The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
sequence length |
238
|
structure length |
238
|
Chain Sequence |
TRSFYNDGHLNGWDYVRKENQGTVSEVSNVVFKGTSALKMTQTYTPGYTGRYHSEVDHNRGYQRGEEQFYGFAFRLSEDWQFQPQSYNIAQFIANRPGAGCGGDDWMPSTMIWIQNNQLYSRYVNGHYRQPNCGRNIVTRPNLATVSAGAWHRVVLQIKWASDNTGYFKIWFDGAKVHEEYNVATTVDDDSVFQFRVGLYANSWHDDGHMTGTQGFRQVWYDEVAVGTTFADVDPDQA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of polysaccharide lyase family 20 endo-beta-1,4-glucuronan lyase from the filamentous fungus Trichoderma reesei.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| source organism |
Trichoderma reesei
|
| molecule keywords |
Glucuronan lyase A
|
| total genus |
64
|
| structure length |
238
|
| sequence length |
238
|
| ec nomenclature |
ec
4.2.2.14: Glucuronan lyase. |
| pdb deposition date | 2009-02-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF14099 | Polysacc_lyase | Polysaccharide lyase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |
