E7JA 4O6JA 2LTOA 1Y96B 2M0OA 1M4ZA 2RHUA 3JRZA 3QHSA 3JCMg 3V7SA 3ZFJA 4F7UE 5A0LA 3J80E 4LDWA 2YLCA 5GAN7 2LT4A 5FU6B 5GANf 4MMLA 3GP8A 5GAOm 3ME9A 4M77A 5DLQE 3L2QA 1I8FA 3RMQA 4PJOE 3QSUA 4DOVA 5A0DA 3BFMA 1H3ZA 1Q86U 1W2BA 3MP8A 3OS5A 4M75A 2DKGA 1Q81U 4E7KA 4BY6B 2M16A 2K5FA 4Y91A 1QVGA 2PUKB 5IT9E 4XK8E 2K5LA 2R5AA 2RM4A 4LDVA 4RKUE 3DLLA 4QVCA 1HXDA 1ZQ1A 4UC4A 5CQYA 4Q5WA 2XDPA 4M75D 4PKCC 2V8IA 2X4WA 3OB9A 4NS5A 3JCMh 1VQOT 3GIBA 2ZPFB 3H8ZA 2MWOA 3OYCA 2F69A 1WPYA 5GMKi 3NTIA 3PNWC 2WSEE 3HFOA 2LCCA 2LQ8A 5I2MA 2YLBA 1K9MC 5FLXE 3DKMA 4QQDA 1M1FA 2BUDA 1S72T 1VQ8A 2JOYA 4BE2A 4A4HA 3OS0A 4C92G 4M77G 1NPPA 2RJFA 4F7UB 3JB9G 2LC4A 3SD4A 2RJCA 3PMTA 4BI3A 3OYNA 3CC7T 2VGNA 1YITA 3CCUT 1M90U 4EMHA 5CAIA 2XHCA 1JB0E 3CCJA 1X6OA 1PSEA 3X25B 2RO0A 3RERA 1YJNA 2QDYB 3FJPA 3M54A 4LDXA 3M59A 2XDDA 2XICA 1K8AC 3DLMA 3OW2S 2VYTA 4J7FA 4HCZA 1KQSS 3ER0A 1VQ6T 1M5Q1 5DY9A 2E41A 2RK2A 4M7AB 4M75B 1WJRA 2OAUA 2EJFA 3S3OA 4C92E 5GAN2 2Y4YA 3CCQT 1BIAA 4MDWA 4A4FA 4ELZC 4M7AG 5GMKh 3JAME 3GOXA 4BDZA 4C0GA 4E7HA 4C8QC 2RK1A 1QP2A 2QQAA 3LGLA 4XQ3A 2XKOC 3L2RA 1I5LA 3M58A 1BYMA 3LX7A 2A3LA 3CD6T 4DQ2A 1Y07A 1ZBXA 2KK4A 5IAYA 2JUFA 3FC3A 1KC8U 4M7AC 4JRQA 1WQ7A 5GAOq 3HFNA 2R5MA 2ZPBB 2ZZDA 1N8RC 2VC8A 2X4JA 2QXFA 1YIJA 3MHXA 3QO3A 4XU0A 3SFMA 2D0QB 4C0DC 2K3XA 2RHZA 2O4XA 3FLGA 3CCET 3UT1A 3TCJA 1N9RA 4OB3B 5CVIA 4Z02A 5LJ5d 5I2SA 3HRTA 3CC4T 5D6WA 3VV0A 5GAN3 3X28B 3JCMe 3JCMb 1WNLA 2GFUA 4JUVA 2XIDA 3I55T 4PJOC 3OSSC 3M4YA 3WVEB 4EDUA 4JJNK 4M78A 3TU4K 3CEYA 2EQMA 4A54A 2GF7A 4M78G 1Q82U 1NE8A 4HT8A 4F7UG 2P0PA 3A8GB 4KT0E 5HY6A 4PJOG 4RCCA 3WVDB 4M75C 4IUQA 1K73U 3QUIA 1BKBA 2JTFA 1KHIA 3G71T 4BI4A 3FDRA 1UGPB 4C0ZA 1Q7YU 1VQ6A 4M78D 2E6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ0 B;  1IRE B;  3QXE B;  2PU9 B;  1UGR B;  2PVG B;  2PVD B;  1DJ7 B;  4FM4 B;  4OB3 B;  5L8R E;  4ZGE B;  2DXB A;  4ZGJ B;  1QP3 A;  2WSF E;  2PUK B;  3A8H B;  2PUO B;  3VYH B;  4XK8 E;  1GXI E;  3X28 B;  2ZPG B;  4RKU E;  3HHT B;  2CZ1 B;  2ZPE B;  1QP2 A;  3X24 B;  3WVE B;  2CZ7 B;  3QZ9 B;  2PVO B;  2DD4 A;  1JB0 E;  2CZ6 B;  2ZPH B;  3QZ5 B;  1PSE A;  3X25 B;  1AHJ B;  1UGS B;  2WSC E;  2CYZ B;  1V29 B;  3QYH B;  3A8M B;  3QYG B;  4OB1 B;  2ZPF B;  2QDY B;  3WVD B;  3A8G B;  2DPP B;  2ZPI B;  3A8O B;  4KT0 E;  4L6V 5;  3X20 B;  3VYG A;  2DD5 A;  2AHJ B;  2WSE E;  2ZCF B;  2ZPB B;  1PSF A;  3LW5 E;  4OB0 B;  4OB2 B;  2ZZD A;  2DXC A;  4Y28 E;  3X26 B;  4ZGD B;  3A8L B;  1UGP B;  2D0Q B;  2O01 E;  1UGQ B; 
#chains in the Genus database with same CATH topology
 5KYY B;  4RTT A;  2DET A;  4PNO A;  4WCI A;  4OMP A;  4DEX A;  1QVG P;  1R0C B;  2ZPE B;  2OTL A;  2LDM A;  2PZ1 A;  2WSC E;  3OYA A;  2RD1 A;  4OB1 B;  1Z9Z A;  1MGQ A;  4DBH A;  3JCM X;  5A0G A;  2L3R A;  3TRE A;  3OYG A;  4J6Y A;  5AYF A;  1YBY A;  1I5O B;  1PCX A;  1JXO A;  5IHI A;  1LJO A;  2LT1 A;  2VKN A;  2L3S A;  2FPE A;  3OYD A;  3UPU A;  1RUW A;  3CCS T;  2K4Y A;  2RQU A;  3L2V A;  4N0A C;  1X01 A;  1I1J A;  1UEC A;  3G6E Q;  1R0B G;  3CME A;  1U8R A;  2R57 A;  2K7A A;  3VS7 A;  1B07 A;  5GJV B;  2LJ3 A;  1Y0M A;  2DVE A;  2EGA A;  1QVG S;  1Y71 A;  5LJ5 h;  4M77 E;  2QEX Q;  2QEX A;  1IGQ A;  3ASK A;  2YUP A;  1I4K 1;  3CCV T;  5CQX A;  1QCN A;  1B34 A;  2X35 A;  3CXC A;  3VRZ A;  2RI3 A;  1BI0 A;  2XD0 A;  4GY5 A;  1X2Q A;  2RH2 A;  1M90 R;  2EW3 A;  2W0Z A;  3VS4 A;  1JQQ A;  4EMK C;  1SSF A;  2JMC A;  1G2B A;  2KEA A;  1ZUU A;  3OYI A;  1M1K U;  3CCE Q;  3PGG A;  3PE0 A;  3JCM f;  4AFS C;  4BAC A;  2FG0 A;  3BDU A;  1KQ2 A;  3RIR A;  4J9E A;  1IZ6 A;  5A2Q E;  5KH6 A;  1AZG B;  5GJW B;  2DJQ A;  2CP6 A;  1X6B A;  3JB9 D;  3LW5 E;  3CCR A;  1RAI B;  3EG2 A;  1AZE A;  4HT9 A;  1R8O B;  2KXC A;  2FYK A;  1WLP B;  1AT1 B;  1KFZ A;  3P8H A;  2DXB A;  3CCU A;  4CRI A;  2NUZ A;  4FIB A;  2BE9 B;  3QZ5 B;  2CYZ B;  1RAB B;  2LQW A;  2OTL T;  