2ZZMA

The complex structure of atrm5 and trnaleu
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
333
structure length
329
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVSYAPREYILALDFKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 82
structure length 329
sequence length 333
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zzmA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zzmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zzmA03
3K0BA 3EVBA 5MHTA 1RI5A 3P2IA 4O29A 4RYLA 1V39A 1NW8A 5BP7A 1X1DA 1VPTA 5HIJA 5LQUA 3G2MA 3GCZA 3R9XB 2PWYA 5C1IA 4DM3A 3UJDA 4RTKA 1VIDA 4FT2A 2Z6QA 5DM0A 4ER0A 2B25A 2AOUA 2OY0A 3PS9A 5FA5A 5GINE 1NE2A 2NNWB 3EGEA 4RTJA 2CL5A 1N2XA 3ERCA 2OBFA 4PGHA 4GBED 1SUIA 3X0DA 4BLVA 3RIEA 5CCBA 3BKWA 5FWAA 1JTFA 5EVJA 2O57A 2NP7A 2AOTA 3FPEA 3MCZA 3FUWA 3OPNA 4HTFA 3TR6A 1L1EA 2PXAA 3THRA 3TOSA 5CUQA 3V97A 4OX9Y 2AS0A 5CVUA 5E1DA 3EVCA 3LCCA 3C0KA 1U2ZA 5GM2A 2ZBRA 4YUXA 1SKMA 1ZKDA 5ERGB 5FTWA 1XDUA 3BXOA 3IV6A 5DLYA 2QYOA 1KYWA 1AV6A 5EPEA 3UA3A 3GIWA 2P3OA 1EAMA 3LHDA 2YXLA 2V7EA 4FSXA 2P40A 5GIOE 1O54A 3C3YA 1HNNA 2XVMA 3LKZA 3MERA 5EMMA 1XDZA 4YUYA 2PKWA 3QOXA 3G7UA 2G70A 1RJFA 4OA5A 5EIWA 3TLJA 4B17A 1XDSA 3KQMA 5DRYA 2FYTA 3Q7EA 1ZHFA 3FUUA 5EC8A 3SM3A 2G72A 3BUSA 3EVZA 5EHIA 3OU7A 3LX6A 3GDHA 3NTVA 3FPHA 5HOQA 2YXEA 3ER8A 1H1DA 2AN4A 1Q0TA 3V8VA 4HH4A 4BP3A 3KR9A 5U4XA 2GA9A 4QQKA 1EJ6A 2B3TA 3TRKA 3CKKA 5LQCA 1JG2A 4AZVA 3FTEA 4PYIA 1TW2A 5GP1A 4KDCA 2ZIGA 3NW9A 1X19A 3GXOA 4RSRA 2CKDA 4RWZA 4YV2A 1NV8A 1YZHA 5DX0A 1G38A 4XUCA 4F86A 5DTMA 5B1SA 3UJ9A 3M6UA 1SG9A 2ERCA 5D1NA 2AN5A 1NW7A 4EQZA 3UBTA 2IBTA 1T43A 2R3SA 2C7RA 2IFTA 2Y1XA 5E2BA 2OO3A 4E2ZA 2AVDA 3KPYA 1FPQA 3M6XA 3P9KA 4YUVA 3PFHA 5CVVA 5T64A 5K0JA 3G8AA 2FHPA 1QAQA 2YQZA 3KQQA 3F4KA 2YVLA 3EPPA 3SX0A 4DQ0A 5LQKA 2C7OA 4V0RA 4P58A 5BW4A 2UZ4A 2C7QA 1YFLA 3OFJA 1XXLA 3Q87B 4P7KA 4QDJA 4PIMA 3DUWA 3BT7A 5DPMA 1Z3CA 3LL7A 4E2YA 2AR0A 2EG5A 3HCDA 1NW6A 2PX2A 1JG3A 3CGGA 4OQEA 4X60A 3KPVA 3UJ8A 1M6EX 2ZCJA 1AQIA 5IKMA 2E5WA 2CWWA 3OU2A 4HGZA 3FPJA 2NP6A 3BWMA 1JQ3A 5EMKA 4XCXA 3M70A 3ELWA 4M37A 3B3JA 3G2OA 2O0LA 5HIMA 1P1BA 3QOWA 1VE3A 5K0CA 3EVDA 3ME5A 3AWIA 1BHJA 5K0EA 5CM2Z 2PGXA 1O9GA 1XTPA 3NJRA 3BWCA 4E32A 3I53A 4CTJA 2JHCA 2FRXA 2ZSUA 2BR3A 1G60A 1YB2A 4YMGA 2BR5A 3LECA 4C08A 5K0FA 2G71A 2YTZA 2ZTHA 4U7TB 3G5TA 4JXJA 1KP9A 3TFWA 5DWQA 3QV2A 2K4MA 2IDKA 2PT9A 3HCBA 3A7EA 3KQOA 3P9CA 3PX3A 5DX8A 1R8YA 2QM3A 4HTFB 1WG8A 3JWIA 5K0BA 3EVAA 2IP2A 3R24A 2VDWA 3M33A 1O9HA 2HMYB 2EX4A 3KQWA 3HA7A 3OZTA 5BXYA 1QYRA 5K01A 1NW3A 5CVJA 3T7SA 4AZWA 4CWAA 2PSSA 5EGSA 4A6DA 4EVIA 2IH5A 3O4FA 4KW7A 4LWPA 2BZGA 4QPPA 4XUDA 5CVEA 3CC8A 3DMFA 5EKUA 2OXTA 3TM4A 1YFJA 4PGGA 2AVNA 5T67A 4RVHA 3OFKA 3I64A 4QTTB 5E9JA 3HP7A 2ORED 1Y8CA 3UA4A 4X41A 3MB5A 5DX1A 1WY7A 3CJTA 3HVKA 5KS2A 2GAFA 2WA2A 3FTDA 5EKXA 4HSGA 1JG1A 2LD4A 2O06A 5K0GA 4GEKA 3G2QA 3I9FA 4HGYA 2ZVJA 4K6MA 4PCAA 4OA8A 4OQDA 4HG2A 