2ZZMA

The complex structure of atrm5 and trnaleu
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
333
structure length
329
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVSYAPREYILALDFKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 82
structure length 329
sequence length 333
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zzmA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zzmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zzmA03
3CCFA 5C9ZA 3Q7EA 4QVKA 4KVZA 4GF5A 4PINA 2C7RA 3M33A 3Q87B 2AOTB 3FPGA 5K8VA 4PIMA 4CKBA 3HCBA 2P3OA 1NV9A 3EEOA 2FHPA 4ER7A 2ADMA 5GWXA 1G55A 1P39A 2I7CA 4BLWA 2P7HA 4RTOA 1NW5A 2B3TA 4IV0A 3C3YA 3HNRA 2BH2A 5DX1A 2B2CA 2XYRA 5FCDA 3UJBA 3I9FA 4C08A 1QAOA 3NMUF 3L8DA 2ERCA 2OBFA 4XUDA 1L1EA 3E05A 2E5WA 3A27A 3JWJA 2GS9A 5CVEA 1VL5A 5CVVA 2NXEA 1RJEA 3GCZA 3LBYA 5EPEA 1FPQA 2OKCA 3GWZA 5T67A 4DCGA 4DF3A 2PWYA 5ICGA 1R74A 1T43A 3MCTA 3RIEA 3ER8A 3NVKI 2AN3A 2G71A 3T7SA 2UZ4A 1R8YA 4YUXA 1L9KA 2ZWAA 3FPFA 4CTKA 4PONA 1VPTA 3GO4A 5FA8A 5K0EA 5GM1A 3H2BA 4C05A 5FADA 2EJUA 1NW8A 5H02A 1YB2A 4GQBA 2V74B 4AX8A 4IV8A 1ORIA 2P35A 2LD4A 5DLYA 3AXSA 1XXLA 3E8SA 3T7TA 2YTZA 3ORHA 3OFKA 2HR1A 2VDUE 3FRHA 4RTKA 3NVMB 2GAFA 2AN5A 2IIPA 4Z2YA 2AS0A 1DCTA 4RVGA 4PYJA 3M70A 4RTLA 4Y2HA 1JSXA 3PFGA 3BGDA 1I1NA 3OPNA 5CVUA 2HWKA 2QRVA 3A4TA 3DMGA 4V0QA 2JG3A 1DUSA 4CXMA 5E1BA 2GH1A 2JHCA 4YUYA 2IDKA 5F2NA 2FPOA 3GIWA 1F3LA 2ZW9A 1WS6A 3MQ2A 1WG8A 1Z3CA 1R00A 1XDUA 4PGHA 4PGGA 2ONYA 1NBIA 2NXJA 3UJDA 3PT9A 5K0BA 3FPJA 1O9GA 4X60A 1KXZA 1SUSA 5EZQA 4C04A 2OXTA 1SQFA 2G70A 2HNKA 3CBGA 4GEKA 4MWZA 4X41A 1PRYA 2JHPA 3EVZA 4AUKA 4KDCA 4E30A 2I62A 1M6EX 1WXWA 5GOZA 2VDVE 3KQPA 2GLUA 3K0BA 5FQNA 3TMAA 2OY0A 1X1DA 5GINE 5E8RA 4RX1A 4E32A 1KPIA 3B7PA 3DLIA 3AWIA 2HTEA 3TM4A 3VSEA 1IY9A 5FWAA 5T64A 1L3IA 4E2WA 4RTJA 3NTVA 3IV6A 3MGGA 2PT9A 2ZFUA 3R0QA 5E1MA 3TM5A 4E70A 2AOUB 4MQ4A 3MHTA 3ELYA 3OE4A 2PY6A 2FK7A 2UYOA 5C0OE 4DKJA 3C0KA 3O4FA 1KP9A 1TW2A 4RVHA 2P3LA 2O57A 2O0LA 3G2PA 1XCJA 2ZBQA 3HCEA 2FCAA 3G5LA 4LWPA 1JTFA 3KR2A 1DL5A 2BZGA 5E8JA 3FRIA 2YQZA 4GOMD 1X1CA 3DMHA 5ERGB 2XBMA 3OZSA 4YV1A 4FS8A 3C6MA 3MTIA 4FP9A 4GOLD 4QVGA 5K0LA 3T0IA 3FPEA 2B9EA 5EIFA 2JJQA 3BWCA 2ONZA 2PSSA 2P1DA 4AZTA 5KS2A 3SX0A 3HVKA 3F4KA 3GRUA 5GP1A 5U4XA 1HMYA 2P41A 2IP2A 1FP2A 4GC9A 2WK1A 4EKIA 4U7TB 2YR0A 2NP7A 8MHTA 5G02A 2ZVJA 3P2KA 2P7IA 4WXHA 3M6VA 3E23A 5EHIA 4RYLA 5E9WA 2IBTA 1XDSA 4PYKA 3UA4A 1EJ6A 1QZZA 2YXEA 2VP3A 1HNNA 3SMQA 5BW4A 3DMFA 5EZSA 1YFJA 3KQSA 5DM2A 2BR5A 3DULA 4DMGA 3SR4A 2HV9A 4KRGA 1G38A 3KPJA 4KWCA 4R8RA 1BHJA 1R18A 5FULA 3TKYA 2ESRA 1NV8A 1NW6A 3UBTA 1JQ3A 7MHTA 4EK9A 2P3QA 2BR3A 4R6XA 1JSZA 5FHRA 3THSA 4RVFA 5FWDA 5E2BA 3V97A 3T7RA 3C3PA 1ZGAA 3DR5A 5EIWA 5GM2A 3KQOA 4G56A 3HCAA 4IKPA 5HIKA 4LG1A 4RTNA 3RODA 2H1RA 1NE2A 3TRKA 1R8XA 5EKUA 4DA4A 2XYVA 3ERCA 2ZWVA 3SM3A 1D2GA 3MB5A 3MCZA 3LPMA 1VP3A 3G8AA 1KIAA 2P8JA 4F86A 5BW5A 1XDZA 4X63A 4M38A 5K0GA 3HA5A 2AOTA 1X1BA 4DZRA 5JUWA 2PX2A 2N47A 2VDWA 3ME5A 5DXAA 2PX4A 3AY0A 1JG3A 1V39A 5ICEA 3HEMA 1RJFA 2CL5A 4BP1A 3FPHA 2YXDA 2ZIFA 5EEGA 1X19A 5ICCA 1FBNA 3UJ8A 3BGIA 5EVJA 2FK8A 4GOOD 1RJGA 4ATNA 1L3CA 3EVGA 5E2AA 4MIKA 4B17A 3HTXA 5KQRA 2Z6UA 5IKMA 2G8NA 1SKMA 3HA7A 2Z6QA 3UJ7A 2AOWA 5KQSA 1P91A 3FZGA 4ISCA 2G72A 5K0FA 2XVAA 5EGSA 2JHAA 3AJDA 1RI4A 5K0NA 3CJRA 1P1BA 4HG2A 2AN4A 2AVDA 3GGDA 5CIYA 5DTRA 3FUTA 3IEIA 4MTLA 2YVLA 4QPNA 5DXJA 4R8SA 2OO3A 3UA3A 4YUZA 1JQDA 1RI2A 4OX9Y 3G5TA 1FP1D 3ELWA 3LBFA 3QV2A 4JXJA 3UJ6A 1JG4A 4PCAA 3FTEA 4UOEA 1O9HA 5E9JA 4QDJA 2I9KA 1ZHFA 3R6TA 4RV9A 1G6Q1 3KQVA 4QTTB 4E31A 5LQCA 2ORED 2YXLA 1YZHA 1TPYA 4E2ZA 5FQOA 3P9NA 3EVBA 1QYRA 2O05A 1AV6A 1VBFA 3TKAA 2EG5A 3GRRA 3O31A 4XCXA 4A6EA 2YX1A 2QE6A 5FHQA 1NW3A 3SGLA 3B3JA 1N7JA 3BGVA 4OBXA 3REOA 3BKXA 4EVIA 4FR0A 5LQKA 2Y1XA 5K05A 3KR9A 2VZ9A 5EKXA 5K01A 1SVUA 1D2CA 3JWIA 1UWVA 3NDJA 3GRYA 1SG9A 3NDIA 1N2XA 4POOA 4O29A 5GIOE 3B5IA 3LCCA 5EEHA 3UFBA 2ZBPA 3SSOA 4HTFB 3EMBA 2NYUA 3FUUA 1AF7A 1R6AA 2PKWA 3P2IA 3THRA 3V8VA 3P8ZA 1RI5A 2GA9A 4M7RA 2QM3A 4RTMA 4FGZA 1WXXA 2H00A 3HVJA 3KPWA 2DPMA 3LX6A 3OCJA 4KIGA 5P8WA 4RVDA 2JH9A 3I58A 1YFLA 1JQEA 4DM3A 2WA2A 1AQJA 4RTPA 2PGXA 2PXAA 3JWGA 1Q0SA 3QOXA 5K09A 4IWNA 3R9XB 3P97A 3TLJA 2AOUA 4E2XA 5CM2Z 4ER0A 3FYCA 1Y8CA 4BY9E 3MERA 5EHGA 1KPGA 3HM2A 4P7KA 1I9GA 5DX0A 3EVEA 5LQUA 2ZSUA 3SSNA 3PFHA 3IHTA 4XUEA 2PBFA 3GNLA 1I4WA 2NXCA 3NJRA 5CCXA 2ZZMA 1VLMA 1WZNA 4GC5A 3UJAA 3NWBA 1EIZA 2QYOA 2EFJA 5DM1A 3LDUA 4F84A 3LDGA 3M6XA 3QOWA 2PX5A 4LWOA 3FTDA 3LDFA 2Q41A 2B78A 3DOUA 3PS9A 3JWHA 4QQKA 4WVLA 3TPZA 3FUWA 1WY7A 3I53A 1VE3A 1YZ3A 4DCMA 3PTAA 3LECA 3TR6A 1G8SA 3A7DA 3HVIA 5LQRA 1M0EA 3LSTA 2ZULA 2PXCA 3SXJA 4EQZA 2BM8A 3BWMA 5M5BA 2OB1A 3CC8A 5DRTA 2K4MA 3G88A 3DXXA 4RSRA 5EOVA 5DWQA 2C7PA 3G2QA 3AXTA 2AVNA 1XJ5A 3UZUA 5LSAA 4P7FA 5HFJA 5ICFA 2OZVA 4L7VA 5DRYA 3EGVA 4E2YA 4OQEA 5CCBA 3EVAA 3KHKA 2NP6A 2PX8A 4KIFA 1TW3A 3E7PA 1MHTA 3BUSA 4P7JA 1IXKA 3KQTA 3ELDA 2R3SA 3GXOA 3HCDA 1JR4A 4ER6A 3KQQA 3M6WA 5DTQA 5FUBA 3HVHA 3A7EA 3LKZA 5E1DA 1O54A 5HIJA 3G2MA 1MJFA 4RTQA 4H0NA 3B3GA 1EQAA 5DM4A 5LR6A 4RWZA 3G2OA 5F2KA 4OA8A 10MHA 4FZVA 2QY6A 1UIRA 4YV2A 4F85A 5K0JA 2PJDA 4R6WA 3RW9A 3KQYA 5KVAA 4GOND 2XVMA 3IYLW 3DTNA 3P71T 3EGIA 2PVCA 5DT2A 3BT7A 2CKDA 2V7EA 1ZQ9A 1H1DA 5LQNA 1KPHA 3X0DA 3GJYA 5MHTA 3UJCA 4AZWA 3FUXA 1D2HA 4YUVA 3TQSA 4CKEA 3P9KA 4P7GA 1NW7A 3BWBA 3BXOA 3DUWA 4QTUB 1AQIA 3OE5A 3LGAA 3OU6A 5FA5A 4HSGA 4PYLA 5BXYA 3KR1A 5EC8A 3EGEA 4HGYA 5K03A 3EVFA 2XYQA 2IFTA 2KW5A 3EVDA 3GRZA 4OBWA 5LQJA 1KYWA 2I6GA 3B3FA 3PVCA 4X61A 5K0CA 3OU7A 4C06A 3PX3A 5F2OA 2H11A 1BKYA 2AR0A 3FUVA 1ORHA 3LCUA 2Y1WA 4HC4A 2VS1A 4E33A 1BOOA 2GB4A 4DQ0A 3OZRA 4GBED 3HCCA 3C6KA 3DXZA 4PWYA 3TOSA 1YUBA 4BLUA 3LKDA 2ZBRA 3KKZA 3SVZA 4GUAA 3TFWA 4ER3A 5EMLA 2G1PA 1IM8A 2QRVB 5DTMA 4C07A 2GPYA 3A25A 1INLA 3NW9A 3S68A 4AZSA 3CVOA 2IDJA 4HGZA 1KR5A 3DP7A 1EJ0A 2F8LA 3R24A 5EMKA 5BP7A 4PYIA 4P58A 2PV0A 4HH4A 2UYCA 4FSDA 5EG5A 1XTPA 2IH2A 2ZZNA 3BZBA 4R05A 3OFJA 1M6YA 2DULA 2YUIA 3BWYA 3DH0A 3FTCA 5HOQA 2B25A 3VC2A 5KYGA 3P9CA 2OB2A 2NXNA 3EMDA 3PB3A 1EG2A 3LL7A 4FT4A 4KDRA 4YMHA 9MHTA 3KPVA 4EKGA 2C7QA 1P1CA 2IH4A 3R3HA 1QAQA 1L3BA 3LCVB 3MTEA 4MHTA 3HCFA 1JG1A 5E9QA 5FTWA 5HZMA 4FT2A 4X1OA 3CGGA 3GDHA 1ZGJA 1VIDA 4FSXA 4ZTBA 1SQGA 2C7OA 2O07A 2ZIGA 4OQDA 4Y30A 2EJTA 2IBSA 5T6BA 2ZIEA 3G7UA 4PNEA 2JH8A 1N7IA 1U2ZA 2AZTA 3CJQA 5GIPE 5EMMA 4YMGA 4QQNA 2WA1A 4C03A 1JG2A 3EEYA 4RTRA 4PYOA 4M36A 4K6MA 3KPUA 3OZTA 1XVAA 2AOXA 4HTFA 4V0RA 5DPMA 4QDKA 5HIMA 1QAMA 4XUCA 5B1SA 2CMGA 1ZG3A 1SUIA 2R6ZA 3EVCA 3G89A 5HIIA 3ID6C 3CKKA 2UYQA 1X1AA 5DX8A 5E1OA 3EPPA 1KYZA 3DLCA 4PYMA 3KQWA 1NKVA 5CVDA 3WSTA 3PLAE 3NWEA 4OA5A 2AOVA 3HP7A 4LECA 5CUQA 5CVJA 3ELUA 3KU1A 2Z6AA 2ZCJA 2NNWB 3PX2A 2OPBA 2PWPA 4PYNA 3KR0A 2FYTA 3KPYA 1B42A 5C1IA 5D1HA 4AZVA 1KHHA 3KQMA 4A6DA 1RI3A 1EAMA 4RTSA 2CMHA 1F38A 1OR8A 3G8BA 1UFKA 1QANA 4M37A 2IGTA 1PJZA 1VP9A 1RI1A 1VQ1A 1FJXA 3UWPA 3ANXA 3VC1A 1NT2A 2IPXA 3O7WA 2FRXA 5HEKA 3SSMA 3U81A 1BC5A 4C4AA 3BKWA 1Q0TA 2PT6A 3DXYA 3OU2A 3P2EA 4YV0A 1ZKDA 5LQAA 2BM9A 3I64A 4KW7A 4PIPA 3GU3A 5EMJA 4CWAA 2P40A 4YUWA 1XCLA 4QPPA 2A14A 5CD1A 4PCLA 3ER9A 2UYHA 5DSXA 2PLWA 3MAGA 4EMSA 2ZTHA 2IH5A 3UJ9A 2CWWA 3VYWA 2BR4A 3D2LA 3M4XA 3P9IA 4ER5A 4BP3A 4CTJA 2ZZKA 4HRAA 2O06A 1G8AA 3HA3A 5HILA 3GRVA 1JTEA 1RJDA 5DSTA 4CKCA 4U7PB 3LHDA 3M6UA 5JR3A 3I5UA 5IH3A 1NBHA 2ZLBA 4NECA 4PYQA 1G60A 5D1NA 2OYRA 1YF3A 3K6RA 3CJTA 5EQJB 3FTFA 3B89A 2EX4A 2HMYB 5DM0A 4BLVA 3FYDA 3A26A 2PXXA
chains in the Genus database with same CATH superfamily
4DPUA 1RAGB 3AUTA 3EHDA 4TYQA 3KYDA 3JYOA 3ZNPA 1CS0B 4GP9A 2XLBA 3KELA 2XBLA 1E2BA 1PJQA 2DFVA 2UVQA 5IM4F 5LZ2A 4DV7J 2WHQA 3T99A 3MWJA 2XT9A 3BZWA 3ZK7A 1XTKA 3A6DA 4FMPA 2ZPTX 2C5AA 7AT1A 1GZ5A 2H9AA 2YRFA 2PMKA 3QYJA 1SBQA 4A8JA 1BMQB 2XT0A 5GM1A 1WSAA 3QITA 4DCUA 3BMCA 3NCRA 1B14A 4EA6A 3V8BA 1EINA 4ZK7M 3EFOB 1M5TA 1NW4A 5I9IA 5JUMA 1W6RA 3VVUA 3FY4A 1FW6A 4BYMA 5HJXA 3RTVA 5I9BA 2R2UA 3W2EA 1Q77A 3EVZA 3K5IA 4HFRA 4ALIA 3ITHB 3AB8A 2C3PA 5DS7A 2F59A 5LP6F 5C7IO 4U5YD 3TRIA 2QVBA 1E4YA 2J7PA 5D3QA 2Z95A 4KBGA 2AOUB 1JLBB 1J2RA 2ZITA 4X8LA 1N0VC 3OWXA 2QM8A 1JDPA 1JLEB 1T3LA 3K0KA 2WJWA 1TL7A 4B9SA 4TM7A 4YV1A 2XNSA 4RF2A 1QO0D 1RT7B 1RWXB 4I8DA 5CJ2A 1PTJC 3JD3A 1OWOA 2UXCB 3FPCA 3I32A 2CJAA 3C5VA 4IWXA 4I08A 1OB2A 3U13A 3DHWC 4TQGA 2HMSA 2GIFA 4PSDA 5KOJB 4NQRA 1OPZA 3IQFA 2ABWA 1ADJA 1GU7A 4XVQA 5KYWB 1N6LA 4YRMA 3OQBA 4RY2A 2OPSB 1MABA 3PGMA 3KLEB 4CIXA 3QIDA 3HUDA 2QP3A 4B17A 4F8YA 2D5AA 2PU5A 2FSUA 1Q0UA 4GSLA 1FXRA 2VDIA 3AL0C 3EH2A 2REQB 4EMDA 4GWKA 4K4SA 3CXRA 4ZVEA 3RHZA 1TKZA 3K5LA 1K9MT 2JFHA 2JF0A 1HDIA 1UDXA 2XVZA 5K3DA 4BCDA 4RZUA 1KBQA 2GHVC 4XPIB 3TAPA 4HQOA 4H7HA 1E0SA 3BN4A 1M2WA 4C4WA 5I5EA 3M3DA 3W5UA 2AYEA 4K9SA 2BH1X 4RHCA 5P8WA 2D00A 2ON6A 4AU1A 5I7SA 4RH3A 4MKRA 2EW9A 5JSFA 4QUDA 5BNIA 4IXNA 2YZKA 4P7KA 5HCNA 3EUNA 8ATCA 4CCSA 4QLOA 2DITA 3DCAA 4YCSA 1Z6TA 1QQ7A 1S7GA 2AC7A 3L7NA 3I6QA 5I47A 2Z58B 4X3PA 1R5BA 4IINA 3F6SA 3W90A 2XXAA 1LSSA 1XJ5A 1L8LA 2G6BA 3L46A 3SF8B 3PHJA 5C8YB 1UBUS 1HZZA 1HW9A 3R74A 4KO8A 1SXJE 2BGRA 5DM4A 1HI9A 4P7TA 1P2VA 1H1TA 2YASA 2FETA 4TS9A 1KJJA 4DR2B 4W63A 2H5JB 2HA6A 4JUBA 4MP3A 1U8XX 3FCOA 1KFSA 3H2ZA 4N5LA 3Q15C 3VBEA 3WKBA 2H4WB 2KPOA 3FNEA 2MKIA 3TGWA 1IN1A 4FYDA 3PDUA 3PX3A 1U24A 1U0BB 4ALKA 2CF6A 4D9GA 4BLTA 5C7LO 5ILQA 3KV3O 4P2XA 1N5VA 1E2KA 4WXOA 1XAHA 1X94A 4PG7A 4I2QB 3DP7A 4XVUA 4FBTA 1RWOA 1K3FA 2AQ8A 4L28A 1ZJJA 3PEFA 2QAGB 1KP2A 4EYQA 4A0QA 1JAIA 4B3BA 3GFFA 3HPRA 3R7WA 3CY6A 2JNWA 3KXPA 4QHYA 3GJSB 3RFVA 4KSYA 2Q9BA 3F0NA 2HWYA 4Y30A 1U6FA 1WDKA 3EFHA 4TLDA 1ZJ4A 4PNEA 4MW5A 1GZDA 3FSGD 2B1GA 3LXUX 1EETB 3ZNQA 4UFOA 1SQ5A 3HEAA 3GARA 1LWCB 3UO0A 4C4PA 2PWPA 3JQ7B 1OWMA 1O03A 3DMDA 4B6RA 4TLBA 4XX0A 3CEPB 3RV4A 4I6YA 3T1VA 2J0XA 1SQ6A 3JD1A 4DR5B 1TUEA 3AR7A 1E58A 3AD7C 5DSXA 2ZJZA 4EMSA 5B6PA 1PJ5A 3ZWNA 1UPUA 3O8CA 1SXJA 4PYQA 1F5CA 3GN1A 2O54A 3HZZA 4Y1RB 2IS2A 3WL6A 2HJGA 1YBMA 1N2CE 3VU1A 3DLHA 3PW4A 1FF9A 4BGEA 3OQNA 1UK6A 3UH1A 1DTWA 1NKEA 3R44A 4K9RA 1L4BA 1GLNA 4C2BA 4GE0A 4M0FA 4EX6A 1AROP 1Y8QB 1GZ6A 2AG0A 5DETA 3EVTA 1MT0A 4DOMA 3GAAA 1X1RA 1K92A 3LT5A 5DCWA 4F5DA 3LDHA 1MNAA 3GLIE 3WI7A 5ALTA 5KKNB 3SXUB 1UP4A 1NJ8A 3CNNA 4KO0B 1A9PA 1XQ9A 2WMOB 3J7AC 4DR4C 1T9AA 3CZPA 4AZ3B 5IDXA 4OX9F 3O74A 2HWKA 3ZTTA 4MAKA 3CQ3A 1AQNA 1IUKA 1R00A 1SHZA 5FO1A 4YJ3F 2OO4A 3WYAA 2EXXA 3EY9A 2OBLA 2JZ5A 4I2VA 5EERA 3M4YA 4C0OC 2FRDC 3DLTA 4G4GA 1NPTO 2WF6A 4YB8A 5AUOB 4C2MA 3TJMA 1MNQA 1VQYA 3K8YA 4DRXB 3M2RB 2X51A 2HQIA 4UOGA 2BGGA 3LP5A 4PPDA 1S7CA 5F77A 1BTOA 2JJQA 1TU0B 2DHHA 2FLNA 2A4KA 3QLJA 2ZR9A 4D0SA 2WK1A 4OB7A 2V8GA 2GAHC 3JRXA 4XPEA 5F76A 5LMNJ 1V5GA 1CRZA 1Z0KA 3WGVA 2HLDD 2QJTA 1FTRA 2NZWA 4DUYC 5EWJB 2PGCA 2JI7A 2XTMA 5BQOA 4D46A 1E7WA 2EX1A 2HWUA 1N2CA 3FYSA 4X7BA 5CT9A 4DRYA 4K8RB 2ZB8A 2M6LA 5A4AA 4G0OA 2QUZA 4MVJH 2BGTA 3EXG2 3IPLA 1R16A 2TSYB 1JJAA 1GHTA 2R44A 3ZDFA 3CISA 1T2FA 3VX4A 2BJ3A 3NV9A 1X19A 2AFHB 3V1YA 5GY7A 2XSZD 3GLIA 2XO6A 3GWCA 4EYEA 1Z83A 4RV4A 3DL2A 3GUVA 4YAGA 1P1BA 2GJSA 3WMRA 1WMDA 4R8SA 2RFLA 1AZLA 2O2JA 4Y0AA 4LF4F 3PFFA 1UBSB 4TRJA 5AKHA 1GAEO 4JEUA 3N6MA 5LQCA 1U0HB 2XODA 4J43A 1YBVA 4ARAA 3H5NA 2A1BA 2YJNA 4AIRA 2QZJA 5DOVA 2VZ9A 3UJNA 2MQLA 4MUBA 4B33A 2W8LA 5ETQA 4A8TA 4X4UA 1BU5A 4BKOA 4CG0A 3ETCA 4NLOA 1ATZA 3KYIB 2V8BA 2W4CA 4LJYA 2Y1CA 3QNUA 3ZCVA 3WIDA 4QEZA 4LFCJ 2XQCA 3QOXA 3J80U 2AC4A 3U0VA 1DOHA 1ORDA 2IY7A 3RARA 4GU5A 5TPWB 3IKMB 3OQJA 4FBMA 3PFHA 1BSVA 1PUIA 4XOIA 5IDWA 1SAYA 3TCKA 2VHXA 4N77A 3WB2A 1CQPA 1W6UA 1V6HA 5TR9A 3OA0A 4YJGB 1BXZA 5FLXU 4LBVA 4LJ7A 4WKBA 4CFSA 5J4LA 4OJNA 1MHTA 4R1MA 3H16A 1YBAA 2P91A 2CB9A 3FNHA 5JNTA 2D69A 2X9VA 3PYEA 3ETOA 1COWD 2J4CA 3DYAA 4MZDA 2CLEB 3BQNB 3SMVA 3W2HA 3BBFA 2QN3A 1XHEA 2IRXA 4X62C 1YDWA 1F1BB 3CH5A 4RW6B 3KDNA 5TGDA 5K51A 3UJCA 3NATA 4PPNA 2G17A 4K4VA 3MT7A 3BWBA 3SJCA 3R3UA 4MI6A 2UKDA 2UU9J 2F55A 5K03A 4BC0A 3PNVA 2V03A 4OBWA 3ZCPA 3AVTA 4OSOA 3RSHA 3BGOP 5B4UA 2UUCJ 4RQAA 4LJRA 1X7XA 1HXHA 2DCMA 4JKYA 4D43A 1WEYA 1EXMA 3NOQA 2VATA 3VOSA 1HWUA 4R0VA 1A9SA 2K2PA 5D3GB 4HAOA 5DQGA 1CDOA 5TLSA 2AFIE 3QENA 1N33F 2X2EA 3DKRA 1K27A 1EVKA 4R69A 4ZCQA 1JG1A 3OPYB 2AHOB 2EKYA 1UFQA 3UK6A 3M81A 1VQ9S 4EJMA 3VO2A 2IZ0A 2WD9A 4B9MA 5DM6Q 3EXAA 4UM9B 1Q3TA 1D6NA 4IGFA 4O4IB 2WSIA 3QVGB 3NRBA 5C1OA 2QW1A 2VKQA 3HP7A 3C1UA 4XTTA 4XIFA 3I2IA 1B42A 2IKSA 1N6QA 4IVNA 3H99A 5BRAA 4ENSA 4GVLA 4TTJA 4K4ZA 1W4AA 2MZTA 3CRVA 1B8UA 2NACA 4OAQA 1DUIA 1NBEA 2EQ5A 5CB4F 2ZIZA 3K6SA 4BE4A 1J2YA 1CQIA 3ZI4A 3RVBA 4ER5A 4E0BA 3NBPB 1ZMOA 1VDMA 2DXEA 1YF3A 3ZWQA 4DJDC 2WF7A 4QZVA 4HDNB 4XM1A 3KYBA 4ZT3A 3SXLA 5AM2A 5B7NA 4PZDA 1Z9BA 5KNCD 4AW9A 2BMAA 2JD0A 1FFXA 1K3UB 1P5FA 4FR2A 4X4QA 5A03A 1ZITA 3FR8A 4IKOA 2X8LA 4P0QB 2JCSA 1YCHA 5ETRA 4XVHA 2CU6A 4K6FA 4LOHA 2WF5A 4Q12A 1YCGA 2VG5B 2W8BA 1FFEA 4NE9A 1NW8A 1N0HA 1P62B 4LGMA 3D6NB 1RSZA 3HVUA 3BKUA 1N2ZA 4P82A 3BXFA 3SIPB 4RTKA 4XIYA 3I5XA 2AFIA 3BEOA 2DQYA 1ZN2A 1O9GA 4XGKA 3MWEB 4S1TA 5AP9A 3UFCX 2NZ2A 4K2JA 4ERDA 3FLMA 3O9VA 3ISZA 1XNHA 1ZUNA 1JAZA 4ZVPA 1UPAA 4IIEA 2CUTA 3BJIC 3W2WA 4FPIA 2I7XA 5MN4A 6ABPA 2YINC 2JAPA 1OJ7A 1RFGE 4DKJA 4EB0A 3FA2A 2O57A 3EN0A 3NANA 2RHOA 2Z4TA 2MYUA 3DMHA 1VHFA 3RM3A 3CF4A 3KTAB 4LVOA 1ZR4A 4DUTA 3GC6A 3NP9A 2IEZA 4WD3A 4DCSA 1IYZA 4IOMA 4I5EA 5F1PA 4XFDA 4WHMA 4R81A 3W6NA 2NV0A 1P81A 1HR0J 3O7MA 3RS3A 3RCBA 1NPDA 4MK8A 5J23A 1QS0B 1PR1A 5TV2A 4DMGA 4IM7A 4MW0A 5FT9A 3FMIA 5JDIA 4DV4F 4RK1A 2J8SA 2MYTA 3ANLA 4QA9A 1CHNA 2QTGA 4FZ3A 2AJQA 1PZMA 1MC5A 1BE1A 1PYDA 1OAAA 3HVAA 4AKHA 2P9FA 3OI7A 2YV5A 1ISHA 4RNDB 4O0MA 3MM7B 3CT6A 1T29A 3V1MA 1IWPB 5DBHX 2GASA 1OXXK 2JI9A 3DGEC 4JI8J 4NV0A 1UFVA 1ZXXA 3L7PA 4MINA 4MH8A 4M86A 3QU9A 3STXA 4LE0A 1TAQA 4X7PA 5EXEA 3OCWA 3R23A 4H1VA 3TQ1A 3QV2A 1H85A 1HYBA 5LA6A 5I48A 4V0LA 4JI4B 3H2JA 4CV2A 2ZNYA 3NHYA 1PV1A 1QRRA 1S02A 3DRRA 3W6OA 3B3JA 2F7SA 2QP9X 3QEJA 3IAUA 1WUYA 4YREA 5ARDA 3NDIA 2HJVA 4HL9A 1NIPA 5EKTA 2ZBPA 4U7CA 1MXHA 4HGOA 1Y9ZA 5E7QA 1KBRA 3I58A 4YJHB 2OOKA 4ZCMA 4KLRA 4EY6A 3ESAA 3TNYA 4PQGA 1D3WA 2ZT8A 2IBKA 3EHEA 4REQA 2PSFA 3CUKA 1I4WA 4LXGA 3GZNA 2GEUA 3QLVC 1TQHA 2AF4C 1JLHA 3L0YA 4RJTA 4QM6A 1SWVA 4LY9A 2Q2NA 3NUZA 4MO2A 1ZCZA 1KOGA 1V60A 4JBYA 1YRQA 1U63A 2VJCA 3HV2A 1YTUA 3KQQA 3RB3A 2O8DA 1U1QA 4LJ9A 3KJIA 1QQ5A 3E81A 5EIXA 3A14A 3F7NA 4DMUB 2GR9A 10MHA 5TS3A 3NL0A 2VQFJ 5KVAA 2NO1A 5HQMA 4H4KC 3H2UB 1K7EB 1E3LA 3TUFA 1RJWA 4YLGA 4R1QA 2NPOA 1E1KA 4HLNA 1OY9A 2XXBA 1DE0A 3MINA 1CCWA 4GBMA 4A48A 1G6OA 3EWNA 1UMJA 2VIIA 2MDAA 1U6IA 2KBFA 3X1MA 3OJUA 2MKSA 1EQ2A 1IKVA 3FWZA 2G9VA 1K75A 5FBRB 1TL4A 2VP2A 3O21A 2A1UA 4V19X 1T3GA 2BTOA 2OAP1 1GG2A 3H5TA 3QFCA 4LHSA 2D1CA 1POXA 4MYRA 1EIWA 2HYIB 1Q1AA 1FWPA 7ADHA 2DBQA 3C7DB 1PHPA 3L84A 4RXMA 2ZJ6A 1NJWA 1M2FA 5GZ6A 3IIIA 1P75A 4OB6A 4JLDA 2ONFA 3GIIA 4INJA 2C20A 2NSHA 1I2AA 3CF2A 2R7LA 5BSRA 4DFPA 1KHHA 3DAYA 5AW0A 3V1KA 3BDIA 1OSDA 2PT6A 1EX9A 4DI6A 1IKXB 3QEMB 13PKA 3N2ZB 9MHTA 1N8NA 5F12A 4BBYA 1KLMB 5IDVA 2WE8A 4YXWD 1WC0A 4WU2A 5A8WB 1M75A 2ANBA 3ILOA 5FKJA 4LXYA 4W5NA 5DDOC 5D1NA 2O8FB 4E4YA 1LX6A 1M9NA 2QD5A 1W5TA 1I2CA 3Q7EA 3SBOA 3GGCA 1Y4AE 4CCWA 3IIMA 1T2UA 2JI6A 4LOLA 3AVQA 4K03A 2VHTA 4HJXA 1V5EA 2KHZA 2ZIXA 2YHUA 1UKAA 1R0RE 2ZJOA 3MCTA 3FWYA 1RMQA 3SM9A 3FYUA 1H2VZ 3EX7B 4NXNF 3MB8A 1FEHA 2WG0A 1AIPA 1OU0A 1ADGA 3LANA 3OIFA 3FRHA 4TMYA 5SY6A 4R3WA 4I3FA 1R0AB 1GZHB 2FX5A 2J6TA 4ZV7A 4NABA 4E0DA 4JI6B 1KVKA 1VPVA 1YZKA 1E3WB 3E2PA 2GEVA 3FI0A 3TI9A 3IQWA 4ASUA 3PHHA 1A4UA 1F2DA 1LLCA 2PT9A 4HACA 4B6PA 1DBVO 1XJWA 4QNMA 4QUIA 2EG2A 2FCAA 4QIFA 4I4TB 3LP2B 5LMUF 1ZJ6A 1OI3A 1OJ4A 2C3UA 4YMSA 3QMWA 1PVDA 3UHPA 1D9XA 4PZEA 3QBDA 1HDEA 1G1AA 2NVBA 4CF4A 5KT5A 3H8SA 1ZB8A 3A06A 1S2NA 1KNXA 3H5RA 1CFJA 4H4CA 3PESA 3TLYA 4M2LA 4AY4A 3TRDA 1M1YE 2P2GA 3QBTA 4PTYA 3BFVA 3MM9A 4HQ6A 3ZU4A 2W2OP 3DLBA 1FFGA 1A4RA 2AF3C 3B60A 1DWPA 2VDPB 5JMOA 2VK8A 4JH0A 3IIEA 4ND3A 2VXCA 1XMOF 2W6ID 4CTAA 4LF9C 4DUZB 3VR2D 3A1TA 4GPAA 2V58A 4ED0A 5BN5B 3V7WA 2AN4A 4WP9A 2Q1UA 2EZ9A 1JLRA 1DKOA 3RTCA 3FIJA 3Q9SA 1DEOA 1CJVC 2HHJA 4YV7A 3T3FA 1KZ4A 2YFQA 4TLEA 2F1JA 4EW2A 4WKRA 2WKRA 3I92A 1WEHA 2G1JA 4PXAA 2N7YA 2VYFA 1NMXA 2J3DA 4CKWA 2ZBCA 4DYVA 4PAAA 2AGVA 4C5AA 2NVWA 2LQBA 2HNYA 2Z1MA 2PKWA 3DD5A 3ZGLA 3AVUA 1H2EA 2ZAGA 4L8YA 1WELA 3NB0A 1UXOA 3H0KA 2FF7A 1Z0JA 1NF3A 4DR6B 2NUPA 1TTTA 2X4DA 1G20B 3Q12A 4E08A 4KRWA 2CLLB 3P4YA 3SC3A 1J1ZA 2XRZA 1I0LA 4B3HA 2GYWA 2QTWA 5JCJA 1U0RA 4CKCB 2X3FA 5ICFA 4OXIA 4JR0A 1A5BB 1J5PA 2P5UA 3KQTA 1WG4A 1H72C 4K50A 1G21B 5JS1A 2FSGA 5BW6B 3TZQA 4FDLA 4WOCA 4ZU6X 5ALXA 1VMAA 2ADBA 3C46A 1X80B 2QV7A 2HWXA 1H2HA 4MH0R 4IO1A 4IS3A 1RZVA 4QQRA 1PR2A 1KPHA 3GJYA 3LALA 2VJQA 1J8YF 2D41A 5HKLA 2QL6A 4LW8A 1PNVA 1P2GA 5G4LA 3TJAA 4LHVA 2ZTLA 4MUYA 2AR0A 5AW1A 1G8HA 2GB4A 5I45A 3JQRA 4B83A 4OPMA 1U7UA 2HHSA 1SHKA 3EZXA 5BSMA 1VIXA 4RULA 3L9WA 4BE9A 5HJYA 3IDFA 1Q0RA 2MHEA 2H54B 1K6EA 4NWBA 4I99A 4YMHA 3OLBA 2YOGA 2D0IA 2ZYWX 1RWWB 1J5EC 5IJWA 2GN1A 2ZIGA 2BC9A 1C3EA 4WFAQ 4EGLA 3O3MB 4QQNA 1OV6A 1YACA 4NYMR 3UDCA 4HR7A 4IUYA 4NI2A 2Y0EA 3ELUA 2GEDA 1D8TA 1A8IA 1DAFA 4P4LA 3SHWA 2A9KA 1VQ6S 1KFJB 2DWPA 4N7BA 1E4OA 3G59A 3SSMA 1Q0TA 3FJOA 5H4HA 3GCDA 3O03A 1TMMA 3NEKA 4LXXA 1E94E 1AUOA 3ECAA 4I50F 3VYWA 4GPTA 2BR4A 4EVSA 1C7ZA 1U4BA 1Z5UA 2IEAA 5CVCA 3C8DA 2NAFA 3JZMA 1I10A 2WMYA 4A0GA 1Y1LA 3N74A 4LRWA 3FTFA 1ODJA 1HQUB 2JGMA 4RCVA 3MLEA 4KSBA 4BB9A 1PNQA 2D5IA 4WNIA 3V6HA 2ZHBA 1ZGGA 2CQ3A 4UARA 1J23A 1VL1A 4IIDA 1VIYA 1IXYA 2G8LA 4Q4JA 4MWGA 5KJ1A 7ABPA 2AX3A 4D5EA 4YDDB 3ESZA 4MLCA 2HMWA 5EJMA 1IJFA 5EHHA 4IFYB 2OD4A 1DWUA 2BFBA 2WZCA 1TVEA 3FSIA 3P9RA 2JCXA 2D0PB 4UUAA 2VEDA 2X8JA 1II0A 3BEDA 3JQ9A 3PC6A 4LQ4A 2H4XA 3UJDA 2P9CA 1ZETA 4RLQA 1JVBA 2IPMA 5EZQA 3G71S 4OBEA 1H2XA 1IVYA 1XF1A 1I4EB 2ZUEA 2NVOA 2WAYA 2QNIA 1A77A 5LBUA 4UE6A 2DH6A 2B6HA 2IOYA 1ZN8A 4AMGA 4NCAA 1Y5NB 4EBBA 4DL4A 4B3RC 4ED9A 1ST2A 1VSBA 5E33A 1QHGA 3E3MA 1KJQA 3JD2A 5G02A 2CHGA 5CHCB 1RHRB 4FJ1A 4LSZB 3NXSA 4IOJA 3HS3A 1WNEA 4I4LA 2WEKA 1TJ4A 2F1IA 4J5OA 3N6NA 4Y2VA 2VF5X 4RVFA 2XNCA 2UV8A 4DJAA 3UICA 2R6R1 2CDRA 2ASBA 3QFRA 3OCVA 3G8AA 1V6AA 5JSKA 1FB5A 1U9JA 4MVJG 5DW0A 1T25A 1SIOA 1WBBA 3WOHA 5E2AA 5JNRA 5COBA 1P27B 3KVVA 1MA0A 2QFJA 5IC6A 4X66J 2DAPA 2GZAA 3PGLA 2G0IA 3R0ZA 5BN4A 1MW8X 1T24A 2W83A 5AKYA 3F8SA 4N03A 2XCOA 4ZOEA 1T2CA 5IM4A 1M2OA 1GGHA 3DBVO 3MPDA 1FX4A 2PDAA 2I2BA 4KB7A 2W58A 1UXKA 1V37A 3FRJA 3T3EA 4DXLA 4G5QA 2NOAA 4R9SA 4CT4B 5EHXA 2PSJA 4RIIA 2ZTSA 1NVVQ 1ADCA 1RI5A 5T4HA 2W11A 3H1EA 1VB5A 1XRMA 3FFAA 1U8YA 1PJ6A 2RI6A 4DV1F 2JBHA 4ABYA 3E0XA 2R7AA 2G1UA 5DWVA 5CYJA 2FC8A 1SL1A 3PXDA 2PVSA 2J85A 2EFJA 2MT9A 2LTAA 3CLTC 2I54A 1ZJYA 3RS8A 1L7XA 4DUPA 4O4LA 1N6KA 4X90A 5JXJA 3CVVA 3MM4A 4J6FA 4WCFB 1R9JA 3STYA 5ADZA 2HMIB 1KI9A 4LQ9A 2M0GB 4ZK6A 3LUCA 1EXNA 1I5RA 1J00A 5DTQA 4EL0A 3A3OB 4WOBA 5DRKA 4W1SA 2NV6A 4P35A 2EK6A 4QSMA 4RLHA 5JLAA 4QOTA 4BNIA 3DZFA 4JUAA 5JZOA 1UJ5A 1Y4SA 3K9FC 5LA6F 4IXTA 3UN5A 4EECA 3MR5A 1U6KA 1DKMA 4E33A 2SCUA 1GNPA 2Z4RA 4D26A 2IFXA 4PHHA 2CZVC 3RFFA 2C7VA 2OR3A 2BW7A 3JSRA 1X0PA 2FWPA 4PYIA 1M2VA 1PEYA 2QQEA 2YUIA 3KJFA 3JATB 1N2GA 1YH3A 4V19J 7REQA 5F8HA 2HK8A 4ALNA 2KYXA 1SQGA 5A1GA 4BIMA 3C7TA 2IUUA 3CPWR 3DRSB 1WC4A 5K3AA 1GXUA 4L0CA 5DE3A 3CMMA 2HNDB 3EZ9A 3P0HA 2Z6AA 2VONA 3B9PA 2VHVA 1KH2A 5BMVB 3B1ZA 1U8CB 2RGGA 3W60A 4BO8A 3ZNNA 3VM6A 3LGHA 1PQWA 4UCWA 2WU1A 4C8NA 4OOEA 1P17A 2FEMA 1TV6A 1P4SA 3LZDA 5CDTA 4GYWA 2D74B 2HGSA 3N2KB 4IQ0A 4DWOA 3T3MB 2OC9A 3FDZA 1EB9A 2R0QC 4XYMA 5LL6P 4RK4A 3FMBA 4IO0A 4KY3A 3W8DA 3ZS9A 3ZWAA 3W8RA 3VKHA 2GXAA 4DTIA 3LF0A 1TMJA 1H0RA 4JKIA 1B8VA 2M5HA 5AKZA 2VCEA 4XDHA 3U5TA 1JKFA 2J9FA 3BO4A 1X9IA 3B12A 3NIWA 3TVYA 1T43A 2YY3A 4BMSA 2UYYA 2FD2A 3AL2A 2RAVA 4I1TA 3FUCA 1ZGHA 1Q12A 3UJHA 1DJPA 3ZY4A 4R8UA 1WAMA 1XL1A 3IE1A 4YQFA 1ZK4A 1HT0A 4K1XA 3X44A 1HNXB 4IYRA 5AVYA 3O8RA 3DLPX 2IE0A 2BMJA 2GMJA 4OMUA 5ETLA 2FPOA 1NQTA 1YE3A 2FSIA 2C0PA 1WKLA 2BGKA 4PU0A 1OS5A 3B6KA 5CFRA 4ND8A 1F48A 3B7PA 4C6RA 2GSDA 1VGVA 1YQTA 2RBKA 4LKOA 2E8FA 2CB0A 3ZGXA 4R2KA 3VAJA 3DC7A 1UKZA 2C42A 5JSZA 3AFGA 1A76A 3HSGA 2CVFA 2EKBA 4E11A 3BMQA 3SD7A 1QYVA 2GARA 2P2YA 3T0IA 8LDHA 1E6MA 4DLBA 2N1BA 4S12A 4LFCF 4LVNA 1R10A 3RSOA 2HDHA 3ZZRA 1UKYA 4F4WA 1SK8A 3R5AA 4GIBA 2YQ4A 1W46A 2QMEA 1SQEA 3OTHA 1USWA 1ZAWA 4DV4J 3FPKA 5BVGB 3O1LA 5BN3A 3GP8A 1PIWA 1HDCA 4FBUA 3DV0A 1ZM2A 5F7ZA 4UHKA 4DA4A 1XMXA 3GFZA 2DQSA 3KU4A 1A0OB 3ZCSA 2AOTA 1W36C 4A26A 2G83A 1TL3A 4N5MA 1UZAA 2VJOA 1O0CA 3A8KA 3ZQJA 3WRXA 1JN0A 1PN3A 4DV2F 3J81Y 5FR1A 5K0FA 3NGSA 3N3BC 3D7MA 1OKKD 1NYLA 5K0NA 3MK31 2ZI3A 3IEIA 2UU9F 3TFOA 3LBFA 2XCUA 3PC4A 4RV9A 4I1SA 2OGSA 4X64F 5JXHA 2UUCF 5TDHA 2BKXA 1VBFA 4WU3A 2OHDA 2YZNA 2Q62A 4KJIA 1R6YA 1IM2A 1YSJA 3NALA 1E9FA 1X13A 1ZA2A 2ATVA 1UXJA 2O2IA 4N76A 2I9PA 2BF4A 4E2FA 1OJLA 2VHYA 4FGZA 1NOJA 3K0CA 2HHQA 4NHOA 3ZWXA 2HQDA 5HATA 3AUKA 5FTMA 5B12A 5JZVA 3L6BA 4M9QA 2NUHA 3M8PA 1OD6A 1JDUA 4S1OA 1ESMA 2F1OA 4L5YA 4CLSA 3FC9A 1LVHA 1J4AA 3RAQA 4AWAA 3AGQA 3RK0A 3DEJA 2ZULA 2H8KA 3IWXA 3SSSA 4ZXPA 2O14A 3D7RA 3ZJUA 3HKWA 4P7JA 3KJXA 4PFQA 3GKUA 4G0YA 4AS3A 1GKYA 4OYHA 3K9WA 2FMUA 3BFKA 3G2OA 4ILKA 1TKTB 2B3TB 4UU1A 3EJ6A 3HO8A 5IZHA 1Z26A 3ZN2A 2Z57A 1TELA 2Y93A 2XC9A 1LB1B 3P9KA 2CCJA 4DV6B 4B3IA 4Q2MA 2XSJB 1JMTA 4I1UA 1SM4A 1VRVA 5IJ9B 2ZRGA 1USVA 4FGSA 2GK7A 4XEUA 2DRIA 1U9CA 3R24A 3GJRB 2F90A 1S6QA 2ZHAA 3O3CA 2H57A 4BMOB 2W2LD 3UCUP 1USIA 2AJ8A 2ZAYA 1SC6A 2QPAA 1QRAA 3HX9A 1GVHA 1YZLA 4KFUA 1O9BA 3BS4A 4FSXA 2BBOA 1VHDA 1T1SA 3ULHA 1YA8A 5FUYA 2QT0A 3V7NA 5AVQA 2RD5C 3RB6A 1BIFA 2VV5A 3EWIA 4L8LA 1PBAA 1SUIA 5G4KA 3STUA 5JNSA 1TM4E 4B3MJ 1H69A 1U0SA 4IUCS 3O94A 3W05A 1I13A 2GRUA 1G5FA 2A1TR 2XR1A 2IPXA 1Q50A 2ANCA 1WKVA 3D2BA 3C16A 5JPCA 1AT1A 3I64A 2P40A 1NOIA 3B5JA 5B2EA 1KAMA 2RH3A 2QLMA 3VU3A 1GADO 2FR0A 4J2HA 1HR0F 4DXHA 3CJTA 3MMCB 1B64A 3V7UA 4BVBA 5DNAA 1B73A 2HN9A 3R0VA 3K09C 5IVPA 3QKWA 2IVFB 3PYDA 1GPH1 3OJXA 4J49A 4JJKA 1MC4A 2VDWB 2CMDA 2BZ0A 4G1MB 1MXBA 4CO4A 2BKAA 3KZXA 3QP9A 2OUKA 4TMKA 2KLHA 1T4CA 2H0QA 4LKRA 4WN3A 4L51A 1TVRB 4FW8A 1OASA 2CUKA 3JQFA 3LP1B 4Z7JA 4OO3A 1L5HB 3SCKE 1JXOA 1XMJA 1XEXB 1ABFA 1STOA 4MT1A 2A0FA 1XDUA 5FTLA 5AVKA 3FWKA 3WYFA 3UG6A 4RUKA 1FLNA 3V4OA 2P67A 1RI7A 3MCOA 1JJVA 2JVIA 1MG5A 3WGIA 3K1AB 2QE7D 3NEAA 2DGDA 1R12A 3RSSA 2Q5LA 4ZN1A 3N6VA 4LX0A 2B43A 2J6BA 2HNBA 1PS0A 1BW9A 1WUUA 5AKGA 4LRYA 3A1SA 3ZBPA 4B2YA 2GZMA 3WFZA 4DV5B 1SBRA 3CE8A 2MM9A 5DLEA 5AVZA 5I7VA 2YXEA 2YOHA 2QDKA 2KZMA 2C8LA 3T1YC 5JMPA 3QBVA 3J81j 3CWZA 1V9CA 4B9TA 2HOQA 4KGMA 1L7VC 2OV8A 1FS6A 1O6FA 2PLAA 1R8XA 3HKCA 3TQHA 3OQ6A 1S3FA 2ZWVA 4Q21A 4EI8A 1UEXC 4AUMA 1H6DA 2XYGA 3A1FA 3G8TA 4D9JA 2JIZA 2RUSA 3UNXA 3QXXA 5JLJA 1E2LA 3PRVA 4N7RA 5EFOA 3GT7A 2I1LA 4ZN6A 1UVIA 2VQFF 1OX5A 4ATNA 3ZW8A 2LQ9A 2ACMA 1UTAA 1DX6A 2IRUA 3FGPA 4XJSA 1T34A 1Q7GA 3W2IA 5CEFA 2PX6A 3U7RA 2B1IA 1XU7A 4F02A 4QXPA 3QFSA 1GA6A 1TPYA 1CRQA 2X3GA 2GO9A 1LWFB 1OOEA 5BXIA 4YCMA 1SY7A 4NV3A 1TTHB 2XX3A 3TFQA 1D4AA 2YZMA 2W70A 5D84A 3N0WA 2VHGA 4NMLA 5J58A 5ERYA 3PHLA 1JBKA 2W01A 1H6AA 3ULKA 5AJWA 1XEWX 2XNKA 5FR2A 2W90A 4MSUA 1OWNA 3UV3A 2KXNB 3N7AA 2ZGVA 4BFUA 4BAZA 3FGZA 2IM0A 1OFTA 4XZ3A 1IRIA 5F9MA 3GILA 4ZLLA 3MGJA 2FW0A 5ALIA 1AHNA 3GOHA 5SYAA 4HYTA 3T5GA 3G0BA 4BDSA 3MDFA 4OV6B 2M4MA 2MTLA 3GNQA 4ZDIA 1T4MA 5LSAA 3VMMA 5IFIA 1D6JA 4MTPA 4BDTA 5LIRA 5K3OA 3TYXA 2P78A 1X8DA 5CQGA 1HPZB 2O8VA 4L0QA 1NYEA 4NCJA 1Y3IA 2XBUA 1B0TA 1Z2ZA 4MCJA 2JAUA 2WIAA 2F7VA 4YAEA 2IS6A 3T0FA 4O23A 1P9YA 1ODLA 5JZ9A 4TWBA 4R1PA 5C3MA 1SU6A 3K70D 3PTWA 1T5OA 4PVDA 5AKJA 1QQBA 3W34A 1RZ3A 5IVIA 1RT4A 5K85A 4BMDA 5TQ0B 1KI7A 2PMWA 3RUCA 1VPDA 1OX4B 1ISGA 1ZGZA 1KTVA 3PDJA 1EAYA 1NJGA 3AOCA 1ZW6A 5KFZA 1LW2B 3H1PA 2ZSKA 3V5NA 3DLJA 1U2GC 4NEZA 4ITSA 4HFNA 2J09A 1QHFA 1HL7A 4ETNA 3OTOC 3WWZA 2MKKA 3L7IA 2XLJA 1Y1QA 2Y8YA 3L1HA 3LUSA 4Y1GA 4O4LF 1YQGA 1PBNA 4FWIB 2EWWA 2UYQA 3SY8A 1O94A 3LTOA 1MX9A 2I66A 3G1UA 4H7FA 2JAHA 3TTTA 1MUUA 3R1IA 1BEUB 3TJ8A 3HL0A 2PKRA 1NK5A 4V3BA 1Y5IA 3URKA 4M95A 4CT0A 1ZRMA 3M0EA 2OD2A 5HRAA 1YRYE 3VHXA 1VQ7S 2O66A 2XMSA 2KVQE 3M4XA 1G59A 4FFMA 4ZVGA 3WB1A 4DYDA 4MR8B 3FVYA 2J4DA 2Q6IA 4BATA 3C87A 5C4MA 3DKDA 4D9EA 4URFA 1WEZA 4YR0A 4UNIA 1NJXA 1NMSA 3QT8A 1RTJB 4ZRMA 1SVOA 2A8YA 3FOEC 5DMXA 4FCWA 1TIKA 4G6ZA 3VTIA 1U3TA 2HUNA 1KERA 2I6FA 3GFPA 2WFLB 3JD0A 3SBDA 5JCOC 4G85A 1FX2A 4JXZA 2E5WA 1OQ3A 2WAXA 5I9NA 3LBYA 3RV2A 3U1NA 5ENDA 5ALDA 2Z8XA 3UUGA 1CRWG 3BHNA 5L40A 3WQHA 4N5HX 2BFFB 1FYFA 1K89A 2Q21A 2DD8S 4FOLA 1YJ5A 3GBPA 4BNWA 5ETPA 3TOQA 4FZ5A 3WTBA 1WS6A 3EGDA 1SKWA 3F3YA 1OY6A 1NASA 3KSAC 5E7IA 1WUJS 5AE3A 2AL7A 4V1CI 4XPCA 4COOA 4KFSA 3ACDA 3DVRX 2IIHA 2X0RA 3DEYX 3K8WA 1VRUB 3IJEB 4XWGA 1COZA 5EX3A 4U6PA 4CO1A 2C8JA 2BTQB 1DQRA 1UC9A 3RGGA 3GPDG 3M1VA 3QOFA 3PW0A 1PX2A 3PX7A 2SKDA 3H5LA 2B0JA 4JR2A 5A5EA 1BQMB 4GMDA 2XZTB 3FGVA 4AMYA 4CIVA 3CF5Q 1PHRA 3WK5A 2FTRA 5GOTA 3TSAA 3WBFA 1G2OA 4RD6A 3IPRA 2JVRA 2J0QA 4UM8B 1EM6A 3GRFA 3ABRB 4R98A 1V3SA 4E15A 2MEWA 1XNRJ 2WG2A 5BVHA 4OATA 621PA 2PV7A 4JZYA 2WD7B 1NHUA 4TMZA 3LA0A 1M2JA 2CJXA 1RAAB 2FVQA 1IN7A 4WF9Q 4B0PA 1Z2PX 3KL2A 3H84A 2IXFA 2NU7A 4DR1J 4NMHA 