1JEG A;  2J06 A;  2DAQ A;  2G3R A;  4DA4 A;  2E10 A;  1N8R U;  3VUZ A;  1GCP A;  4J9B A;  3OSV A;  2RI5 A;  3V8K A;  5KYU A;  3M0T A;  3V7R A;  3PFS A;  2MAM A;  3R6N A;  3G4S A;  3HSB A;  5CO7 A;  2CP5 A;  3H6Z A;  2DA9 A;  4Z89 A;  4ZGD B;  1NJI C;  1ZSZ B;  2OTJ T;  1PG5 B;  1VQM T;  3NGP A;  5D6X A;  1RI0 A;  5IN1 A;  2K3B A;  1GCQ A;  4PJO F;  3HHT B;  2QTX A;  4WTO B;  3OBW A;  2BKD N;  5I21 A;  2FVU A;  1OOT A;  3BW1 A;  2LVM A;  2LMJ A;  4M7D G;  1M3A A;  2AK5 A;  2I2L A;  4C5G A;  1I0C A;  2QQR A;  3CBM A;  2HZY A;  4N0A A;  3QDR B;  5LJ3 e;  1AWO A;  1S72 A;  1P92 A;  3EAE A;  3CCJ Q;  5GAN g;  3OMC A;  4ZGE B;  1G5V A;  3A1P A;  2XU8 A;  5GMK e;  3OBY A;  3MJX A;  5LJ3 h;  2KYB A;  5LJ5 j;  2V1R A;  3E9F A;  4F04 B;  3VS5 A;  1I07 A;  4OMO A;  4ZN1 A;  2MF2 A;  1VQ9 T;  5GAN e;  1Q86 C;  1VQ4 A;  4BE0 A;  4BD3 A;  5L8R E;  4N4I A;  5GAN h;  3E19 A;  1O9S A;  1IO6 A;  1YJN Q;  2DIG A;  4ME7 A;  1RAF B;  4QW2 A;  4JRP A;  2O9S A;  2D8H A;  1WXT A;  5GAM j;  4E7I A;  4M78 C;  3NFC A;  2V8K A;  3H0F A;  3M5A A;  1PWT A;  1YNZ A;  2DXC A;  3D7S B;  4CI0 C;  2DJZ A;  1VQ8 Q;  1UGQ B;  5M9O A;  4CC4 B;  1DJ7 B;  3VUB A;  3EFO B;  4DBQ A;  1XTD A;  3QWX X;  3TSZ A;  1KD1 U;  5GMK l;  4M7A A;  3E9G A;  3JCM J;  3OY9 A;  3PIP A;  2ZPH B;  2VV5 A;  3JCM d;  3A8M B;  2OJ2 A;  1VQP Q;  1BI3 A;  1JU5 C;  2P4R A;  1Q81 C;  4PJO D;  2HAX A;  4LUE A;  1YWP A;  4A4E A;  4BDY A;  2YRD A;  2NYS A;  1G3S A;  1KQS P;  1RAC B;  3NTK A;  2K5I A;  1PRM C;  3CBO A;  3CMA A;  5KE2 A;  1RL2 A;  3OYH A;  4J9F A;  1MUZ A;  4N4H A;  1FMV A;  2RPN A;  1W6X A;  3JV3 A;  2DXU A;  3QZ9 B;  2DD4 A;  2KRS A;  1V29 B;  2VXE A;  4RTY A;  2D1X A;  1QVF A;  2LQK A;  4M7D D;  5LJ3 f;  1E6G A;  3QDF A;  4F14 A;  1LVK A;  4F7U A;  4RTV A;  4DBR A;  3SHW A;  2QI2 A;  2HQE A;  2RHI A;  2GNC A;  3UDC A;  3JB9 F;  4AFQ C;  2MOX A;  2L8D A;  2NUT B;  3EG3 A;  3HL8 A;  4ELY C;  2EIF A;  2GFA A;  4QQ6 A;  2IVW A;  1IHW A;  1HK9 A;  2K2M A;  2RHU A;  3JRZ A;  4F7U E;  5GAN 7;  3G4S Q;  4M77 A;  5DLQ E;  3L2Q A;  1YI2 Q;  3RMQ A;  3QSU A;  1W2B A;  4M75 A;  3I5S A;  1X69 A;  2V26 A;  1QVG A;  2ZAE A;  2R5A A;  3CCQ Q;  1UFF A;  5IHN A;  4QVC A;  4UC4 A;  5CQY A;  4JJD A;  4Q5W A;  2XDP A;  4M75 D;  1H3H A;  2ZPF B;  2DM1 A;  2F69 A;  3PNW C;  1KJW A;  3HFO A;  2O2O A;  2YLB A;  2BUD A;  1S72 T;  2JOY A;  4BE2 A;  4A4H A;  4F7U B;  2FPF A;  2NWM A;  2LC4 A;  4FW1 A;  1M90 U;  3VS2 A;  4QKU A;  2YWW A;  4KH0 B;  1TUC A;  2HSE B;  2QDY B;  1K8A C;  2XIC A;  3DLM A;  4E7Z A;  1Q82 R;  4J7F A;  4J9D A;  3ER0 A;  3RNJ A;  2GQI A;  2E41 A;  4M7A B;  1WJR A;  5GAN 2;  2Y4Y A;  4J9G A;  4A4F A;  1RLQ C;  3EFO A;  2MYS A;  1KK7 A;  4BDZ A;  1VOM A;  1AOJ A;  4E7H A;  4C8Q C;  5FWB A;  2DMO A;  4EIK A;  1I5L A;  2A3L A;  3FC3 A;  1ZBX A;  2KK4 A;  1ZLM A;  4M7A C;  2L3P A;  4JRQ A;  5GAO q;  1YIJ A;  3MHX A;  5KYW B;  2K3X A;  3EGU A;  3CCE T;  4Z02 A;  4OB3 B;  4FYW B;  3CME Q;  1X27 A;  4J9H A;  4JUV A;  3I55 T;  2XID A;  4M78 A;  2EQM A;  2CSQ A;  2FEI A;  3WVD B;  4F7U G;  4PJO G;  1K73 U;  2LP5 A;  4IUQ A;  2DRK A;  1KHI A;  2JXB A;  5HCK A;  3SWN A;  2XG8 D;  3CCV Q;  2E1H A;  2EGE A;  3UA7 A;  1NYG A;  4M7D C;  4E47 A;  3AT1 B;  1N27 A;  2CT3 A;  2OTL Q;  5LJ3 j;  4E7S A;  3M55 A;  1QKX A;  3RES A;  4EPC A;  5GAO r;  1UUE A;  2D9T A;  2O4X B;  1VQ7 T;  1TOV A;  5FRM A;  1G83 A;  3A8L B;  4C8Q D;  3CC2 T;  4M77 C;  1JJ2 P;  2CGH A;  2EQK A;  2DBM A;  4J83 A;  4BE1 A;  3EG9 A;  2SRC A;  2HKN A;  1Q86 R;  3REA B;  2DTO A;  1GFD A;  5GAN 5;  3V7C A;  2KMT A;  4IUT A;  1Q82 C;  1NJI R;  4X1V A;  3HRU A;  4A53 A;  4B6M A;  2NLU A;  2DEQ A;  3CCM Q;  2JN0 A;  1LOJ A;  2YT6 A;  3MEU A;  1YJW Q;  4FM4 B;  3C95 A;  5CK9 A;  4PFO A;  4J6X A;  2YUO A;  5GAO p;  5FRO A;  1VA7 A;  2KRN A;  5KYU B;  1YN8 A;  4D8D A;  2FZC B;  3KBG A;  1G3T A;  