3DP7A 1P91A 4E31A 4AZSA 2YUIA 4RVGA 1P39A 5K8VA 4GOOD 5IH3A 1L3IA 3DMHA 1UWVA 5K0NA 3UJ6A 5CD1A 3DXYA 1RI3A 3EVEA 3VSEA 5K03A 3KKZA 3MCTA 5M5BA 4F84A 3ER9A 3G5LA 2ZWVA 3EVGA 3OE5A 3PVCA 3PT9A 5DM2A 2OB1A 4C07A 3FYDA 5K05A 3L8DA 1G8AA 1WZNA 2H00A 5E8JA 4AX8A 4ISCA 1DUSA 2OPBA 4OBXA 2ZFUA 5FHRA 5GWXA 3IHTA 3EEYA 2AN3A 2VS1A 5F2OA 3GRUA 1JSXA 2ZW9A 4YUZA 3I5UA 4PYQA 5EZQA 2NXNA 3IEIA 4C4AA 3DXZA 1SQGA 3TM5A 4RTMA 5LR6A 3JWJA 1YF3A 3TPZA 3R6TA 5LSAA 3R3HA 4DZRA 3P97A 1L3CA 2P41A 5K09A 3GO4A 2JHPA 1KHHA 2IPXA 4MIKA 3T0IA 1WXWA 4DCMA 1XCJA 2HR1A 3UWPA 1JSZA 2HNKA 1Q0SA 3DOUA 2V74B 5EHGA 3T7RA 3CBGA 5ICCA 4FS8A 1HMYA 2AOUB 2O07A 4P7GA 2XYRA 3DMGA 5HZMA 4RTOA 4ZTBA 2PT6A 3KPUA 2P1DA 3KQVA 5H02A 2BR4A 3GWZA 2PX5A 3B7PA 3KHKA 4KVZA 5EOVA 3TKYA 1AQJA 1XVAA 2EJUA 3LGAA 1I4WA 2NXJA 4M36A 1VBFA 3REOA 2OB2A 2B2CA 3NWBA 3VC1A 3SGLA 3O31A 4KIGA 4BY9E 4PYKA 2Q41A 2PLWA 1FP1D 1NW5A 5JR3A 1VQ1A 1PJZA 3PB3A 3P71T 3LBFA 4M7RA 4KIFA 4E33A 1R8XA 5F2NA 3A7DA 3H2BA 3A4TA 1SQFA 1EQAA 3HA3A 5FULA 4POOA 4DA4A 2CMGA 4RTLA 1UIRA 1YZ3A 2HV9A 4PONA 3TKAA 4CKBA 3LDFA 3MGGA 3P2EA 1FJXA 1YUBA 3ELDA 3NDIA 5EMLA 4FT4A 4C03A 2AOTB 4YV1A 2R6ZA 1JR4A 3B89A 3OZRA 3UZUA 1QANA 3D2LA 4LG1A 4KRGA 3C6KA 2PV0A 3BWYA 3SSMA 5KYGA 1XJ5A 5GIPE 2C7PA 3VYWA 2Y1WA 4IKPA 5E1OA 2AOXA 2JH8A 4FR0A 2XBMA 1IY9A 1TPYA 10MHA 1R18A 2JG3A 1NBHA 5DTRA 2ZBQA 2ZIFA 5KQRA 4Z2YA 3B3GA 2ONYA 5T6BA 3K6RA 2GH1A 3SR4A 3EMBA 5HILA 4MWZA 4GOND 4R6WA 1L9KA 2XYVA 4PIPA 3A26A 1F38A 2OZVA 3CJRA 3NWEA 3KR1A 4GC9A 5EEHA 2P7IA 4ER6A 3HCCA 3HCEA 3DULA 3PTAA 3MQ2A 3E7PA 4CKEA 2O05A 3ORHA 1ORHA 3OE4A 1NKVA 4QPNA 4U7PB 5DSXA 3T7TA 4WXHA 3GRYA 4FGZA 2GS9A 4RTNA 1X1AA 1SUSA 1VL5A 5DM1A 4QDKA 1VP9A 3G89A 2UYCA 4DCGA 2FK8A 2JH9A 1RJGA 4BLWA 4GF5A 2I9KA 1N7IA 2IGTA 4QTUB 4XUEA 5FADA 2GLUA 1EIZA 4PYLA 5EQJB 5EG5A 4G56A 5FUBA 4GQBA 4AUKA 3FRHA 3G8BA 2I62A 3HA5A 5HEKA 3EGVA 5DRTA 2PXXA 4DMGA 4HC4A 3FZGA 4RVDA 3E05A 4E2WA 4PYJA 2VP3A 2VDUE 4C05A 3GJYA 3LCUA 1KPGA 5HIKA 4QVGA 2ONZA 2ZZMA 3B3FA 3CCFA 2GB4A 3EEOA 5FQOA 5GOZA 5C9ZA 2HTEA 4PCLA 2UYHA 4GOLD 2FK7A 3AXTA 4RX1A 2QE6A 3HVHA 3MAGA 2PY6A 5EIFA 4BP1A 4EKIA 2AZTA 1QAMA 2EFJA 3NDJA 2I6GA 1DCTA 3SXJA 4WVLA 4GC5A 2XYQA 5LQJA 1KPHA 3BKXA 1EJ0A 3A25A 4FP9A 1M6YA 2FPOA 3E23A 3KR2A 4PWYA 3U81A 3HVIA 3I58A 4MQ4A 3KPJA 5DTQA 4CKCA 5JUWA 4HRAA 4DF3A 2I7CA 3PFGA 5HFJA 4YUWA 2JHAA 3DTNA 4EMSA 2IBSA 3EGIA 3KQSA 2ZZNA 5E9QA 5DXAA 4CTKA 3P8ZA 2DULA 5E2AA 3IYLW 1RI1A 2H1RA 4MTLA 4OBWA 4CXMA 3VC2A 3O7WA 5FCDA 4IV8A 3DLIA 4PNEA 5LQRA 1JTEA 4X1OA 1VLMA 5LQNA 3M6WA 5D1HA 1G8SA 4A6EA 1M0EA 4R8RA 4PINA 4DKJA 3FUTA 1NBIA 1ZG3A 2G8NA 2ZBPA 3BZBA 3FTCA 5DSTA 3NMUF 1INLA 1MJFA 3HM2A 4NECA 1R74A 2FCAA 1ZGJA 1X1CA 2YX1A 5HIIA 1NT2A 4UOEA 2PX4A 2NYUA 4PYOA 4PYNA 2IH4A 5E9WA 3FUVA 1F3LA 3GRRA 3KQPA 5CIYA 4KWCA 5GM1A 1JG4A 4QQNA 5KQSA 3P2KA 3OU6A 5EEGA 2BH2A 4GUAA 5DT2A 2IH2A 4FZVA 1JQDA 8MHTA 1FBNA 2PWPA 1OR8A 2ZWAA 4PYMA 1AF7A 2B9EA 2BM9A 3G2PA 3GRVA 3PX2A 1RJDA 5BW5A 