3FNBA 3FAKA 3G2LA 4LC0A 1U99A 2L42A 2OP0A 3AD9C 5TE9A 4YJ2A 1HNIB 2PA0A 3L1KA 1Q74A 1V1MA 3GGDA 1HHTP 1YDLA 2OAEA 4RPHA 2O2YA 3G13A 2DQ4A 2QTLA 3L92A 3A1DA 5FA6A 3LKVA 1DQSA 3T9FA 1LFPA 3KMSA 4O3NA 2A5JA 1GP2A 3DP9A 4B3CA 1U28C 1MA3A 3DKIA 2CNKB 4HXYA 3HUUA 1QAJA 3UXEA 1TCVA 5F3WB 3FXAA 4JYMA 4POOA 1YRWA 4Y7CA 2DWUA 5TPZD 4ECWA 1Y6FA 4MHOA 4DV1J 1L4FA 1NM5C 2V3WA 4ZV9A 3UO8B 3EXYA 1PL0A 3R5TA 2MR5A 3ZDYB 3BRQA 1E59A 2JC1A 4IG3A 1S9FA 5A9TA 3C15B 1JBEA 4YMEA 1S1MA 4EF4A 2FZWA 4OJHA 1Z4IA 4HN2A 1SK9A 4BRSA 4ED8A 1KZHA 5AJXA 5HMWA 5IKXA 4I8XA 3QPIA 2P5SA 2PT7A 5JEDA 5ED0A 1XR3A 3A7DA 1KDRA 5JBQA 1N36B 5IYZF 2XY7A 4JV1A 5BV0A 2AE1A 3BV8A 1I1HA 2ZBDA 4TN2A 1JTVA 4YH1A 3R7BA 3HCDA 2VK4A 4H1TA 4PW0A 4N1AA 2R87A 2VSOA 3ZBTA 3OEED 3N5CA 2OA0A 3S8EA 4YV2A 1SBIA 5HGJA 4R6WA 4QQFA 4U2GA 1SB6A 3DZIA 4FXVA 2WWHA 3RJMA 4FI3C 2X0FA 2HRRA 3AHDA 3I1FA 3KOZA 2C84A 3K5NA 3D4NA 1V8BA 3PVCA 3SQGA 4F4DA 1XX6A 3K4HA 1Q16B 5KNBA 3UUWA 1L9XA 3Q3IA 5L9AA 3FYHA 2QX8A 4W1PA 3L07A 4L07A 3ETNA 4OYPA 4KMOA 3IKTA 4HL6A 5IBCA 1FK9A 1GEEA 5C25B 2QSZA 5ETTA 4UUQA 2W6MA 5COQA 6CHYA 5HOQA 1J9GA 4CIOA 4K9NA 1G8JA 4TV9B 1FE8A 2C7QA 2QR5A 4QLBA 4DMZA 3CNOA 2ODNA 4LK2A 2J5KA 5E9QA 2C00A 2X14A 1CUEA 4OYBA 4NLUA 3CG4A 3ETLA 2R8PA 3LUPA 4ID8A 4USVA 3G17A 2CQIA 1MO2A 3WGYA 2NNWB 4HF7A 4O4JA 3QX9A 4NS1A 3NWPA 2L08A 3CLSD 3D59A 3O95A 2XS7A 1UFKA 1ZMRA 3OJCA 4KFBA 1NT2A 4KYVA 3QUAA 3GEMA 1QONA 1JNZB 3IJPA 1RYBA 2FPPB 3KKQA 4QYIA 1HDRA 1RXEA 4JI3J 1YA6A 3HJBA 3GROA 1T5HX 2QP4A 4C3LA 3VH4A 5ALYA 2DBZA 3H98A 5FFNA 4OXKA 2WVGA 3INNA 4JYZA 4EUEA 3DMJB 2E1AA 4FONA 3M5DA 3NTLA 2I5JA 4ER7A 2ADMA 2Z30A 1G3QA 2ZI7A 5J2TF 3PLRA 1BRMA 3DE7X 2W2QP 5L39A 5T8TA 4JENA 4PXYA 2EP5A 3Q8VA 5FI0B 3NBYC 3V4IB 1JI3A 4HYKA 2BI7A 3MWDB 1A71A 4M5MA 2BGWA 2NZJA 1MNEA 2C2GA 2V74B 2HA7A 4C7BA 7FDRA 3KZKA 1M8PA 4IQMA 3EDRB 3G2IA 2DTXA 3LC2O 4X66F 1L3TA 4CMEC 4EUFA 4ZAGA 4BGUA 4N49A 4X84A 4B45A 5ENVA 3D5MA 1O92A 3DV2A 4V24A 2FHKA 3DOMB 1N5YA 1O58A 3ZWBA 4INPA 1O93A 5B1IA 1CNFA 2QZ8A 1YVRA 3HKEA 1NG9A 2V65A 4HLUA 1DWOA 2GBCA 1N2SA 3W1EA 4JV5C 1U9IA 2I4OA 3KQUA 1Y3FE 2ECQA 1F9EB 1SUQB 3SJUA 4KXQA 2G88A 4LJKA 3PO5A 1QKKA 3VYRB 5LD2C 2ADFA 3C70A 3MS2A 1M1NA 3Q4GA 1U9YA 2QD1A 3SO4A 4DR7C 4RAQA 1P5RA 5KSOA 4DV3J 3HVRA 1J5XA 2CVQA 1HNNA 3F71A 2IXDA 1G18A 4JT4A 3FOFC 3DB2A 3B6BA 4HK4A 2IXBA 4G1UC 4KV7A 3FPAA 4D8UA 4ZYLA 4JB2A 1II8B 1M72A 1FS5A 2VBYA 1QGZA 4TOIA 3ZTOA 4MKVA 2ZDPA 3GGJA 2GPAA 2I87A 2C1EA 1NK4A 3N28A 1TVMA 5IN5A 2J9ZB 1OH7A 3JQPA 3ME5A 4M5HA 4YB7A 4I50A 2FKNA 4DV2J 1OHHD 1XLVA 2YIVX 3AUAA 5IC4A 4F3RA 5EZ6B 3U0BA 4LFBB 4IG0A 3DFFA 4KXWA 3CSDA 3UMVA 4GO1A 2NUAB 4EHJA 4F4KA 1ZK3A 5KJEA 4FDUA 4AFFA 2AYYA 3D31A 5DTJA 2ODTX 2X0JA 4X64J 1CV2A 3NIBA 3AV0B 4TGLA 2IEBA 3SEFA 3AFIA 1JALA 2IYPA 3HP6A 3AFOA 5ETMA 2G08A 3EIXA 2YY5A 1EJBA 4K6GA 1CRPA 1WF6A 4P32A 1D2CA 1N3YA 2QVGA 2BONA 5ENZA 1B7FA 1N5MA 5C2CA 4C6TB 2W6NA 3LUHA 4G97A 2ACVA 5K20A 2EYQA 2VHWA 2IA6A 5IVKA 4EYKA 1HLGA 4W5QA 4EZBA 3L77A 3DLGB 4L50A 4J9VA 4I5IA 1U1KA 1PNRA 1KU0A 3WP0A 3EIEA 1UEUA 2JGKA 4ZYUA 4US2R 3D6FA 2P9TA 3M6IA 2LKZA 3B82A 2GJ2A 3ZIAA 2MMYA 3ISND 4B6FA 2JVJA 2A9OA 4RCZA 1IB6A 4WVLA 5IXSA 4B02A 1VE3A 1L5YA 4RIGA 1G8SA 2BFDA 5F8JA 3FNRA 4MKHA 3C3AA 3W8GA 5EOVA 3O5TB 3JZIA 5JAOA 4Q3KA 4HHEA 1W2IA 3QYYA 2H48B 1VL2A 3RS2A 3F49S 2B36A 1Y5MA 4CCYB 4CLDA 3EPHA 2QO3A 4ZOLF 1KRXA 1AC5A 3CLRD 3PY8A 1CF2O 2PJUA 1MZVA 1JDVA 2C2KA 2PBRA 3ZOZA 1NAHA 4PBRA 5LC1A 4MAAA 2PL5A 2MTBA 1O6BA 4XH9B 3R6GB 4QGSA 3VAYA 3BIFA 3WSVA 2O5DA 3HUFA 5KFSA 4LVUA 3RRFA 3WFJA 3CB4A 4DSTA 4L5JA 2FP4B 1RADA 4AI6A 5HUJA 4PQRA 3QVLA 4PWYA 2YV2A 3OR2B 5DTMA 2M1XA 1L7DA 5LXYA 3I5MA 1M5OC 4AG5A 2K87A 1WHYA 1PV4A 3BWYA 4RZRA 3NBQA 4HDAA 1CDEA 3JPWA 3EMDA 5B58C 2PG3A 2ZKUA 2HQOA 4G81A 3VNVA 1RE1B 5CJPA 2QJ3A 2ROEA 1N6IA 1LDYA 2DNKA 3OEYA 2WSMA 1VRTB 2KRRA 5IZ4A 1Q84A 3FCSB 1ZMTA 2GPTA 2OKGA 1T1JA 4WTOB 1GKKA 2BAGA 3SCIE 1UC8A 1RAEA 1GTEA 3QVMA 3K9HA 2FLKA 1OY1A 2QIOA 1S8NA 2IX9A 1I3MA 4UXJA 3O38A 5IXYA 4DCOB 1IFXA 2DEUA 1PFQA 1C9MA 1DBRA 2V5VA 5T7LB 4OXQA 1KZ9A 1CZLA 2Z2MA 2OYRA 3V4LA 1T8YA 2RHDA 4AT1B 1Z7BA 2WINI 2CGEA 3WWPA 5K8UA 4C29A 4EHNA 5CLLA 3WMEA 5IT9A 4QBUA 2WU8A 1RXCA 3KQLA 3IBFA 1VXOA 4XGRA 3KFXA 1JLMA 4KQJA 1EFHA 4OKSA 3JWJA 1MXAA 3C3DA 4JI5C 4ZVFA 4ARIA 4F3NA 4A46A 3RIEA 4F12A 4K40A 3FPFA 3ZDZB 2ZI5A 2PZLA 4EG7A 1WX1A 2Q5OA 1M5SA 1HZJA 1QV6A 3ZUPA 3BTSA 2WT4A 1Z5GA 2ZSIA 4FX5A 5KNDH 3ESRA 2LCIA 3ZHXA 1H8EA 3QEAZ 1UBHS 4J9UE 4R5MA 4IG9A 1ECCA 4JLVA 3WQSB 5TQVA 2OHXA 1WIWA 3BWVA 4JASB 1M1UA 1CXZA 4RZQA 3OEHA 1NXVA 1P6UA 1P2TA 2LDYA 4CZ2A 5KMGA 4KXVA 1Z5NA 1IQ0A 2WUGA 1QQ6A 4TQRA 3MRTA 1XZIA 3DO6A 3AI3A 2WVEA 1UANA 4KG7A 1M7BA 2HJRA 4FP9A 5D85A 3FPEA 4X2BA 2BUCA 5B0GA 4EFDA 3DTTA 2G5PA 4IDAA 2NQ2C 3GIRA 2CCKA 3TVKA 5BORA 1VSQA 1X0FA 4D3FA 1RA6A 1QH1A 1G2IA 1GXLA 4HNAA 3KK3A 2E37A 4C2AA 2R1VA 3WGHA 2HGNA 3WBKA 5CD9A 1D0IA 2VRBA 4G1CA 4CNQA 3P0JA 4G1QA 5EXSA 3C6UA 2OBVA 3MM6B 1E5LA 1IUJA 3T7JA 4Z7OB 3L01A 3LPNA 3U5ZB 4P36A 1C4XA 5AQ1A 3LO5A 4HLQB 1BVHA 3BN3A 