1NJI U;  4EMK B;  2RA2 A;  1G3W A;  2ROL A;  4OF1 A;  2HSP A;  3HP9 A;  3GNF B;  4FCY A;  1FWZ A;  3X20 B;  5IXF A;  1PSF A;  4OB0 B;  2CP0 A;  3MET A;  4XTU A;  3DB4 A;  3M0R A;  4MMK A;  4HCC A;  3QBY A;  3WXM B;  5C6S A;  3JB9 J;  1WQW A;  1OX8 A;  1C0M A;  4PJO A;  3I9Q A;  1D1B A;  4OMN A;  4M78 E;  5GAM h;  1OQK A;  3ZEH A;  3RKY A;  3OYY A;  4PFP A;  4RG8 A;  5KCH A;  1UHC A;  2KY9 A;  4HA8 A;  1HSQ A;  3OW2 A;  3G7Z A;  2HQH A;  4LD6 A;  4R56 A;  1O75 A;  2RJD A;  4HKE A;  4A63 B;  5DM7 R;  1VQN Q;  2CUD A;  2M1H A;  3NHN A;  2KI7 A;  1Q7Y R;  2X9H A;  4GLM A;  2C0T A;  3M57 A;  1SG5 A;  1D3B B;  2EQI A;  2DIQ A;  3QG1 A;  2KVQ G;  2QDL A;  2F5K A;  4X9C A;  3CCL T;  2V8J A;  4IUP A;  3VYG A;  2L89 A;  2HEQ A;  2ATC B;  2EJG A;  4C8Q G;  3EHR A;  5D6Y A;  5FU6 C;  4R55 A;  2E64 A;  1AEY A;  4HVW A;  3SWN C;  2FZK B;  3CMA Q;  3EHQ A;  4LD9 K;  4JJB A;  4LXC A;  2KDS A;  3OYL A;  1NZ9 A;  1QVP A;  2MCN A;  1KC8 C;  4DBF A;  2QAS A;  4GLK A;  3OW2 P;  3KUF A;  2ROT A;  1VQ4 T;  3MEW A;  2EPD A;  1EFN A;  5FWC A;  5KE3 A;  2DO3 A;  4HVV A;  3VS1 A;  2EYQ A;  3CCM T;  1QKW A;  3I55 A;  4NOY A;  4X9D A;  2AT1 B;  5GMK m;  4OMM A;  1RAH B;  2MIO A;  3OQ5 A;  3EGD A;  4OVA A;  1JJ2 A;  3CCL Q;  4NL2 A;  3SEM A;  3G71 A;  3BE3 A;  1G8X A;  4J8O A;  1M90 C;  1BB9 A;  2RN8 A;  1B34 B;  1KD1 C;  1W70 A;  3EFR A;  1GXI E;  2E12 A;  1YHQ A;  1H64 1;  5CKH A;  1VIF A;  1K0X A;  3S3M A;  4C8Q A;  2P0Q A;  1HD3 A;  1VQP T;  3ZBD A;  1VQ4 Q;  1PNJ A;  3BY7 A;  3M0P A;  1D0Z A;  4K11 A;  1K0S A;  4IKF A;  1MHN A;  1Y7X A;  1UG1 A;  3EG0 A;  1OYX A;  5KYY A;  3JB9 H;  3OYF A;  4JLI A;  4XTX A;  1SHG A;  1C1A A;  1VQO Q;  3L1A A;  5GAM f;  2EQU A;  4XU2 A;  4KGV B;  2A7Y A;  1NEB A;  4AFU C;  3PIO A;  2CKK A;  1VUB A;  4JRI A;  2CS7 A;  1QW1 A;  2DX1 A;  5LJ3 g;  3SDZ A;  2AHJ B;  3T9N A;  4Y28 E;  2RQW A;  2LCL A;  2DK3 A;  4M78 B;  3CPF A;  3C94 A;  4XTW A;  1WFW A;  2P0K A;  4FYX B;  2EKH A;  2KQW A;  2F2V A;  4FSX A;  4C8Q F;  2M9U A;  2YHT A;  1EZZ B;  2O88 A;  1TU0 B;  2DIL A;  1MV0 B;  2QG9 B;  1FMK A;  3JCM P;  2D6F A;  2AIR B;  3OYM A;  2F2W A;  1KG1 A;  4M75 F;  1W2B P;  3CXC S;  1F1B B;  1WXB A;  2ED0 A;  1D1A A;  2JTM A;  1YCS B;  4EMG A;  1M3B A;  2H3E B;  3J7A F;  4EMK A;  3Q1J A;  1UJ0 A;  2GQV A;  1TUG B;  1WJQ A;  4M7D E;  2EVR A;  4HCB A;  4AT1 B;  3FB9 A;  2FHD A;  2H3J A;  1VQK T;  3L2W A;  1IHV A;  2CP7 A;  3EGD B;  2HQX A;  3M0S A;  4M77 D;  3LWI A;  4OP0 A;  4AFZ C;  2JZ2 A;  5D7U A;  3MP1 A;  2E65 A;  2B8A A;  4E7J A;  4O6J A;  2OTJ Q;  4RTX A;  1Y96 B;  1M4Z A;  3V7S A;  3ZFJ A;  5GAN f;  1MND A;  3GP8 A;  3ME9 A;  2NUP B;  5A0D A;  2X3W D;  3MP8 A;  3NPF A;  4JPB W;  4BY6 B;  2RF0 A;  2ABL A;  5IT9 E;  1SRM A;  1NBE B;  2BZY A;  2V8I A;  2X4W A;  1SRL A;  3H8Z A;  1X6G A;  5GMK i;  2HKQ B;  1VQK Q;  4QQD A;  2ED1 A;  9ATC B;  2CH4 A;  2OAW A;  1VQ5 Q;  3PMT A;  4BI3 A;  3CC7 T;  2VGN A;  2A28 A;  1NLP C;  3CCU T;  4EMH A;  1M8M A;  5CAI A;  2A08 A;  1T0J A;  3RER A;  3QWY A;  5KYN A;  3FJP A;  3M54 A;  3M59 A;  1K73 R;  1OEB A;  4HCZ A;  2Z0W A;  2RK2 A;  2OAU A;  1FYN A;  1NG2 A;  2EJF A;  4C92 E;  3CCQ T;  2LX7 A;  2OI3 A;  4M7A G;  3JAM E;  1Z9Q A;  2RK1 A;  1QP2 A;  3LGL A;  4XQ3 A;  2XKO C;  3LX7 A;  2VVK A;  5IAY A;  2JUF A;  1K1Z A;  1YHQ Q;  1VQ7 Q;  2QAZ A;  2R5M A;  2ZZD A;  3VS3 A;  1TWB A;  3QO3 A;  4XU0 A;  3SFM A;  4C0D C;  1GFC A;  2MPX C;  5LJ5 d;  2KR3 A;  5I2S A;  3CC4 T;  5D6W A;  1MMN A;  1OPK A;  3TVT A;  3H9N A;  2EYZ A;  3X28 B;  1WHK A;  1WX6 A;  3JCM b;  2GFU A;  1VQL Q;  1CKB A;  4EDU A;  4JJN K;  2HMA A;  1XJW B;  2QGG A;  4J9C A;  1AWW A;  2GF7 A;  4M78 G;  1Q82 U;  2A37 A;  2P0P A;  4M75 C;  1BKB A;  4PJN A;  4BI4 A;  1UGP B;  3CCS Q;  4C0Z A;  1D0X A;  1U06 A;  1WHJ A;  2E6Z A;  5CCA A;  3O8V A;  2RNA A;  4RMO A;  3JB9 I;  1TSF A;  1TTH B;  2KNB B;  4KH1 B;  1GBQ A;  3M0U A;  1GBR A;  4FL6 A;  1IRX A;  2NUT A;  1IB8 A;  2KAF A;  1OI1 A;  2KSS A;  5C0M A;  4JS5 A;  3VJP A;  3CD6 A;  3VRY A;  2CP3 A;  1N8R R;  4X34 A;  5GAM g;  1ZUY A;  1BCM A;  2K3Y A;  3TEE A;  1PKT A;  2HD0 A;  4QVD A;  5CR2 A;  5GAN 3;  1TUD A;  1ARK A;  2XMF A;  2DXT A;  4PJJ A;  2COY A;  4M4Z A;  4C0F A;  1M1K C;  2JJ9 A;  5HK3 A;  3OS1 A;  1VQL T;  1U5S A;  4O5V A;  1VQM Q;  1K4U S;  3QYH B;  3E2U A;  2B86 A;  2AKL A;  3GF5 A;  4JZ3 A;  4DEY A;  1XNI A;  2DTH A;  1JJ2 S;  4AG1 C;  4CC2 A;  2EAY A;  4P5N A;  1YJ9 A;  5I11 A;  2LJ1 A;  5LJ5 g;  2PU9 B;  2RB6 A;  1WGS A;  1QP3 A;  4QT7 A;  5GAM e;  3G6E T;  4FW2 A;  2ZPG B;  2EKO A;  2XK0 A;  4J5Y A;  2KT8 A;  4AMC A;  1YJ9 Q;  2HNI A;  4XTZ A;  3CCR T;  3PT9 A;  1S1N A;  4M7A D;  1ZSZ A;  1HJD A;  2ENM A;  4OB2 B;  3J81 E;  2CUB A;  3M9Q A;  1K9M U;  4R0K A;  1VQM A;  1PD0 A;  4JLG A;  8AT1 B;  3CC2 A;  4C5H A;  4B9X A;  4M75 G;  7AT1 B;  3MEV A;  3LWH A;  2EQJ A;  2QGF B;  3PVL A;  5CIU A;  2BZ8 A;  2F5T X;  3FRN A;  5J26 A;  1K8A U;  2L2P A;  2NUP A;  1SPK A;  4OGE A;  1WJS A;  4IUU A;  5J3B A;  2BIV A;  1PKS A;  1TG0 A;  4MZM A;  1VQ9 A;  1ZBJ A;  1YJW A;  4C8Q E;  4KGX B;  3CCM A;  1U1S A;  3BDL A;  3I35 A;  2PVG B;  3HPW A;  4C92 B;  1JXM A;  4JZ4 A;  5HKC A;  4M7D A;  5LJ3 d;  3VS0 A;  3OA6 A;  2X51 A;  2O31 A;  3MKD A;  5L23 A;  3CCS A;  4ORZ A;  1D3B A;  2J6K A;  5FU7 B;  3CBP A;  1MV3 A;  4XU1 A;  1IXD A;  3RMS A;  4L6V 5;  5LJ5 e;  3CME T;  4FT4 A;  1EIF A;  1M1K R;  4MZT A;  5GAN d;  1VQL A;  2PVD B;  3AHU A;  5FU7 C;  1PM3 A;  2QQB A;  1BI1 A;  1E6H A;  2VUB A;  2JM8 A;  4M7D F;  1ZUK A;  1X75 C;  3GPL A;  2EYY A;  4LUD A;  2HL5 C;  1K73 C;  4M77 B;  4RG2 A;  1UEB A;  2DL4 A;  2IG0 A;  2GTO A;  2M51 A;  3GNG A;  2QYZ A;  3H41 A;  1VQ7 A;  2ECZ A;  4BUG A;  2CDT A;  2O01 E;  1RAE B;  3DB3 A;  3M56 A;  3VYH B;  2W10 A;  1XQH A;  3RDV A;  4II1 A;  3M53 A;  2R58 A;  1N6A A;  2BTT A;  5EC7 A;  4LDU A;  2QA4 T;  1KHC A;  1WA7 A;  4JRK A;  4Y92 A;  4FU6 A;  5KCO A;  2ZPI B;  1BU1 A;  1E7O A;  4KRT A;  2ZCF B;  3NMZ C;  4MDX A;  4Z8A A;  3QJ6 A;  4L59 A;  1SSH A;  2X4Y A;  4KUI A;  3C4S A;  1YIJ Q;  1M2V A;  3CPW P;  4CC7 A;  4WF2 A;  3N5B B;  2D0N A;  4VUB A;  1OPL A;  1VQ5 A;  2MWP A;  2LX9 A;  2JNG A;  4FT2 A;  1TH7 A;  2Y90 A;  1J3T A;  8ATC B;  4KGZ B;  2E5Q A;  1NYF A;  1YJW T;  3MPU B;  4DOW A;  4C8Q B;  1QVF P;  2HDA A;  1YFN A;  2PQW A;  2CZ0 B;  2JS0 A;  1BI2 A;  3QXE B;  1WHG A;  2MMP A;  2L5Q A;  2COW A;  1Q7Y C;  1M2O A;  2CZ1 B;  1WZO A;  2XDB A;  2MI6 A;  1OZ3 A;  3S3N A;  1W1F A;  4C5I A;  1MNE A;  2EYW A;  4M77 F;  2M0Y A;  2RJE A;  1N9S A;  1BIB A;  2AZS A;  3PMI A;  2OTJ A;  2CRE A;  2VGM A;  2LNV A;  1I81 A;  4IIO A;  2RI2 A;  2PUO B;  5CKD A;  1UGV A;  3SB2 A;  4J9I A;  1D0Y A;  4OGC A;  4XTV A;  3U23 A;  1Y96 A;  1LNX A;  4IUR A;  3G4S T;  1RI9 A;  1VQN T;  1M1G A;  3UF4 A;  5LL6 S;  1WYX A;  2LRQ A;  2I0N A;  3MCA B;  1RAD B;  4J7I A;  1YI2 A;  2WSF E;  4ZTF A;  1SF9 A;  3L2U A;  1YIT T;  5CKE A;  4IUV A;  2DER A;  3LGF A;  4F16 A;  5HK0 A;  1FMW A;  1KQS A;  4KUL A;  1YCY A;  3R6O A;  2QA4 A;  1SEM A;  5EG2 A;  1BBZ A;  1IGU A;  1NLO C;  4PJO B;  1YIJ T;  2HL3 A;  1D1C A;  4MZP A;  1KD1 R;  4KBM B;  1OV3 A;  3V8J A;  2YRV A;  4QVZ A;  1VQ5 T;  5A0L A;  3JCM g;  1AWJ A;  1MMG A;  4GBQ A;  3J80 E;  4LDW A;  1N5Z A;  5GAO m;  2LZ6 B;  4PJO E;  4DOV A;  1QQJ A;  5IHK A;  2COZ A;  3BFM A;  1ABQ A;  4E7K A;  2M16 A;  2K5F A;  4Y91 A;  2PUK B;  4XK8 E;  2K5L A;  2FZG B;  3DLL A;  4LDV A;  4RKU E;  3UA6 A;  1HXD A;  3ULR B;  1CKA A;  1Q81 R;  5KYX A;  2QTV A;  4HXJ A;  4FYY B;  4PKC C;  3JCM h;  3GIB A;  1UDL A;  3OYC A;  2MWO A;  2KXD A;  1WPY A;  3NTI A;  2FO0 A;  1VYT A;  2LQ8 A;  3A98 A;  5I2M A;  1K9M C;  3DKM A;  1SHF A;  1VQ8 A;  2JMA A;  1C6V X;  3OS0 A;  4M77 G;  2RJF A;  4ANJ A;  5KYW A;  3SD4 A;  2RJC A;  4JJC A;  3OYN A;  1UJY A;  1YIT A;  2JS2 A;  2XHC A;  1JB0 E;  1Q95 G;  1X6O A;  3X25 B;  2KGT A;  2LJ0 A;  1K76 A;  4E6R A;  1QMC A;  1LPL A;  1YJN A;  4LDX A;  2DRM A;  2XDD A;  1GRI A;  2YRC A;  3OW2 S;  3G71 Q;  2VYT A;  2AZV A;  4PFZ A;  1AVZ C;  1M5Q 1;  5DY9 A;  3S3O A;  2IIM A;  4MDW A;  5FW9 A;  4ELZ C;  5GMK h;  3GOX A;  4C0G A;  4HCK A;  2D8J A;  2QQA A;  3L2R A;  3M58 A;  2PNI A;  1K9M R;  3CD6 T;  1Y07 A;  2HCK A;  1RAG B;  1TS9 A;  2CP2 A;  2VC8 A;  2X4J A;  2QXF A;  2FPD A;  1M2V B;  1MMA A;  1S72 Q;  3FLG A;  3EH1 A;  3CXC P;  2M02 A;  3HRT A;  3C0C A;  3JCM e;  1CSK A;  1OU9 A;  1WNL A;  1OUL A;  4PJO C;  4LE9 A;  3TU4 K;  4RTW A;  2GGR A;  3CEY A;  1VQ6 Q;  4A54 A;  1NE8 A;  4HT8 A;  3A8G B;  5HY6 A;  4HVU A;  5ECA A;  3G71 T;  4LN2 A;  1RAA B;  1Q7Y U;  1VQ6 A;  4M78 D;  2E6N A;  3M4Y A;  5GAN 6;  5KYX B;  3RKX A;  2L0A A;  5GAM d;  2QQS A;  3JCM c;  1YI2 T;  3KXT A;  3OYK A;  5FRN A;  3JCM V;  2QEX T;  1WXU A;  2JVV A;  2KT1 A;  1VYV A;  1VQN A;  1VYU A;  4D8K A;  3CD6 Q;  3M0Q A;  2KE9 A;  4ZN3 A;  2EFI A;  2DD5 A;  3FIF A;  3OMG A;  5AT1 B;  1PRL C;  3CMA T;  4F7U F;  1UGR B;  3VKI A;  1B7T A;  2H8H A;  1M9S A;  4TVR A;  2DYB A;  4XTY A;  2YUN A;  2ZGW A;  3KFV A;  2CZ7 B;  4PK4 A;  3VU3 C;  1UGS B;  3P8D A;  1T3S A;  2LCS A;  3UWN A;  3QYG B;  1ZHI A;  3A8O B;  3JCM W;  3JCM Q;  3CCU Q;  3GLX A;  1KC8 R;  3UAT A;  2DZC A;  2SEM A;  2J6O A;  1RLP C;  2KRM A;  3LH5 A;  4C92 A;  4M7D B;  1PHT A;  3G1J A;  4RCB A;  1IRE B;  4XU3 A;  1U1T A;  3F70 A;  2GTJ A;  1JRI A;  2AKK A;  3CCR Q;  4M7A E;  2YXY A;  1YIT Q;  1YWO A;  2A36 A;  2RQR A;  1NEG A;  2DNU A;  2PVO B;  3L2Z A;  3RKW A;  5GAO l;  4C92 D;  2E3H A;  4BB7 A;  2CH4 W;  1OX9 A;  1GL5 A;  4PLI A;  1QCO A;  4E2F B;  5CKB A;  3CCE A;  2VB6 A;  2K2V A;  4PJM A;  3IQL A;  3X26 B;  1KQ1 A;  2RQV A;  3MP6 A;  1QVF S;  1W2B S;  4JDS A;  5GAO n;  1KIK A;  3HKS A;  4N4G A;  4LDY A;  5GMK j;  4CC3 A;  3RR6 A;  2C06 A;  3H0I A;  1WHH A;  1MMD A;  3SWN B;  4AG2 C;  4C5E A;  1FX7 A;  3C12 A;  3NTH A;  4BI8 B;  2GCX A;  1NM7 A;  4Z88 A;  4C92 F;  3H0H A;  2E70 A;  3ZL7 C;  1VQK A;  3QPH A;  2FB7 A;  2G6F X;  4B9W A;  2WAC A;  3G6E A;  3CCV A;  2K79 A;  3FEO A;  4J6W A;  1YHQ T;  3LH0 A;  3M4G A;  3X24 B;  1AD5 A;  2A0F B;  2YUQ A;  3EG9 B;  3CQT A;  2DL7 A;  2K57 A;  3A5Z B;  2QA4 Q;  1V76 A;  2J05 A;  2HBP A;  4F17 A;  1ABO A;  4PLL A;  2P84 A;  3RUX A;  4IIM A;  5GAN 4;  3CPW A;  5GAN 8;  1M8V A;  4A4G A;  4BY6 C;  1K8A R;  4LNP A;  1K9A A;  3OYE A;  2KYM A;  2CSI A;  2EJ9 A;  2X3X D;  1AWX A;  1W4S A;  4XAX B;  1WIE A;  4RTU A;  2DTI A;  3OYJ A;  3PTA A;  4M7A F;  2P4T A;  3CPW S;  1M27 C;  5CKF A;  2GBQ A;  3S6W A;  5DLO A;  2QK0 A;  3JSC A;  2DZ9 A;  2YDL A;  4ZNX A;  1YJ9 T;  1YP5 A;  3LYI A;  2FRW A;  4ZGJ B;  3QJY A;  3REB B;  5LJ5 f;  2YSQ A;  2E4H A;  3CCJ T;  2IPO B;  3EGX A;  3I56 T;  2CZ6 B;  2FRY A;  4M78 F;  3INZ A;  1OZ2 A;  4V2S A;  3TSW A;  1ZSG A;  2CT4 A;  4PL6 A;  3OS2 A;  4ZTJ A;  4JS4 A;  2X4X A;  4L5G A;  3OYB A;  4M75 E;  3CCQ A;  1NPR A;  3HRS A;  2BZX A;  1BCO A;  2RMO A;  3CC4 A;  1D09 B;  4PJL A;  2DL5 A;  3EFS A;  2EBP A;  1FXX A;  1M3C A;  2KRO A;  4OMF B;  1VIE A;  1YJN T;  3EGX B;  3P8B B;  1JBM A;  3O5Z A;  2EGC A;  1VQO A;  3VS6 A;  3URG A;  2DYI A;  2RHY A;  3GBQ A;  2OX7 A;  4ESR A;  3L42 A;  3EG1 A;  1ZA2 B;  2FL7 A;  4NL3 A;  2RHX A;  1T0H A;  4A4K A;  2Y4X A;  2C0I A;  2XI9 A;  1UHF A;  2VWF A;  4KUD K;  1M30 A;  3MEA A;  4OML A;  1ZA1 B;  3QII A;  4C92 C;  2J6F A;  2MK5 A;  4ATO A;  1UB4 A;  3QKJ A;  5IH2 A;  1LCK A;  3A8H B;  5GAN j;  3CC7 A;  1SKU B;  4QQG A;  2DL8 A;  2J7I A;  2VXF A;  1ZSZ C;  3FJ5 A;  3I56 A;  1AHJ B;  1JO8 A;  2L3Q A;  3CCL A;  4YTL A;  4C0D B;  2DFU A;  3V8L A;  1T3L A;  2DPP B;  3MO8 A;  1BK2 A;  1VQP A;  1XOV A;  2DBK A;  2QQ9 