2Z6UA 4RTQA 3PLAE 5FWDA 4R6XA 2KW5A 3TMAA 1X1BA 1SVUA 4RTPA 1RI4A 2ZZKA 3AJDA 3HEMA 2F8LA 3AY0A 1KPIA 5DXJA 3UJBA 4EK9A 5CCXA 3SSNA 1NV9A 2GPYA 3THSA 3UJ7A 3TQSA 5ICEA 4IWNA 5ICGA 4M38A 3DXXA 2VDVE 4BLUA 3R0QA 4F85A 3FYCA 3B5IA 1RI2A 1I1NA 3HNRA 3OZSA 1L3BA 2NXEA 3KQTA 3P9NA 5DM4A 2NXCA 3CJQA 2HWKA 3JWGA 3ELYA 1BOOA 2EJTA 4ATNA 1D2HA 3E8SA 2AOWA 3S68A 5EZSA 1DL5A 1KXZA 2PJDA 2CMHA 3BGDA 2PVCA 3GGDA 4LECA 3DLCA 4P7JA 3UJAA 3KQYA 3MTIA 3BWBA 4KDRA 1TW3A 2B78A 2VZ9A 2XVAA 3G88A 3OCJA 4P7FA 4QVKA 5CVDA 3GNLA 3M4XA 5E1MA 1IXKA 1QAOA 3ELUA 4H0NA 3LPMA 4ER5A 1IM8A 2IDJA 4IV0A 1KR5A 5E8RA 5FA8A 2A14A 1I9GA 3MHTA 3NVKI 1KYZA 3RW9A 1RJEA 4E70A 1R6AA 5FQNA 5G02A 7MHTA 1UFKA 3A27A 2H11A 3P9IA 4RTSA 3UJCA 5EMJA 3ID6C 3CVOA 2P7HA 3DH0A 1D2GA 2OYRA 1ORIA 3ANXA 3HVJA 4R05A 1G6Q1 2G1PA 3AXSA 4V0QA 2UYOA 3KU1A 3GRZA 1ZGAA 4R8SA 2IIPA 4C06A 1D2CA 9MHTA 4ER7A 1WXXA 3FRIA 1VP3A 2ZIEA 4L7VA 1PRYA 3EMDA 3SVZA 3FUXA 3KPWA 4Y2HA 2P8JA 2OKCA 2QRVB 1B42A 2N47A 1P1CA 1BKYA 4GOMD 3MTEA 1WS6A 1G55A 3KR0A 2ZLBA 3GU3A 2PBFA 1JQEA 4E30A 3LCVB 1XCLA 3JWHA 2UYQA 2YR0A 4RVFA 3NVMB 3SMQA 4YMHA 3DR5A 2YXDA 1N7JA 2JJQA 5P8WA 3FPFA 4ER3A 4MHTA 2ADMA 4LWOA 2QY6A 2WK1A 3WSTA 2BM8A 2PX8A 2P35A 3LDUA 2QRVA 3FTFA 4Y30A 4E2XA 3RODA 3LKDA 3FPGA 3EVFA 4C04A 1ZQ9A 1MHTA 3HCAA 5F2KA 5ICFA 5E1BA 3HTXA 3LBYA 2ESRA 3BGVA 4YV0A 1EG2A 5C0OE 3UFBA 3C3PA 2Z6AA 1R00A 1QZZA 4RV9A 4X61A 3C6MA 4AZTA 5LQAA 1BC5A 2DPMA 2AOVA 2ZULA 5FHQA 1FP2A 2P3QA 2WA1A 3BGIA 4EKGA 5KVAA 3LSTA 4RTRA 3M6VA 3HCFA 2PXCA 4X63A 1KIAA 3SSOA 4FSDA 2P3LA 3LDGA 5K0LA
chains in the Genus database with same CATH superfamily
3T3MB 5BRJA 1XMOC 2VV5A 1VI2A 4HXFB 2QYTA 4PZCA 1F0KA 1MH1A 3RR8A 1BMTA 2GV1A 2XE8A 3SQDA 3G71S 4AZ0A 2DGDA 1NJ6A 1OA1A 4KVGA 3VYVA 1EWTA 4O4IA 4K87A 3K5HA 4LREA 1IAQA 5D87A 3BEGB 1YI0A 1BWPA 3VPAA 3ZZPA 3X2SA 3R2JA 1BEEA 2GKSA 1RFGE 5C8DA 3QIVA 2X8WA 2JIOA 1HQUB 1NXOA 3SP1A 1JG2A 1Z6YA 2EJWA 2ASDA 4EP1A 2QZ4A 4MHOA 3PFBA 4DR7F 4FDFA 2CD9A 2HMAA 4IDKA 2CYBA 3EJMA 4QW8A 3LK6A 5LZ4A 5IBPA 1WDMA 3LL7A 5HBRA 3G82C 3EXHA 1L5VA 1NKTA 3I4PA 2ZM6J 4R2MA 4Y0AA 1I94C 2BGRA 1NMQA 4CI9A 3EPJA 1SBIA 3VAIA 2VDKB 3T4EA 2QLTA 5AI6A 3RABA 1OFUX 5KJEA 1C0UB 1KY4A 4C21A 1I2DA 1W26A 1E9VA 5K0BA 4F4WA 2UV8G 4G1QB 2QVYX 4A6DA 5AVXA 4G2TA 2PUTA 5L9NA 1C0KA 3CRW1 5KYUB 4ECTA 3E0XA 4RXMA 2GAFA 1NG9A 2E1AA 1I2ZA 1HTTA 4DR5J 3FAKA 2WJIA 1ZI6A 2GBLC 1PVDA 1N2EA 2C3MA 1P4HA 3H65A 2VQFF 1QGUA 5CDFA 1UOEA 2EF1A 3EN0A 2EFYA 4ZP1A 3QFCA 4C8NA 3NC4A 1FUEA 4MARA 4WNYA 4DG1B 1VPEA 2X76A 4PABA 4DLSA 3TQHA 4QQRA 2AXQA 5CA1F 2G82A 5CA1A 3S70A 1Y80A 1UWLA 4ARVA 1L5ZA 5JALA 1SY7A 2JI9A 4ZVUA 1PJLA 1Y4ZA 1U7XA 3PFEA 2VUHB 4UFNA 5CFMA 3B70A 5C37A 2CVHA 2VSOA 3EDMA 2XB2D 1H8EA 5CNJA 5LYJA 2VAXA 2HYIC 4UVHA 4MEAA 1K88A 4KE5A 4YV1A 4F5YA 3BMOA 5GIPE 4BXOB 2JBWA 2DNQA 3ENWA 3VAFA 1KZ6A 2O1SA 1XKLA 1YJBA 4HLDA 3SDSA 1J9EA 3GJQB 1FXLA 5A9RA 1UP4A 4QYIA 1CEEA 2P9ZA 1ZD3A 2H4YA 3PGJA 1KQSR 4R3WA 3UNXA 3WK5A 5DT9A 