3I9ZA 1LV5A 2KZ0A 3IMEA 1R2QA 1E9DA 3KZ1E 1MJGA 4Q3BA 1DWQA 2I2AA 4ZITA 2CT8A 2XVYA 4F8EA 3RKRA 2ZIVB 1HMVA 2PEBA 1MVOA 5ILGA 3P5TL 3JALB 5U4QA 3UJ6A 4U3JA 4XGQA 2D0DA 3AJRA 2IM2A 1VLAA 2G13A 2ORED 4FFDA 4LE1A 4DIMA 4A6EA 2FNAA 1MF7A 4GM0A 2OBXA 3RAJA 2C57A 2VT2A 2DB3A 2VC1A 3ZV4A 4RIHA 3HHNB 4ANFA 4CT9A 3GPBA 1RNLA 2EIXA 3I9KA 3TZZA 1JQEA 1NC1A 2R8OA 4GMHA 5JVGQ 3UCZP 3L4KA 1PV2A 2AMCB 5M34A 4PV7A 1KPGA 3AIIA 4LYJA 2NXCA 1JKHA 4G37A 4PSUA 1YJ7A 2E5HA 3ETGA 5CDHA 5B5SA 5CLQA 4B3MF 4LF8B 4HDSB 5KYNA 4F3MA 4PZZA 3A31A 1GT6A 1E6CA 1R0BA 3LBAA 3L43A 2B8QA 2RCNA 4TN5A 4YJ2F 4XJTA 2GN2A 3MEDB 1UIRA 4RACA 1VJGA 3EXIA 1PFYA 3GZJA 1P0MA 5IJ0B 1PR4A 5B7WA 1XLTA 1ITPA 3T9NA 2VJAA 2VRCD 3KE8A 4ZS6A 4OM8A 3NV7A 2GCGA 3D3NA 4PLGA 3DBOB 3OX1A 5I9LA 2RGEA 1C30A 4QIEA 3POTB 4XSHA 1F0XA 4W92B 4QU5A 3VJRA 4IDCA 1UDCA 1ORHA 1QTRA 2FN7A 2CNNA 4QBFA 1JEAA 4JJIA 2YMQA 5CX1A 1TL5A 1UMBB 2H65A 5BUSA 4L0MA 2Y9HA 2O8CA 2R8GA 1M1GA 5EP1A 5FTKA 1VBZA 4LGYA 2C31A 2L69A 1WMFA 5L3ZA 2KWIA 2XSFA 1CG6A 4PWDB 3TOCA 2Q28A 4RFSA 4MEAA 2IBSA 2VR1A 1YJUA 3VALA 3T7IA 2VBZA 3GIJA 4K0KC 1VLLA 4IIVA 1UEKA 1S97A 4RY8A 4RWEA 1XPOA 1GIAA 3G89A 2EOAA 3IDOA 2C61A 1XR6A 4C0AC 2J9CA 2PZFA 3BBCA 4PEOA 2JFVA 3FSRA 4RW8A 1F0YA 4HFJA 3PJWA 1N34C 1WDWB 2C4UA 3LC0A 4IICA 4PG4A 3KSBC 1W5FA 4RA9B 2AJCA 4YASA 4L8VA 1S3GA 2CQGA 3BKWA 3ENWA 4MUJA 3DXYA 3TTWA 3IA0A 1WNFA 4XLZA 3KMQA 4D9CA 3G82B 4U9IS 3MM5B 2YNGB 4XM2A 1IWBB 2AIRA 1VQKS 3OHMA 4A8SA 1DBPA 3RC7A 4EBDA 3HSKA 3TB4A 1K73T 2OXRA 1FX0B 1FJGF 1QCYA 3I5UA 4FK8A 1C0UA 1QYWA 1Y8RB 1VC2A 2GEBA 1I0IA 3DG9A 3C4QA 1QK4A 3R8CA 4Q9AA 4P4SB 3HHKA 4YACA 2WJAA 4B9UA 4LY3A 2DTDA 4B8WA 2FJAB 3I6ZA 2QA4S 1C1XA 4BKUA 4TSKA 4MW4A 2BEVA 3O9MA 4JI7B 5G1NA 1GGJA 4KQGA 3D6MB 4XX2A 4Q34A 3C5CA 2DNRA 3PNOA 3AOAA 2VBXA 4GKAA 1U1OA 1MTZA 2Y27A 4Y2HA 4X95A 4OLHA 3H86A 1PR6A 1O51A 1BAPA 2HPHA 1ZM3A 4O4JF 4UD2A 3KT0A 4FWBA 2NZCA 4DR3F 5JMWA 4GYKA 3ZVMA 3R8XA 1QSLA 2IMWP 4Z4IA 3ZDRA 9ATCB 1KI8A 2CYCA 4H3SA 3TM4A 1U1EA 1TD9A 5KG6A 4JI1F 4R84A 4E2WA 5KG3A 2IYOA 4TT3D 3DQQA 4PZ9A 4WNYA 3T5CA 3OOEA 2Q0XA 3FHTA 1MQSA 2ZYTX 3IDQA 3PO4A 4EJ0A 3DE1X 1FUYB 4RSMA 4Z9BA 3VAAA 4JI2C 2ZJRQ 3OZSA 1OREA 4B84A 2D3UA 2CSUA 3NC4A 3ET4A 1XTIA 4KT0C 3FPLA 1I6MA 2ZVJA 3HT0A 1JQGA 1SXQA 3E2IA 1RT5A 1X4FA 3Q3HA 1TKXB 2R00C 4DCJA 3TA1A 2V5HG 2WIFA 4EI9A 2FPHX 4H4OA 4R9RA 4AYXA 4GP6A 1RZUA 1VPWA 1NE2A 1M1YA 1NXQA 4F3KA 3BRWA 4A8HA 1XNQB 4KX5A 2G0JA 1TEZA 3K58A 1YIJS 3UPUA 5CXUA 2QI9F 4F3YA 2H5EA 1FESA 3QAUA 2JLXA 1GL7A 2IYRA 4Q5IA 5KFEA 1I4OA 1FJCA 3DOKA 5EJ2A 1C7EA 1S57A 1ECPA 1WP9A 3GFRA 1I94F 4P92A 1GNQA 3BPSP 4TWAA 3ILIA 5CZVA 3H04A 3HB9A 2DF8A 3FX2A 4J29A 5K4GA 4V0SA 5E0OA 5HA5A 1U09A 3SJZA 1W87A 1FA9A 2CEKA 4DCVA 4LI0A 2HXGA 2L41A 2RH9B 3K8QA 2BYTA 5DV9A 3GONA 3MM8B 2YH2A 5KTRA 4QPJC 1O57A 3I30X 5EJIA 1HNVB 2PKYX 5LOVB 3WNZA 5CBPA 1T11A 4YROA 2ATCA 4RJ2A 3J81U 4J9NA 1YITS 2FPIA 1VLOA 1PYGA 2B9XA 2VBIA 3GX1A 1C1CB 1HURA 3DBRA 2WK4A 4MQMA 2OL4A 3GJQA 1YR6A 4HZUB 2ZSUA 3K9CA 4BMVA 4UUNA 1C0EA 2PXHA 1WZNA 2I4NA 2RDDA 1L3UA 3WKCA 3I09A 1LA2A 3GG1A 1RRGA 5CLJA 1D09A 4BKRA 1H2UX 3MCNA 4OOFA 1X4BA 3T5MA 1QMGA 4QUAA 3BSFA 1AK2A 4BMCA 1WOYA 2AMYA 1HO3A 4Z0TA 2XWYA 2NTVA 5LWHA 4Q24A 1MX5A 4LC9A 3U7EB 3OCXA 4JYBA 1Q81T 2O5EA 2LIPA 4S35A 2X5XA 2V7EA 3I6MA 4I1IA 2FN4A 1ZVKA 2ALJA 5EX0A 1NU4A 2E21A 4HGYA 1ONSA 1MENA 4RNCA 2XB9A 1GCIA 4KAXA 2YBDA 3RT1A 4HMPA 2WI8A 4N40A 2VPPA 1H2AS 2O59A 4YAUA 2BFWA 4ER3A 5DI3B 4G2TA 1PSZA 2MKCA 3L93A 4RDCA 4DSAA 2BDPA 3JARA 4C0WA 5LP6C 1RKUA 2CQ1A 3NGKA 3LF2A 2JCGA 3WHLA 5JV5A 1Q3HA 1QAQA 2JNVA 1KU6A 3VH2A 2DC1A 2G80A 4ES1A 4NZYA 3E7FA 1T9DA 5IU6A 4ECQA 3WBJA 3T5BA 3H9CA 4IDHA 5DPMA 2OK7A 3A3YA 4F1WA 2ZXEA 1ILWA 4E1VA 4X1YA 3OXFA 1DXHA 4NATA 1FRKA 3DOLA 2XD9A 3I8OA 3KEQA 2PVPA 4CUKA 4PX2A 1JB0C 3SQDA 1S8FA 5GJCA 4IMIB 2BM9A 1A50B 2YKNA 2Q4EA 1U8AA 3W9YA 2OZPA 4DG1B 4X91A 1QU2A 1S0NA 5JR3A 1RTHB 2BP7B 2G76A 2CVZA 1YR8A 1VCIA 2QFIA 2GWHA 2RK6A 3BMNB 4PWWA 5KDDA 2HHLA 4BBJA 4NEGA 1EKXA 2QL5A 4MRRA 4DNOA 1EZZA 4YQYA 1G64A 4CIWA 3F56A 2FFHA 4Z9XA 1PJLA 1WZEA 4CQJA 1XNRF 3FMPB 4YO7A 4H7PA 2ZC4A 3MW8A 3ER8A 3QVVA 1NYQA 3QKTA 2ZWAA 3MHPA 3VU9A 3H2BA 2P35A 4B7AA 5CAEB 4FGWA 5IF3A 2YIDA 1FMLA 1X8LA 4DR1F 2VDMB 3OTEA 1VQSA 4Z2YA 3HJNA 3COZA 1OVMA 2HGMA 4RLSA 3MQ2A 4I4IA 1U8TA 3SDEB 4MKIA 4DMHA 4C04A 3LYAA 2G70A 3QMVA 4IAOA 2BFCA 1GUFA 2XTNA 2FOLA 1QUPA 2VG7A 1S9EB 2Q3PA 9ABPA 3PRJA 3SS8A 2GERA 1W88B 1WU7A 5CLHA 1KJIA 2D62A 2Z3VA 2OPLA 5CFQA 3TZXA 3MS4A 4A47A 1E8MA 1A4IA 3G2PA 1JB1A 4U8VA 1QWIA 3GDOA 2AT1A 1AKRA 1N9ZA 3P49B 3JQMA 4YMTA 3PFBA 3S40A 4B2IA 2WP0C 2ONZA 4GWGA 5CCEA 1LTKA 3KHLA 2ZTMA 1KEKA 1CY6A 4RKYA 5FLKA 1JHXA 2JLSA 2HNAA 2QOEA 2YYSA 3PFWO 3W61A 1MTOA 2XCSB 2Q2WA 4FYKA 2DFLA 2CPHA 1JT2A 3K6JA 4H6XA 3TKYA 1Q15A 1IB8A 2O0JA 5GM2A 3UK2A 3KQOA 4RD2A 3G2KA 5MAOA 1ZNQO 3H20A 3K1ZA 4DILA 4FYVB 1NSKL 3W5ZA 3KEFA 4HT5A 2GFHA 3VZPA 2V7XA 1AS2A 1OFVA 3L0CA 1NBME 4FDFA 1AZSC 4CQNA 3BZUA 2RRAA 2CBGA 3T6BA 3VNUA 3GL9A 2ZP1A 4KNYA 3TOZA 1TEHA 2NUTA 4PKDB 