A;  5J39 A;  4E7L A;  1H8K A;  3I55 Q;  1H92 A;  3I5R A;  2VAS A;  5I22 A;  4D6W A;  1ACM B;  1WDX A;  1VQ8 T;  2EWN A;  3LLR A;  1WHL A;  3E1S A;  2JM9 A;  3TQ7 P;  1WI7 A;  1G3Y A;  2BE7 D;  1TXQ A;  3I56 Q;  2LTO A;  2M0O A;  1OU8 A;  3QHS A;  2YLC A;  2LT4 A;  1EX4 A;  1VQ9 Q;  1ZX6 A;  2JW4 A;  4MML A;  5FU6 B;  3RBB B;  3CC7 Q;  2DLP A;  1I8F A;  6AT1 B;  2E5K A;  1QCF A;  1H3Z A;  1QWE A;  1Q86 U;  1KSW A;  3OS5 A;  2DKG A;  1Q81 U;  3PVQ A;  2RM4 A;  1ZQ1 A;  4OMQ A;  3HTR A;  2E3I A;  3OB9 A;  3CC2 Q;  1V1C A;  4NS5 A;  1VQO T;  1HYO A;  2WSE E;  2LCC A;  2DEU A;  5FLX E;  4RTZ A;  1M1F A;  1PC0 A;  2DVJ A;  4C92 G;  1UTI A;  1NPP A;  3JB9 G;  5IXB A;  4FYV B;  2PTK A;  1X43 A;  3CCJ A;  2O9V A;  1PSE A;  2RO0 A;  2DL3 A;  3CC4 Q;  1B3Q A;  1KQS S;  1WHM A;  1VQ6 T;  2C0O A;  4M75 B;  3THK A;  1BIA A;  1U3O A;  1PD1 A;  2KBT A;  2K6D A;  2DE0 X;  2RQT A;  1BYM A;  1GCQ C;  4DQ2 A;  1KC8 U;  1QWF A;  1WQ7 A;  2LNH B;  3HFN A;  1UE9 A;  2ZPB B;  2K9G A;  1N8R C;  2JT4 A;  2D0Q B;  2RHZ A;  2O4X A;  3UT1 A;  3TCJ A;  1N9R A;  2DF6 A;  2ESW A;  5CVI A;  2V1Q A;  3VV0 A;  2EYX A;  3OSS C;  3WVE B;  2HBW A;  1X2K A;  4RUG A;  4KT0 E;  4RCC A;  1Y57 A;  3QUI A;  2JTF A;  3EH2 A;  4FSS A;  2F1L A;  1R77 A;  2F2X A;  3FDR A;  1A0N B;  2JTE A;  2LQN A;  1QLY A; 
#chains in the Genus database with same CATH homology
 3SWN A;  3RKX A;  2E6Z A;  5GAM d;  2QQS A;  5CCA A;  3JCM c;  2XG8 D;  4PNO A;  3O8V A;  4RMO A;  3JB9 I;  2E1H A;  3JCM V;  3OYK A;  3KXT A;  2QEX T;  5FRN A;  2JVV A;  4M7D C;  2ZPE B;  4E47 A;  1VQN A;  2OTL A;  4FL6 A;  2LDM A;  2KAF A;  5C0M A;  1OI1 A;  2KSS A;  4JS5 A;  3VJP A;  1N27 A;  3CD6 A;  2WSC E;  3OYA A;  2RD1 A;  4OB1 B;  4X34 A;  4ZN3 A;  5LJ3 j;  5GAM g;  3M55 A;  5GAO r;  3RES A;  4EPC A;  2EFI A;  1MGQ A;  2D9T A;  2DD5 A;  2O4X B;  1VQ7 T;  2K3Y A;  3JCM X;  5A0G A;  3FIF A;  5FRM A;  2L3R A;  3A8L B;  2HD0 A;  3OMG A;  3TEE A;  3TRE A;  4C8Q D;  4QVD A;  4J6Y A;  5AYF A;  2DXT A;  3OYG A;  1YBY A;  3CMA T;  3CC2 T;  4M77 C;  4F7U F;  2CGH A;  1UGR B;  2EQK A;  1LJO A;  2LT1 A;  3VKI A;  4J83 A;  4C0F A;  1M1K C;  4BE1 A;  1M9S A;  4TVR A;  5HK3 A;  3OS1 A;  1VQL T;  4XTY A;  2ZGW A;  3OYD A;  2CZ7 B;  3UPU A;  3CCS T;  3VU3 C;  1UGS B;  4O5V A;  2K4Y A;  3QYH B;  3P8D A;  3L2V A;  2DTO A;  3UWN A;  5GAN 5;  3V7C A;  2KMT A;  3QYG B;  4IUT A;  1X01 A;  1ZHI A;  4N0A C;  1Q82 C;  3A8O B;  3JCM W;  4XU3 A;  3GF5 A;  1XNI A;  3JCM Q;  2DTH A;  3CME A;  3GLX A;  2R57 A;  3HRU A;  4A53 A;  1U8R A;  1JJ2 S;  2DZC A;  2NLU A;  2DEQ A;  2EAY A;  4P5N A;  1YJ9 A;  4C92 A;  4M7D B;  2DVE A;  1IRE B;  2JN0 A;  1LOJ A;  4RCB A;  3MEU A;  1U1T A;  2PU9 B;  3F70 A;  3C95 A;  1Y71 A;  2RB6 A;  4FM4 B;  4J6X A;  5CK9 A;  5LJ5 h;  1JRI A;  1WGS A;  1QP3 A;  5GAO p;  4M7A E;  5GAM e;  4M77 E;  5FRO A;  3G6E T;  2QEX A;  3ASK A;  1I4K 1;  3CCV T;  5CQX A;  2ZPG B;  2EKO A;  1B34 A;  2X35 A;  2XK0 A;  4J5Y A;  3KBG A;  1G3T A;  1NJI U;  3CXC A;  4EMK B;  2RA2 A;  1G3W A;  2PVO B;  3L2Z A;  3RKW A;  4OF1 A;  5GAO l;  2RI3 A;  1BI0 A;  4C92 D;  2HNI A;  4XTZ A;  4BB7 A;  3HP9 A;  3CCR T;  2XD0 A;  4GY5 A;  3GNF B;  3PT9 A;  2RH2 A;  4M7A D;  4PLI A;  1FWZ A;  3X20 B;  4EMK C;  1PSF A;  4OB0 B;  4OB2 B;  3MET A;  5CKB A;  3CCE A;  3X26 B;  2K2V A;  3M9Q A;  1SSF A;  3J81 E;  1K9M U;  4XTU A;  1KQ1 A;  3DB4 A;  1VQM A;  4MMK A;  4JLG A;  3QBY A;  3WXM B;  5C6S A;  3CC2 A;  4HCC A;  3JB9 J;  3MP6 A;  4C5H A;  1WQW A;  1QVF S;  1W2B S;  4B9X A;  4JDS A;  4M75 G;  3OYI A;  1M1K U;  5GAO n;  4PJO A;  3PGG A;  3HKS A;  4M78 E;  4N4G A;  5GAM h;  3MEV A;  3LWH A;  3JCM f;  3ZEH A;  2EQJ A;  3RKY A;  4BAC A;  5CIU A;  3OYY A;  4LDY A;  3BDU A;  5GMK j;  2F5T X;  3FRN A;  4RG8 A;  1KQ2 A;  3RIR A;  1IZ6 A;  5KCH A;  5J26 A;  5A2Q E;  1K8A U;  5KH6 A;  4OGE A;  1WJS A;  4IUU A;  2KY9 