1NAHA 2OP0A 2OQVA 3L5OA 4B84A 4IH7A 4K5QA 2W71A 3FCEA 1EK5A 2OLJA 4FQ7A 5CH3A 3EG9B 3I42A 1Z4IA 3C70A 4MS3B 3LIIA 3SHFA 3ZCXA 2D2FA 3NP7A 2EL7A 2BELA 2H59A 5JY1A 2AI3A 4C0LA 3TL2A 2XUPA 4GC5A 1NVKA 2YHIB 1O96B 1NATA 4LIPD 1G7SA 2Y27A 3P9SA 4EGCB 3H9JA 4RQTA 2I7CA 3AOAA 3TOZA 3I72A 1U8CB 2DPIA 5I9NA 3WC4A 2HLUA 4BPRA 3UK2A 4J9UE 2JCYA 1XTVA 2FZCA 3OY2A 4TLBA 3G5MA 2EWHA 2GEDA 4MQFB 1YT5A 2Z9DA 1BDBA 2OE2A 1FFBA 4B3OB 3T38A 2GUGA 5C80A 4BAUA 2BZSA 4G0WA 5CITA 1O94C 4FIZA 5TVGA 1WSRA 3ZCUA 1MG0A 4LIWA 4QU6A 1HORA 1H4SA 3K3PA 1Y37A 4WERA 3H4VA 4S1NA 4ZZIA 2X0JA 3DDZX 1B14A 1ZNQO 3H18A 3K5PA 1CQZA 2CXRA 1Z5UA 2G5GX 4MW6A 4D46A 1DMRA 3AKDA 3TARA 1HD1A 3IQHX 3PYEA 4KV9A 1KQFA 2V63A 3Q6MA 3D2AA 4IZ6A 3SO4A 1F8XA 4BXOA 4CGYA 1NLKL 1BWRA 3UW1A 3TPCA 3FTFA 3D0QA 2C57A 2R87A 2N4DA 4F0JA 4RETA 3Q8PB 3CRQA 2YV4A 4DMUB 1WPGA 1W581 3HBFA 2DG2A 4L8WB 3MGJA 4TTAA 3HCWA 2QK4A 3NIGB 1NUQA 2QQ0A 4DC1A 5BSHA 5CA5A 4F4XA 4I08A 4YREA 2CL5A 4BLVA 2TSYB 1TXGA 1VGQA 4WLNA 3KLMX 2ECPA 3RB6A 1GP2A 5B6IA 2QMXA 3H1EA 4MLZA 2LP4Y 2CU6A 3SIPA 1ZW6A 2P9GA 3Q3JB 1SHKA 1DO0A 4RPCA 2BGIA 1PK8A 2I1VB 3QPBA 4KC5A 4I81A 4NK4A 4M5DB 1RVDA 1XB2A 3KS9A 3NW9A 2CJWA 1ZB9A 4LQ3A 3KLGB 1YJUA 3RVSA 3CW8X 5H82A 5I7UA 1RT6B 1U2PA 4ZEVA 1W0KA 3L6RA 4A9AA 3MELA 2FPSA 4X7MA 5JRJA 5EP1A 5ALYA 3EBOA 2Y1FA 4IIGA 2PNJA 1X60A 3K5MA 1EH5A 1N0UA 1H4VB 4Q02A 5IWAC 2E4YA 1M2OB 1OFVA 2VFVA 1PR2A 4E32A 4CTJA 1VXRA 2BRUA 4UVIA 1XZKA 2D69A 3GR0A 3HCOA 1ZLYA 2KLBA 2H63A 5BVGB 1IN1A 1XN1A 4HMPA 4QIHA 1A5TA 1JDJA 4MAFA 2P5SA 4H3KB 5BWLA 2N3OA 1GA1A 1JLRA 4B3IA 1YHYA 5EIHA 4CNZA 1AHPA 4C8LA 4JCCA 4W6QA 4M3NA 1CT9A 3E22B 3ZCPA 3HSSA 1PWXA 4U2KA 5KU1A 3E8XA 4C0SA 3MBIA 3W05A 4B0PA 3EPRA 5AOVA 3FYDA 1KSJA 3H2VE 1BA3A 4S04A 5FHRA 2ENUA 1IJKA 4F36A 1G8PA 3CJ5A 1WXWA 1E9FA 1VJCA 3HDVA 4I55A 2FLLA 3NRJA 1UPBA 4FS8A 1WG5A 1L4YA 1ZU4A 4W5QA 5DQHA 1SC9A 4CMBA 5ITWA 3IKVA 1ZMOA 2H3EB 1TK9A 4NHOA 2DNOA 1HI0P 1Y8AA 1DTSA 4DBLE 4DFJA 3QHAA 4JI7B 1AD2A 2IP4A 4CKBA 4TKLA 1MOPA 2R9VA 4UD2A 2YHSA 821PA 3AHJA 4JLPA 4KHMA 4MYTA 1KR2A 1YRAA 1UWKA 1NI4B 3COZA 1FUUA 1MFZA 2NSYA 5GJWC 5A02A 1HPLA 1MO2A 1USIA 3JQEA 2IV7A 5HJXA 3T7TA 4ZQCB 1M34E 3V8RA 1MB9A 2BRKA 4R84A 5D0GA 4O2RA 2DWUA 1SHJA 1EQMA 2KFYA 4C89A 4TM8A 1OYVA 1QTNB 3TUPA 3GJTB 2Z4SA 4NY1A 3W6ZA 2F8HA 4PV7A 3V80A 5EWFA 1D4FA 2NU7B 3AR7A 4XWTA 2N82B 1R64A 5ED4A 1PQWA 3A1FA 1UC9A 4KB5A 2QRUA 3DE3X 3S5UA 4IPTA 4IIJF 2QLBB 4HYTA 4BNYA 4DWIA 1AUPA 2R2SA 1K8QA 2B4UA 1QAJA 2WUWE 4C2MA 3C3XA 1U8FO 4MMXB 3RAGA 4MUYA 4PU0A 4F25A 2EJBA 4NLPA 4BIMA 2FR0A 1PBNA 4RTQA 2MJUA 3FUVA 2M52A 5AXBA 1MENA 4HTIA 1UBKS 1XT6A 3ZBQA 1BY9A 4GHWA 1LNZA 2ZIXA 1LD3A 3R1HA 1G6HA 1NVTA 3B1WA 1PFUA 2QN6A 4WCFC 1WHSB 1J42A 3F4LA 1UMDB 3E2EA 5J2UB 4YASA 2B8WA 4UPVA 2EJTA 1VQ7S 4ZAVA 3L8HA 5ER9A 1W76A 1Y82A 3SX4A 2JVRA 1DHTA 2XITA 1FFGA 5D4NA 3GNLA 4Y28C 2PL9A 5EJAA 3FM9A 4P86A 5AICA 3J81k 2FWPA 2UYYA 3TZEA 1U7OA 4FJ2A 3HYTA 1IIBA 4KN9S 5DTEA 2FMIA 3URMA 1H0SA 