5JNLA 4NZPA 2XE6A 3M6FA 1V4VA 4RHXA 1OPXA 4OQYA 2LEPA 1H4TA 1D1QA 3S1AB 4OZJA 3G8DA 3BH6A 5EXXA 2JBAA 2ZYRA 4EO8A 1AOXA 2BL4A 4NYIQ 2Y0BB 3ZY6A 3UVJA 4CLHA 4O1MA 4P98A 4IZOA 3HYSA 2EQBA 3MSXA 2QROA 2CFSA 3M8QB 1X8JA 2JHEA 3SSOA 1K8RA 2C8VA 1Y7LA 3THRA 3W5HA 4X4OA 4XW2A 2W9CA 1AO3A 2KDOA 3TEMA 1AMNA 2BW2A 2ZAIA 1NZDA 1ZNYA 4AXJA 4DV0F 4EW3A 1X9GA 2VA9A 3HJGA 2BGJA 2XF2A 1I9GA 2QA4G 3SQNA 2QL7B 5EWFA 3K0EA 1P7WA 3NPAA 2HFNA 1E3EA 2HNZA 4MYSA 4EFAC 2Q3EA 4IXWA 1SGWA 3BDEA 1DPFA 1ZPVA 1H66A 3QPCA 1N6RA 2D0OB 2G77B 1R27B 1U0GA 4I56A 1ZOIA 4OJ3A 4Q8FA 3KZNA 3SHOA 1PKXA 4M0UA 1WTBA 3CTRA 2QY9A 3E7PA 3FN4A 3GJ0A 1TKDA 3H1FA 3KZVA 5B2ZA 1U2DA 3DZKA 1X5OA 2VWGA 3UXYA 1NBMA 4JI3F 1Q91A 2F8MA 4K28A 4IBOA 5CNMA 2UUOA 1PJ4A 2RQ4A 3H7IA 3CD7A 3E48A 2AYAA 1UPBA 5T3YA 5J4HA 1JKJB 4DY6A 1BXGB 4NYPA 1Y8ZA 2WSFC 1WUKS 5C5IA 4OX9C 1KI6A 4MQ5A 4DM7A 4Y2CA 3NGMA 2LLZA 2VSXA 4PHTA 4MR9A 3RUAA 1CWUA 5DDPC 2ZSBA 4FDVA 3PCTA 3LO3A 3FJYA 3T4PA 1SV5B 5KYGA 4GNKA 4YP7A 2WILA 5LYJA 1QDEA 4W9NA 4BWYA 4C14A 3FUYA 3A4VA 2ZOGA 4C30A 1UFOA 2XCRB 4OI6A 2B5VA 1A04A 2CL0X 3IPAA 3KOMA 3RT9A 4ZJUA 4JC4A 4V0RA 4NOZA 3ZDBA 1E1DA 3B8EA 4KWTA 4IO9Q 5B36A 3AT1B 2XMJA 3QXJA 4V2IA 5BNWA 3LPLA 4DBZA 1B6GA 3DDNA 3I9V1 4D9NA 4EARA 1BN7A 4UZSA 4X71A 1JXAA 1N92A 5AW7A 5CHEA 1N32B 4FQ5A 3PXGA 4ZAVA 1U94A 3ER9A 4CEIB 4DSKA 3UJ9A 3RDPA 3HA3A 2JIDA 2HDNB 4DV3F 3EIWA 3MBKA 4LE2A 4FNIA 3W5VA 3CCFA 5DISB 2ZWOA 4A73A 4RM2A 4EYSA 3RIHA 2P2FA 2OGTA 1Q44A 1VB3A 3AWDA 5JDCC 3AY3A 5IYZA 2AG5A 3KETA 4F2DA 5CA0F 4TL8A 3KSZO 4OHUA 1UK9A 2YYYA 3QIPB 1DINA 4P4NA 1FDRA 2G71A 4LF4C 2GGPB 2FVPA 5D77A 3T5PA 2VBCA 1P73A 3RYLA 1FSZA 3M1YA 4GH5A 5D0EA 3WIEA 3O8WA 2R2RA 2ZS7A 2XOKD 3D1QA 4O0LA 4HGRA 4JEHA 2ZEJA 4NLGA 3S1TA 1MORA 4HDOB 5D3ZA 3AEKA 3C85A 2GK4A 2OXEA 3CKYA 1JBQA 4FE3A 1RAHB 3G85A 3LWMA 5ALOA 4NH0A 1UWAA 3GRKA 1EI9A 4BNDB 3AF4A 4MJ3A 4ZD6A 3TMAA 1UWBA 4RW4B 3PRHA 1H0KA 4N01A 1DQNA 2BDTA 1WHSA 1ROFA 4RVCA 2ZZTA 1WQ3A 4XX1A 1RAOA 1JPVA 3KXIA 3TM5A 1GU1A 2IHUA 5DLFA 1C9DB 4QUBA 2J3KA 3FMFA 2HHVA 1I51B 3UOAB 3I08A 2IC3B 3H5YA 5JWOA 4Z86A 3OVBA 2G9UA 5DNDA 5LLTA 3X1LB 1NJYA 2M70A 1Q0PA 1ZIOA 2G6TA 2WWIA 3KJHA 1QZZA 1ZA1A 5IRCD 5I7RA 1C2YA 2I65A 2Y66A 3H3JA 1DO0A 5C7YA 2AW5A 1OZAA 2AZ4A 4CV1A 3D67A 5FWDA 2QD4A 3ANYB 1X7ZA 4IQ4A 5JRZA 2PSZA 4JN6B 5GAGI 3AQOA 3VWSA 4BQRA 5HP1A 4MW6A 1S7IA 3L6EA 1UAAA 5KTNA 5A2QY 2C2YA 2DQZA 4YRGA 3TUPA 3UAVA 3P20A 2HXSA 3ZGOA 2PX4A 2PPLA 3NOGA 2WYHA 4F97A 1EE2A 8AT1B 1TIBA 3FCEA 1DMRA 3DQZA 1EBFA 8GPBA 3IEPA 4G5YA 4YLEA 1ST3A 1TUIA 4L3KA 4DLZA 1V8PA 1BGWA 1DJLA 1J8DA 2GZ2A 4TL9A 2C28A 3IJ5A 3EXEB 4XSGA 3C5EA 1N33C 5J2TA 6ADHA 1RYNA 3P2OA 4IHAA 4FGKA 4ED3A 3INYA 2Y1GA 1MN9A 1I14A 3KTFA 1QQTA 4N3AA 5EIAA 4IS2A 4ZZ3A 1IEVA 3OFNA 1YI0A 4Q3CA 5C4IA 4XQ9A 1YZVA 5L95A 4ANCA 3V4SA 3MCSA 2VBWA 4XB2A 4QXRA 1EK2A 3REGA 1BVRA 3CJ8A 5J1PA 4WIQA 3L79A 1N8TA 1E2JA 3IILA 1ZIDA 1IN5A 2HCFA 5DM1A 1DAGA 1Z4OA 1UWKA 3H5OA 4LOKA 3VZSA 1RBYA 4MA0A 4AP5A 3HZEA 2FLVA 1ABEA 1OT5A 1I5OB 2GNPA 3R75A 4GXQA 3IVMA 2QTMA 1Q83A 5DRYA 3BQ0A 3UDLA 4ZJQA 1Z4JA 3KTOA 3VR6A 1E4EB 4JA0A 1RWMB 3CTPA 3HVHA 5FOWA 1U4OA 2V8PA 1S2LA 4EYGA 2LW7A 5EUQB 5E6SB 3I4HX 4DL7A 3M05A 4E7PA 1GMUA 4NJEB 1C81A 5JD4A 3TLEA 4MQ6A 2C9DA 3IXLA 4W9RA 2EDCA 3BDAA 2AG6A 4C1BA 2QTHA 1GQ2A 1F8FA 3DM5A 4LI3X 3MI7X 4WFZA 4B76A 3OT5A 3KYJB 1Z5OA 4H6VA 4CMBA 2YH0A 2FPUA 2X2OA 4KH0A 2ZBRA 2JFWA 2IW3A 3COSA 2P2LA 1X5SA 1XU4A 3W3ZB 2CXXA 4OLAA 5ICSA 1OYDA 2WC1A 1HNWJ 1QBKC 2FA9A 3PDIA 1FMTA 3AH8A 4KWIA 4BQPA 3KLPX 1XQIA 2Q79A 1BX0A 1KR2A 1N7IA 2XD4A 3TPFA 4MPRA 4HXGA 4M36A 3I07A 5CXQA 3AM4A 3BYPA 3D3BJ 3IQGX 5B3AA 3KU1A 3EA0A 4UM9D 5DGHA 3RVKA 4N6OA 4YI5A 3HO6A 2DBYA 2PH5A 2IYTA 2H0AA 1WO8A 2OBYA 4M37A 2WTEA 1UMDA 3K35A 2KHCA 1TK0A 1FJ7A 1UBEA 2I6QA 2GQ2A 1KYYA 3UW3A 2O1EA 4XIGS 4LSLA 3M34A 1FJGJ 1QK5A 3IAM6 4A8JC 4BIIA 1H0HA 5LU8A 2Q6VA 3NNHA 4MX8A 5JH7B 1RYZA 3M1AA 3GJ3A 5ADHA 1A7UA 4Y1FA 3CJ0A 2JGEA 2P4HX 5C24B 2B5JA 4GAEA 4JELA 4IYQA 5HDBB 3FSXA 1YQUA 2DHXA 3EULA 1N3IA 3HNRA 2BKLA 2DFTA 4U2BA 4L6IA 4EK2A 1WY5A 1LBTA 4Q18A 2OHVA 2AN3A 3BGRA 1OZFA 1KMMA 1A82A 4L74A 2JGDB 1R8PA 3NYQA 4AY6A 1V7QA 2CK3A 4ZOLA 1Z5WA 4G63A 4DPOA 1NNDA 4AL7A 1TMGE 2EHJA 3RR8A 4HUJA 3I61A 1P8GA 1ZH4A 2XGOA 1TJYA 1R15A 1TL7C 4DR3J 2IZZA 4HPWA 1WG8A 1CHDA 3TLGB 2J5RA 4HB0A 1TA4A 4U63A 2OLJA 3W3AA 4JI1J 3DLIA 2R4QA 3SCLE 3THYA 4ETMA 3FNGA 1XDWA 5KWJA 1T0BA 4YHHC 3N9UC 4F92B 2VSQA 2O0LA 4KZKA 1S76D 1FDOA 1KBZA 4LRUA 3UEBA 3CDEA 4O3FA 1GA4A 2RAQA 4RX6A 3ZHZA 3D0RA 4L02A 2BR5A 4ZQFA 4ALLA 2HV9A 1GPYA 5LZ7A 1NW6A 1EUDA 1FJHA 4BVGA 2LUOA 4ZYZA 4LYYA 4CQMB 4MGIR 2AN1A 1JDTA 3USES 2B7CA 1MVLA 5DF1A 5EYPB 4BV9A 1I94J 4HDKB 2OM6A 4DUYB 2KI5A 1XN1A 3DUFA 1BRTA 3UX3A 3UGKA 3WQPA 1MROA 4MJLA 3SHVA 4JQYA 4A2PA 2JHAA 4D4HA 1LNZA 1WXEA 1ESCA 4C76A 3DVSX 2ZM5A 4OX9Y 1FP1D 3JWPA 4HT7A 1G3IA 2HQRA 3VV2A 2KYZA 3HMQA 1GXSA 2DTEA 1Z08A 4FU0A 1NM2A 1D9DA 3RBAA 3I9V9 3PZBA 3D54D 2AR7A 2HT6A 1P74A 1P9QC 4P34A 1T4BA 2F4VJ 3ZW7A 5DLDA 4C4OA 1E69A 3GRYA 3AYZB 4A8PA 1RKBA <