A;  4HA8 A;  5J3B A;  2BIV A;  2C06 A;  3SWN B;  3OW2 A;  3JB9 D;  3G7Z A;  3LW5 E;  4LD6 A;  3CCR A;  4R56 A;  1O75 A;  2RJD A;  4MZM A;  1FX7 A;  4C5E A;  1VQ9 A;  1YJW A;  3C12 A;  3NTH A;  4C8Q E;  4BI8 B;  4HKE A;  4HT9 A;  2GCX A;  1R8O B;  3CCM A;  4C92 F;  5DM7 R;  2FYK A;  1U1S A;  2E70 A;  2M1H A;  2PVG B;  3BDL A;  3HPW A;  4C92 B;  3P8H A;  5HKC A;  4M7D A;  2DXB A;  3QPH A;  2FB7 A;  4CRI A;  4B9W A;  2WAC A;  3G6E A;  3CCU A;  1VQK A;  3CCV A;  5LJ3 d;  1YHQ T;  3FEO A;  4J6W A;  3LH0 A;  3M4G A;  3M57 A;  3OA6 A;  4FIB A;  1D3B B;  3X24 B;  2DIQ A;  1YI2 T;  3QG1 A;  2KVQ G;  2F5K A;  4X9C A;  3QZ5 B;  3CCL T;  3CCS A;  2CYZ B;  1D3B A;  5FU7 B;  3CBP A;  2OTL T;  2V8J A;  4XU1 A;  4IUP A;  3RMS A;  4L6V 5;  3VYG A;  5LJ5 e;  2DAQ A;  2G3R A;  2K57 A;  3A5Z B;  2L89 A;  2E10 A;  3CME T;  4DA4 A;  1N8R U;  4FT4 A;  1EIF A;  2HBP A;  3VUZ A;  2EJG A;  1VQ5 T;  4C8Q G;  4MZT A;  3OSV A;  2RI5 A;  5GAN d;  4PLL A;  2PVD B;  3V8K A;  1VQL A;  5D6Y A;  3AHU A;  5FU6 C;  5FU7 C;  3RUX A;  4R55 A;  3V7R A;  2QQB A;  1BI1 A;  2E64 A;  2VUB A;  3PFS A;  2MAM A;  4M7D F;  3SWN C;  5GAN 4;  3CPW A;  5GAN 8;  3G4S A;  1M8V A;  4LD9 K;  1X75 C;  4A4G A;  3GPL A;  3HSB A;  4BY6 C;  1K73 C;  2KDS A;  3OYL A;  1NZ9 A;  1QVP A;  4M77 B;  4RG2 A;  1UEB A;  2IG0 A;  1KC8 C;  3GNG A;  3OYE A;  1VQ7 A;  5CO7 A;  4GLK A;  3H6Z A;  3KUF A;  4BUG A;  1VQ4 T;  3MEW A;  1NJI C;  4ZGD B;  2OTJ T;  2EJ9 A;  5KE3 A;  1VQM T;  2DO3 A;  1W4S A;  2O01 E;  2EYQ A;  4XAX B;  3CCM T;  3DB3 A;  5D6X A;  4NOY A;  2DTI A;  4X9D A;  3OYJ A;  3M56 A;  3I55 A;  3PTA A;  5GMK m;  3VYH B;  4M7A F;  1RI0 A;  1XQH A;  5IN1 A;  3OQ5 A;  3M53 A;  4II1 A;  3HHT B;  2P4T A;  2QTX A;  2R58 A;  1N6A A;  4OVA A;  4PJO F;  3CPW S;  3OBW A;  2BKD N;  4LDU A;  5I21 A;  2FVU A;  2QA4 T;  5CKF A;  1JJ2 A;  1KHC A;  4NL2 A;  4JRK A;  3S6W A;  3BW1 A;  3G71 A;  2LVM A;  4FU6 A;  5KCO A;  5DLO A;  2ZPI B;  4M7D G;  2I2L A;  4C5G A;  2ZCF B;  2QQR A;  3CBM A;  4MDX A;  3QJ6 A;  3JSC A;  4J8O A;  2DZ9 A;  4L59 A;  1M90 C;  4N0A A;  3QDR B;  5LJ3 e;  1YJ9 T;  1S72 A;  1P92 A;  3EAE A;  2X4Y A;  1B34 B;  4KUI A;  1KD1 C;  3C4S A;  5GAN g;  3OMC A;  4ZGE B;  1G5V A;  2XU8 A;  3LYI A;  4ZGJ B;  3EFR A;  3OBY A;  3QJY A;  5GMK e;  4WF2 A;  3N5B B;  5LJ5 f;  5LJ3 h;  1GXI E;  5LJ5 j;  2E12 A;  4VUB A;  1YHQ A;  1H64 1;  5CKH A;  1VIF A;  1VQ5 A;  2MWP A;  5GAN 6;  2LX9 A;  3E9F A;  3CCJ T;  3I56 T;  2JNG A;  2CZ6 B;  4FT2 A;  1TH7 A;  2Y90 A;  3INZ A;  4M78 F;  1OZ2 A;  2MF2 A;  4ZN1 A;  3S3M A;  4C8Q A;  2P0Q A;  4V2S A;  2E5Q A;  1VQ9 T;  1YJW T;  1VQP T;  5GAN e;  3ZBD A;  1VQ4 A;  1Q86 C;  4DOW A;  4C8Q B;  4BE0 A;  3BY7 A;  4BD3 A;  4IKF A;  1MHN A;  1Y7X A;  5L8R E;  4PL6 A;  2PQW A;  2CZ0 B;  1OYX A;  1BI2 A;  3QXE B;  4N4I A;  3OS2 A;  5GAN h;  4JS4 A;  4ZTJ A;  2X4X A;  3E19 A;  2MMP A;  4L5G A;  3OYB A;  3JB9 H;  3OYF A;  4M75 E;  4JLI A;  4XTX A;  1NPR A;  1O9S A;  2L5Q A;  3HRS A;  3CCQ A;  3L1A A;  5GAM f;  2EQU A;  4XU2 A;  1Q7Y C;  2DIG A;  2CZ1 B;  4ME7 A;  2XDB A;  2MI6 A;  1OZ3 A;  3CC4 A;  4QW2 A;  2A7Y A;  4JRP A;  1QVG S;  3PIO A;  2CKK A;  3S3N A;  1VUB A;  4JRI A;  2CS7 A;  4C5I A;  3EFS A;  1FXX A;  1QW1 A;  4OMF B;  5LJ3 g;  1VIE A;  5GAM j;  1YJN T;  3SDZ A;  4M78 C;  4E7I A;  3P8B B;  1JBM A;  2V8K A;  2AHJ B;  3NFC A;  3M5A A;  4M77 F;  3T9N A;  2DXC A;  2RJE A;  4Y28 E;  1VQO A;  1N9S A;  3URG A;  1BIB A;  2LCL A;  4CI0 C;  2DK3 A;  2DJZ A;  2RHY A;  3PMI A;  2OTJ A;  2VGM A;  1UGQ B;  2LNV A;  5M9O A;  1I81 A;  4M78 B;  3L42 A;  1DJ7 B;  3CPF A;  3VUB A;  2RI2 A;  3C94 A;  2PUO B;  1XTD A;  4XTW A;  5CR2 A;  2P0K A;  1KD1 U;  5CKD A;  2FL7 A;  3SB2 A;  5GMK l;  4NL3 A;  2RHX A;  2KQW A;  4A4K A;  4M7A A;  3E9G A;  4FSX A;  4OGC A;  4XTV A;  4C8Q F;  3JCM J;  1Y96 A;  2M9U A;  2Y4X A;  2XI9 A;  3PIP A;  3OY9 A;  2ZPH B;  1LNX A;  2VV5 A;  4KUD K;  4IUR A;  3JCM d;  3G4S T;  3A8M B;  1VQN T;  2YHT A;  3MEA A;  1M1G A;  3QII A;  1BI3 A;  5LL6 S;  4C92 C;  1Q81 C;  4PJO D;  3JCM P;  2HAX A;  2LRQ A;  2D6F A;  4ATO A;  1UB4 A;  4A4E A;  3OYM A;  4BDY A;  3MCA B;  1KG1 A;  1G3S A;  4M75 F;  3QKJ A;  3NTK A;  3CXC S;  2K5I A;  3CBO A;  4J7I A;  1YI2 A;  3CMA A;  5KE2 A;  2WSF E;  3A8H B;  4ZTF A;  1RL2 A;  3L2U A;  5GAN j;  3CC7 A;  3OYH A;  1YIT T;  2JTM A;  5CKE A;  4IUV A;  4N4H A;  4QQG A;  3LGF A;  2DXU A;  2VXF A;  5HK0 A;  4EMG A;  3QZ9 B;  2DD4 A;  3I56 A;  1KQS A;  4KUL A;  1AHJ B;  1YCY A;  4EMK A;  3J7A F;  3CCL A;  3Q1J A;  1V29 B;  2VXE A;  4YTL A;  4C0D B;  3V8L A;  3R6O A;  2GQV A;  2QA4 A;  1QVF A;  2DPP B;  2LQK A;  3MO8 A;  1VQP A;  5EG2 A;  1WJQ A;  1XOV A;  4M7D E;  4M7D D;  4HCB A;  5LJ3 f;  2QQ9 A;  3FB9 A;  5J39 A;  4E7L A;  2FHD A;  2H3J A;  1VQK T;  4PJO B;  4D6W A;  3L2W A;  1VQ8 T;  4F7U A;  1YIJ T;  2EWN A;  2QI2 A;  2HQE A;  2RHI A;  3LLR A;  3UDC A;  5LJ5 g;  2HQX A;  4MZP A;  3JB9 F;  4M77 D;  3LWI A;  3E1S A;  4OP0 A;  4KBM B;  2L8D A;  2JZ2 A;  3MP1 A;  1G3Y A;  3HL8 A;  2E65 A;  3V8J A;  2EIF A;  2B8A A;  2GFA A;  2YRV A;  4QQ6 A;  4QVZ A;  2IVW A;  4ELY C;  1HK9 A;  4E7J A;  4O6J A;  2LTO A;  1Y96 B;  2M0O A;  1M4Z A;  2RHU A;  3JRZ A;  3QHS A;  3JCM g;  3V7S A;  3ZFJ A;  4F7U E;  5A0L A;  3J80 E;  4LDW A;  2YLC A;  5GAN 7;  2LT4 A;  5FU6 B;  5GAN f;  4MML A;  3GP8 A;  5GAO m;  3ME9 A;  4M77 A;  5DLQ E;  3L2Q A;  1I8F A;  3RMQ A;  4PJO E;  3QSU A;  4DOV A;  5A0D A;  3BFM A;  1H3Z A;  1Q86 U;  1W2B A;  3MP8 A;  3OS5 A;  4M75 A;  2DKG A;  1Q81 U;  4E7K A;  4BY6 B;  2M16 A;  2K5F A;  4Y91 A;  1QVG A;  2PUK B;  5IT9 E;  4XK8 E;  2K5L A;  2R5A A;  2RM4 A;  4LDV A;  4RKU E;  3DLL A;  4QVC A;  1HXD A;  1ZQ1 A;  4UC4 A;  5CQY A;  4Q5W A;  2XDP A;  4M75 D;  4PKC C;  2V8I A;  2X4W A;  3OB9 A;  4NS5 A;  3JCM h;  1VQO T;  3GIB A;  2ZPF B;  3H8Z A;  2MWO A;  3OYC A;  2F69 A;  1WPY A;  5GMK i;  3NTI A;  3PNW C;  2WSE E;  3HFO A;  2LCC A;  2LQ8 A;  5I2M A;  2YLB A;  1K9M C;  5FLX E;  3DKM A;  4QQD A;  1M1F A;  2BUD A;  1S72 T;  1VQ8 A;  2JOY A;  4BE2 A;  4A4H A;  3OS0 A;  4C92 G;  4M77 G;  1NPP A;  2RJF A;  4F7U B;  3JB9 G;  2LC4 A;  3SD4 A;  2RJC A;  3PMT A;  4BI3 A;  3OYN A;  3CC7 T;  2VGN A;  1YIT A;  3CCU T;  1M90 U;  4EMH A;  5CAI A;  2XHC A;  1JB0 E;  3CCJ A;  1X6O A;  1PSE A;  3X25 B;  2RO0 A;  3RER A;  1YJN A;  2QDY B;  3FJP A;  3M54 A;  4LDX A;  3M59 A;  2XDD A;  2XIC A;  1K8A C;  3DLM A;  3OW2 S;  2VYT A;  4J7F A;  4HCZ A;  1KQS S;  3ER0 A;  1VQ6 T;  1M5Q 1;  5DY9 A;  2E41 A;  2RK2 A;  4M7A B;  4M75 B;  1WJR A;  2OAU A;  2EJF A;  3S3O A;  4C92 E;  5GAN 2;  2Y4Y A;  3CCQ T;  1BIA A;  4MDW A;  4A4F A;  4ELZ C;  4M7A G;  5GMK h;  3JAM E;  3GOX A;  4BDZ A;  4C0G A;  4E7H A;  4C8Q C;  2RK1 A;  1QP2 A;  2QQA A;  3LGL A;  4XQ3 A;  2XKO C;  3L2R A;  1I5L A;  3M58 A;  1BYM A;  3LX7 A;  2A3L A;  3CD6 T;  4DQ2 A;  1Y07 A;  1ZBX A;  2KK4 A;  5IAY A;  2JUF A;  3FC3 A;  1KC8 U;  4M7A C;  4JRQ A;  1WQ7 A;  5GAO q;  3HFN A;  2R5M A;  2ZPB B;  2ZZD A;  1N8R C;  2VC8 A;  2X4J A;  2QXF A;  1YIJ A;  3MHX A;  3QO3 A;  4XU0 A;  3SFM A;  2D0Q B;  4C0D C;  2K3X A;  2RHZ A;  2O4X A;  3FLG A;  3CCE T;  3UT1 A;  3TCJ A;  1N9R A;  4OB3 B;  5CVI A;  4Z02 A;  5LJ5 d;  5I2S A;  3HRT A;  3CC4 T;  5D6W A;  3VV0 A;  5GAN 3;  3X28 B;  3JCM e;  3JCM b;  1WNL A;  2GFU A;  4JUV A;  2XID A;  3I55 T;  4PJO C;  3OSS C;  3M4Y A;  3WVE B;  4EDU A;  4JJN K;  4M78 A;  3TU4 K;  3CEY A;  2EQM A;  4A54 A;  2GF7 A;  4M78 G;  1Q82 U;  1NE8 A;  4HT8 A;  4F7U G;  2P0P A;  3A8G B;  4KT0 E;  5HY6 A;  4PJO G;  4RCC A;  3WVD B;  4M75 C;  4IUQ A;  1K73 U;  3QUI A;  1BKB A;  2JTF A;  1KHI A;  3G71 T;  4BI4 A;  3FDR A;  1UGP B;  4C0Z A;  1Q7Y U;  1VQ6 A;  4M78 D;  2E6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...