1S6UA 1M2JA 1PTJC 3MUOA 1Y4SA 4Y2HA 4JI7J 1LCIA 3FWZA 3ITDA 5J1PA 2KBEA 2WJ3A 5DLDA 3F5MA 4KFCA 4EW6A 2I0XA 4DHWA 1ZD5A 1SUBA 1KJNA 4K8OA 3FDIA 1E32A 1PCAA 1ZAVA 1SXJD 3QX3A 1CQNA 2HREA 1PC4A 4BQRA 3H2KA 1TU4A 3MD1A 3RVDA 4DVGA 1YA8A 3I1JA 3MW8A 4JLSA 4E6PA 4EYKA 3ERCA 5KREA 2ZOFA 3N0XA 4MV6A 1W2HA 4ZT3A 1GPKA 1IJEB 3HY4A 3KG1A 2AMYA 4Q9KA 5EMMA 4IX9A 1XZMA 3UF0A 4AY4A 3UKDA 2YJ3A 4N12A 4K4XA 5LU8A 4AJJA 1RTIA 3PWZA 5I8PA 4W99A 3DMTA 4HYEA 4DE5A 3JQBA 1HZJA 3SZLA 5HKKA 5KWJA 1IC6A 4BC7A 3OL8A 1KJWA 4HDOB 2ZOGA 4YH1A 1U2CA 2ERCA 3ZKWA 5FUQA 3N2KB 4IGAA 2VJAA 4DR1F 2HPHA 1XRCA 5IFIA 3C7TA 4JU9A 3JU3A 5DPMA 4OYWA 3SYLA 3SC2A 2PX2A 3K2EA 2O3UA 5MN4A 4EJSC 1YJ8A 3AB4B 1I33A 1RSCA 2F63A 5IC6A 3A58B 1NK4A 1RLOA 3GV8B 3KX2A 3OLWA 3WA7A 2JFVA 3SZOA 5AH0A 5DIFA 1Z0ZA 1W36D 2XWYA 3J7AC 5FTNA 1MTOA 2IYYA 1P1KA 3EC7A 2ZRJA 4ZT7A 2ZE2B 2RHLA 1L7DA 1EWVA 1PS0A 5MDHA 4OMUA 1Y5MA 1MX9A 3OZVA 3UHPA 3DR3A 2FMKA 4BATA 2ERYA 4HDMB 3PIIA 3LLSA 2FRVA 3CF2A 3HVKA 1B4SA 4INAA 2AD5A 2IXDA 5B3KA 3WAKA 1VGVA 1O3YA 2XO6A 3CRVA 2C7VA 4HPJB 4JB3A 3A9CA 3QOYA 5B36A 1CUSA 3DXYA 2FSIA 1N9GB 4DWVA 2ZKUA 3ZWKA 2XR1A 1QIGA 1IQZA 1OB5A 4CR6A 1VJGA 2ATCB 1P4RA 4U6SA 3DDNA 1ACMB 2P69A 4NCIA 1SOWA 4FYDA 3Q3IA 1QRSA 3OVMA 3OICA 4P7GA 3PXGA 2JAQA 3TA0A 1WC4A 3II6X 4A4JA 2I6SA 2GMJA 1L1RA 1TF5A 5KCZA 5CPBA 3O31A 2F4VF 3W5IA 1PJZA 4D42A 1UETA 4QUEA 4Z86A 3RFCA 4Q0BA 1DBDA 4JSTA 2P91A 3K30A 2QV6A 2BONA 1YTYA 1RRVA 3D1JA 2R7RA 1XVUA 2WIBA 3D68A 1FRKA 1C4XA 2JGAA 3W66A 4YYZA 3MQ2A 1SOAA 1FD2A 1XPJA 4QNMA 1U5CA 3S29A 3KUXA 2KM8B 1K5PA 2OPLB 1MTZA 5E5NA 5SZIA 1PW5A 2PJZA 5F8GA 4EYSA 1TL1B 4L4YA 1GXSA 5C4MA 3D0KA 1BS9A 1QUPA 3EGVA 5I5EA 4OLOA 4HEA6 1DWUA 3NGMA 1E3WA 1B7YB 2KVQE 4QVGA 2IW1A 5H9EK 4BTVA 4RX1A 1Z4UA 3BKXA 3CN7A 2W5UA 2YZ2A 4GXRA 4CYMA 3PZRA 4KJIA 1K8RA 4B73A 1N5YB 4C7QA 1TCUA 3VOTA 1QJCA 4QICA 1C50A 4G8JA 2O3JA 3PJRA 3LGMA 3O8BA 2JA1A 5GZ3A 4A6EA 2DEIA 1JEJA 4W8GA 5TQ0B 5HIIA 2FN4A 4LGVA 3DTTA 4QJBA 1X0XA 5AKYA 3VM6A 2Q27A 4WK2B 1RBQA 1R6TA 1QWSA 2AR7A 1T9VA 2HHPA 1V5FA 4PG7A 3BGOS 3N8NA 3SSNA 2HUPA 1M5KC 1K68A 2HIYA 4K9NA 3MD9A 2W6CX 2O3QA 3VYRB 2BW0A 2VT6A 1F4PA 4FFVA 2AOWA 4MDFA 3R75A 1XF9A 3A1DA 2ZRPA 1A2KC 4HDRB 4Z7QB 5DBEX 1UBCA 4YQZA 4FW8A 5EMJA 1OLSA 3IAUA 3GLKA 1TV6A 4OL8A 4PHFA 1KL7A 3X2FA 1ECGA 1L4EA 3FUXA 2FXIA 4F0MA 5ENDA 3CLVA 2OZLA 5JH7F 2JNJA 1A9OA 3UMGA 4N8OA 3SXUB 2VF4X 4BN0A 4UDXX 4J9MA 1ZQ9A 4A0SA 1T4DA 3V33A 2YBEA 4ED7A 2V7BA 3I34X 2CCKA 3EIHA 5UKDA 1Z6GA 2ZULA 4CDIA 3TF5A 2FSVC 1XBTA 2UVQA 5CGQB 2XGGA 2IYFA 1M7GA 2CJXB 1MXHA 1D9DA 3DOCA 4NEHB 1SHLA 4MYDA 3SJAA 2XZTA 3QE3A 1CC8A 2H5LA 5F8HA 3ZZNA 3LANA 4C76A 2NM0A 4L4RA 4CFZA 1PG3A 1F8UA 4REMA 3DOFA 3LWNA 4ZRMA 1JR6A 5FI1B 1E5VA 3DEIA 4M0PA 4IW3B 2H2HA 1RMTA 3G1TA 1AKEA 4DPOA 4ZU1X 1QJHA 3MMCA 1HBMA 2YV2A 1UKKA 3W6NA 4MIAA 4L6IA 3BF7A 1X8LA 4C4XA 1V8BA 2PGIA 2BTQA 1SCDA 2GFQA 2F67A 4DL5A 4YP3A 1ZAXA 3N2EA 2CXQA 4M98A 1J27A 3CUEF 3CVJA 4YONB 2W2MA 1J1UA 2C2DA 4R1TA 2XWXA 3S2GA 1RWPA 2G9OA 5JXIA 4JV5C 2G77B 1F0NA 2DWCA 1TM3E 1IBLC 5HMXA 3MWJA 2VPYB 3EVDA 2E85A 2ZUCA 2X3UA 1HDIA 4YBRA 2ZSUA 2AQ8A 5ALWA 2M8DB 3ZIDA 2LGJA 3BTVA 1J49A 2ZUDA 2QBYB 4ZT4A 4HS9A 3E1GA 3RV2A 2FJBB 2FSVA 1DO8A 1IUNA 2OV1A 4K3VA 1GGEA 2I5JA 2GCPA 5K0SA 1KMNA 3LTNC 4LF5B 2EQAA 4AJPA 5CQGA 5DN6D 4LHZA 4DV7B 2CZQA 3PR2B 4CEIB 2BJ7A 3ETOA 3WIBA 3L9ZA 3C1OA 2J4FA 3EVNA 2W2NA 1REQA 1Q81T 4D4LA 1ZGZA 3T34A 4NXMB 4HGYA 2DNMA 1TYDE 2JL9A 3M6FA 1H5QA 3FH0A 2JCSA 2WTXA 3ZHQA 1N33B 1VLLA 1T1RA 1JHQA 1PZHA 1L5OA 1VBXA 1RU3A 4DV6B 3E0QA 4PS0A 2BZ2A 2XS7A 2G1DA 1M75A 2ZYHA 4J9LA 3ZHYA 1U9YA 1WW3A 2MPUA 1VCTA 2VHGA 3R6TA 4DQLA 4Q2MA 1XZHA 3KQLA 4WXMA 1KHHA 3DRXA 2JWNA 1RM3A 4Y2GA 2ONKA 3V5RA 1JQKA 1CC7A 1A9ZA 2MR5A 1T8TA 5IF3A 3ZXYA 2XMUA 3N54B 5EOVA 3OR1B 2IYTA 4RV5A 2AQHA 2JFZA 2XC9A 2RMKA 3SHQA 2C5LA 3DMJB 2VIHA 4UUBA 4JOUA 2CJQA 5BR4A 5JECA 1HSOA 2R86A 4FT4A 5H16A 2QLLA 2NIPA 3AV3A 4QDTA 4KLRA 4M1WA 1T24A 2X3DA 2E7GA 5KG5A 4OI1A 5I4MA 2B94A 3JALB 4Q37A 5HX7A 1S9FA 1EG7A 3KSRA 1W94A 3Q0TA 2GARA 1LC3A 2O05A 3MI7X 3K0SA 2X1MA 3CHYA 1F7UA 1A9XB 2XOXA 2IEYA 2ARKA 5KTRA 1LX7A 1X39A 4BLWA 3EGXB 3ZXWA 2GVDA 3TSCA 3K17A 4IS3A 2O2JA 1GU1A 3HA5A 2D1TA 5DB4A 1QRDA 2NZ2A 3ZD9A 3PXGa 3UEBA 3DBHB 1WZCA 3HY3A 2EWVA 2X2PA 3BR8A 4M76B 3AVPA 2XUQA 4ASUD 4DUYF 1HH2P 3KPJA 4W5TA 3ZJVA 4YUWA 2ZTUA 1ZIDA 2O8FA 4GM1A 3ILVA 5K3SA 1QG4A 4BZZA 5E2AA 4QUKA 4BBYA 2H1RA 4W1PA 1FOEB 4OBEA 2LNDA 2KJQA 3QEMA 3X1ZA 2JK0A 3PDCA 1ZIYA 1WOPA 1B0PA 3NM5A 2XRMA 4KGKA 5K8CA 4F5DA 1X5PA 4OOEA 1AURA 1E1RA 1XNQJ 3KSZO 4FFBA 1U4OA 1SKMA 2VDMB 1CG2A 4CL2A 2PXHA 1OAAA 1ZJZA 1CR1A 1BDMA 1NYEA 5F4ZA 4IFBA 4WDQA 5BWMA 1KP6A 2Z2XA 3S28A 3ZEAA 3ZXUB 2X19A 3B7WA 2Y6UA 1T8WA 5JJKA 2IDMA 1Q1BA 4IBOA 3IIKA 2R7OA 5C5DA 3K53A 1UEJA 2VPIA 4ACAA 2ZYAA 3EH2A 3EEFA 1P2FA 4DUYB 5KC9A 2ZPUA 1P9WA 3KLIB 4I4LA 5FLXY 4C2UA 3AX6A 1D03A 3RS5A 3CPHA 4P2XA 3G2JA 3NPDA 3MMNA 4YYEA 2X8JB 1SXIA 2P77A 4QPJC 2P2FA 2CDAA 5T5QA 3A3NB 4L51A 4PUOB 1ES9A 4URXR 2M70A 1FP2A 1LS1A 1Z0FA 4TWAA 1KETA 5C5CA 4DCCA 4DIMA 4WFQA 2V4JA 3KKNA 2ZQZA 2PH5A 1T6XA 3AILA 1BWSA 1GKYA 4F3TA 4F3MA 1XEZA 2O3RA 3GE9A 3K94A 3LBNA 1ISPA 2P6PA 4O44A 1RC1A 2ACEA 2PVSA 2EAUA 1VA4A 2AS0A 4R40A 1YJVA 4PN7A 3ZKWB 2QYOA 5LOVF 3L18A 1QG6A 5KYUA 3TPFA 3W78A 2RQ4A 5IWAJ 4BKQA 2Z3ZA 3CLUD 3GRCA 1XERA 1EK1A 4XTTA 1P5ZB 3HSKA 1VKOA 1C1XA 4DXDA 2Y71A 1Q0TA 1WBJB 2MLYA 2X1LA 4TTQA 3QSYA 3I0RB 3FTEA 2HHHB 4X4TA 4I7FA 1U1OA 4Q7QA 2C2OA 1E0JA 2AN5A 1BEZA 4NI2B 2CHEA 4DI6A 2J76E 1ZY2A 1XA3A 3H4DA 1NDQA 4MUFA 3ZTPA 2QL6A 5A5EA 1A9YA 2OUIA 1PL8A 1RWWA 2Z8XA 5E3RA 4LMRA 3CT4A 1X9MA 4EF4A 4FGKA 1T3TA 4G6ZA 1VEHA 1TMJA 2GAGC 4Z1MA 3IIMA 2JHCA 4IL5A 4KRFA 3QZUA 3UWOA 1IAVA 3V1TC 2ZDGA 3HVUA 3KEQA 4DIUA 1V5WA 3M9NB 1MIHA 1WUHS 2QRZA 1K1QA 1G4CA 1DQSA 2HVEA 5EZ5A 3KDAA 2V59A 2HLDD 4P73A 1MRZA 3CMES 2PUVA 1JUDA 2W11A 4CTAB 2WIKA 3TMKA 4XGRA 4Q93A 4CLOB 3U4IA 1NB2A 1CS4C 3V1NA 1PBUA 1SZDA 3V42A 2R7KA 4GZLA 3OA2A 1DBPA 3DXBA 1K63A 1P91A 3G59A 2HLPA 4MKXA 4NBUA 3MJVA 3C3LA 4KMMA 2HYDA 4EDFA 2XW6A 2Q43A 3TZ6A 4QKQA 2E29A 2FSPA 2AN1A 4N3NA 2P9FA 4QTXA 1X4GA 9ATCB 4WJKB 2JGMA 3T7RA 2PUFA 1R8CA 1KVTA 1Q1GA 3PXCX 1WP4A 2FJAB 4K4WA 4DR7C 2GZMA 3S7TA 4RW6A 5JR3A 1HQ2A 1DFIA 2MYUA 1JYEA 5CM8B 3HA3A 4UNIA 1JJIA 1Y6RA 1JTVA 5DDPC 5ARDA 1T36B 4AJLA 3NFYA 4F1JA 1OH6A 5L3RA 2KFZA 2X22A 5I7WA 4X62J 2F9FA 5A8WB 4OJMX 1F38A 5EEHA 3NWPA 3PTAA 3GJ6A 2RDDA 1SM4A 4G6VB 1VQOS 1JJ2R 4LYJA 3ZDCA 3L49A 4FGZA 4RD2A 4TLLB 2WF5A 4LSLA 1Q7BA 3RVQA 3RSSA 4QEDA 3DEJA 1VFNA 4B7CA 4OKSA 2B7CA 5A5FA 3JYTB 3E05A 2YWRA 3I0NA 3LT0A 4XYGA 4CJXA 4IM7A 1JIQA 4D3GA 3MWKA 4ICLA 1NMYA 5H4HA 4BDSA 3SYMA 2X0FA 1HLPA 1Y5NB 4OYRA 4TXHA 1S2OA 2GNAA 4DA7A 1T3OA 1UPCA 3D6HA 4EI8A 4FYWB 1YIOA 2BSQA 1GDHA 1NBAA 3LAXA 2LCIA 5BOSA 4JAVC 1N5OX 2LCQA 4DEYA 4YHHJ 1JJCB 3WMGA 1UL1X 5CIYA 4HNSA 5HUHA 4G23A 3ZVKA 3C5CA 2XZWA 4ZPDA 4OAQA 3PJGA 3TIFA 4ZU6X 1YVUA 4URVR 3KAKA 4PBSA 4K7QA 3W8FA 2O8DB 1PWZA 3EDCA 1FS5A 4HWSA 5IT9Y 1KEWA 4C29A 3CJQA 3J80Y 4DCTA 4U00A 2KL8A 4QPZA 2XMTA 5F2OA 1QYIA 1CB0A 4BVFA 4RJ2A 3N6RA 5ABPA 5HROA 1XZQA 5HRAA 3QNWA 1SIWA 3KTAB 3DH0A 1UVIA 2IPMA 5EJFA 1C1YA 2FZGA 1D1TA 2JD2A 5HKBA 1S6OA 4LSNB 1XWIA 1Z63A 1MMLA 3KJVB 3AR2A 1WBDA 3F9IA 1CDDA 5CU7A 3GU3A 4O02B 4XM1A 4YMHA 5ANRB 2P35A 4YDRA 4TN5A 1FRQA 4RVCA 4BFWA 1EVLA 1S1WB 3R2CJ 1Q14A 3GRFA 1Q8BA 2YS7A 3RT1A 2WI8A 4WVFA 2VG6B 1K75A 2WDPA 4A6XA 4IRMA 2GS8A 3NC1C 2L17A 1TZJA 4LY3A 1VIDA 3O44A 1YASA 3NASA 4OJHA 2N3ZA 2ZK7A 1VRUA 2W6JD 4BQNA 1G8FA 1YSJA 4NV1A 3MCZA 1T1SA 2WW8A 3FMFA 3E9NA 2N3LA 2DR0A 1H6KX 5D7NA 4D8XA 4JBLA 2D7CA 3C3YA 1YI8A 2XVMA 1E0SA 4Q3DA 3G82A 1EIWA 1VJQA 1HHSA 3TLJA 1SJ4P 2NLWA 2DHRA 3SQNA 2RI6A 3WLRA 2E8FA 1SCQA 2KPOA 2MSEB 2W0SA 2Y9MB 4ZKEA 1U0LA 1TW2A 4KDCA 4M87A 4ARCA 3KYBA 4DBVO 1TMMA 4NPOA 4I1SA 4HUQB 5A04A 5JMNA 3BJEA 4EZ6A 1RTHB 3G8AA 2F4NA 3B1ZA 3PTWA 2RD5C 1RXEA 3T6KA 2HWIA 3ANTA 1NTOA 1M0SA 2RS8A 1WZUA 4M5JA 1FUKA 3HJUA 4IHQA 1JS1X 2WR8A 2LQ9A 1W49A 1GZSA 3T3IA 4D9IA 1P2SA 5IM5A 1JIUA 3O2SB 3IPYA 3GCWA 3US5A 4BFLA 3V8EA 1OPIA 3SCKE 2HRQA 4UE6A 4U7TB 3R7LA 4G9GA 2OIHA 5JSHA 1UANA 1X5OA 3OQNA 1T9TA 3EZXA 4UCWA 4KYTA 1PJ6A 4JUFA 1KH2A 4CO4A 5I51A 1TVKB 3BXEA 5AXKA 1DC5A 5CG2A 3FMBA 1XTBA 1ADCA 4URZR 1GLNA 2R2TA 2BQRA 2CDNA 4ZITA 2O7SA 4KDFA 1HNIB 2FDNA 3TVKA 2AXPA 4QIVA 3DGPB 3EVWA 3WYCA 5FBVB 3KQNA 2RSQA 2REBA 2MKJA 4YDHB 1GFIA 5K3FB 1CX9B 4C0OC 3JZIA 4TYQA 3UTDA 2WKPA 1WZNA 2H08A 3BQ9A 4C14A 1CHNA 1ETUA 3IEIA 3TPZA 4JLVA 1QOZA 2BISA 3SQWA 3RC8A 4B7ZA 3CC7S 2RFLA 1NDLA 1HKUA 3GZNA 2QW8A 4RJIA 4JIGA 5MN5A 3TUIC 3CA8A 2XCIA 1QZTA 4M36A 3NWBA 5EJMA 4P84A 1C9KA 2BIFA 1IMJA 3J81A 3PB3A 3LBFA 4G4IA 3AEXA 1PS9A 5DYGA 3YASA 2D13A 2XNDA 2YJNA 5TNXA 2ASVA 3ZCVA 1ECJA 3RQIA 5DF1A 4ONEA 4Y65A 4QFBA 2C7PA 1HW9A 3O3NB 4NR0A 4R98A 4CG0A 2D0IA 3H2GA 3FVVA 2YWKA 2JI4A 3GFXA 3PR1A 4GD3Q 2BRUC 4EKYA 5JD5A 1WU7A 2EFDB 1W85B 1F2DA 1VXOA 4EPRA 1PFGA 4YCLA 3L6BA 4QZVB 2MCFA 3DZ8A 4LFCB 2DTJA 1QQ7A 4D8UA 1NSTA 3QHPA 2C3PA 1RTDA 1E9BA 2QE7A 4DJEC 3K5WA 1RAAA 4X1IA 1YFZA 2C8LA 1UKUA 3O8NA 3Q5EA 2V5HG 1R3DA 3DU6A 1T3GA 3GUUA 1WC1A 2BH1X 1COZA 5LBTA 2FK7A 4RAQA 3C8MA 5BNWA 4UHKA 3BBCA 1XU7A 1FFCA 4C87A 2FF7A 1VC2A 4WOCA 4ZOLA 2GPJA 3S1TA 4B3RJ 4C97A 2WRZA 2ZZNA 1FEHA 2ILVA 3BBLA 1RI1A 1ZINA 4UTVA 2A7QA 1N33F 2C42A 1WPQA 2AEMA 2NYUA 3D0IE 2BYCA 4PRKA 4ANFA 1EXVA 1RYRA 4DNXA 1OWLA 1DCMA 4FYXA 1WWKA 1W2GA 1M0TA 5I9TA 3H4BA 5IWAF 1IXRC 4P74A 5TMEA 4ZHSA 2VOPA 4E5DA 1X4FA 1XHEA 5ALJA 3NOCA 2XYGB 4ZZ1A 1XMSA 4YGXB 2AX4A 4IDBA 3FSIA 1GDDA 1KF0A 3N9IA 4E70A 4TMFA 4W92B 1R0CB 3ROZA 1TYAE 4ENRA 1B0VA 1ZGAA 1T2UA 3UAVA 1ZHOA 1V96A 2R42A 1EMDA 1ZH8A 2AFHA 1E1CB 4YRNA 1JQEA 3K1JA 1N7JA 4RW0A 2JRSA 3D6FB 2FQQB 3GG9A 3L7IA 3NEJA 1LWNA 5FXMA 1WZEA 2KJVA 1Z88A 1BLUA 2YKMB 3B9QA 3ZJYA 4KLAA 2RCNA 5EDWA 3LDGA 2C8VA 2NZWA 1J0CA 2F4VB 4KNYA 1EDOA 5TY0A 1TVRA 5B12A 4V1CA 4KO0B 2GVZB 4XYMA 5LSLA 1RZUA 3K5NA 1XMJA 1H2WA 5KG1A 3C66A 2DHAA 2ECKA 5EWLB 3P45B 1TM5E 1K8ZB 5LL6d 2FLVA 2BFDB 1TE2A 1Z5OA 3ZQJA 5FORA 1DXQA 1SVNA 2OOKA 3I3SR 3EC2A 4WGFA 3LKZA 2ET6A 3AR3A 1VJTA 3GVIA 1JLQB 4B17A 2GPTA 4AQDA 1GL3A 3ZDBA 4AP5A 1IQ0A 1GILA 2IHZA 1WJ9A 1ZITA 3H3JA 2RH9B 2W8LA 2WVAA 1XCBA 3UEOA 4GAEA 3ZXIA 1WEHA 2XYHB 1MAVA 3OWHA 1R31A 1Z33A 3GZTB 1D1QA 1ODSA 3RFTA 4FMDB 3DV9A 3AVYA 1KE2A 3CQ9A 1TNDA 3T9EA 2XAUA 3WK6A 3WLNA 4ZP8A 4CRWB 1NBWB 2DHGA 4DX8H 3RW6A 3EIQA 1OS5A 5EP4A 1TQ6A 1JPJA 1NJYA 1B8OA 2MKCA 5A2QA 4BUJA 4F9EA 3GV5B 3BO2A 3RE1A 1R8BA 4IINA 1Q84A 1Q8IA 4NABA 4UZEA 5EWJA 1JLCA 4JENA 4DR6B 4GYJA 3GJSA 3TW8A 3IR6A 3EEQA 1CY8A 3H16A 1V35A 4KV8A 4YVFA 3R3WA 2XI4A 1XTKA 2ZAMA 3G6VA 1O9HA 4D56A 4QR1A 2P6UA 1QO7A 5F3TA 3D54D 2BZGA 3IAFA 1R5BA 3PEYA 2FZEA 3NGLA 1WQ4A 2B34A 2B82A 3KJFB 1UMCB 3A32A 1Z4KA 4XD7A 4MITA 2GPSA 2WF9A 4BNWA 4E31A 4KQIA 1RGVA 2ZIVB 4F2HA 2XTAA 3U4MA 3VSEA 5K03A 3ZK9A 3B6EA 1M3SA 2H5EA 3QY9A 1CEYA 3GRUA 2BAGA 3JASB 3TM5A 1L3CA 3VR2A 2NWQA 4A5SA 5TPZA 1C14A 3L0SA 2P5YA 5EHGA 1K86A 5U9CA 2PV7A 1H6AA 2P75A 1ZOOA 4K9MA 3WWOA 2FVYA 3KQVA 5AVOA 2A2ZA 4CIVA 1O8CA 3ZGOA 3HB5X 4KIGA 3FMIA 2FJPA 1UMJA 4ZAWA 2MDTA 4POOA 3X1WA 1T05B 2EP8A 3BSFA 2NACA 1PNQA 3FR7A 1CW2B 1CV2A 2Q3FA 2JH8A 1IY9A 1IWAA 2BRLA 3QLEA 1KKMA 5KTPA 2FH5B 2W2LA 3NNHA 2GD0A 2R97A 3NATA 2GXUA 3O9VA 4ZKAA 4JHLA 1ZUNB 2RK3A 3O2IA 2WD7B 3WMWA 3CLTC 5AYVA 3SX2A 3VBCA 2B35A 1XI2A 4LTMA 4WTYA 4GM0A 2QJWA 5L4SA 1LVUA 1K3UB 3NAQA 1J23A 5K5MA 4G0QA 1OB2A 1ETHA 4LXGA 1NVXQ 4KV7A 4EQ6A 2WT4A 2O8CB 3EEOA 1CVIA 4JEUA 2BY4A 4AZ3A 4ZDKA 1W19A 3I01M 2CNNA 1NNLA 4L50A 4FP9A 2GJIA 1GUZA 4LF9B 3BMNB 3X1JA 3GLHB 2GCOA 4JYAC 1UWBA 1RTKA 3IB3A 4AKTA 1KQNA 4UNQA 3EMTA 3LUFA 2Y1CA 5GOTA 4MFBA 2NUBA 4RKQA 1VLAA 1YRXA 1Y9EA 4JI6B 3SLKA 4JI3C 2J9GA 5CT8A 5DSTA 3JRXA 1M2EA 2QMQA 5KWSA 4TV8A 3PACA 2PNFA 4UQGA 1WKJA 4NRUA 4DA0A 3AHCA 5K3CA 1WF3A 3UB4A 1EHIA 2GJ4A 4BLRA 4GUAA 5FOWA 2MSLA 3QUAA 3GVXA 2BOVA 1E6VA 1EI9A 5ED0A 3DM2B 4ETMA 4CUZA 4ZPAA 3T7EA 2ZD1B 3VR4D 4F85A 1BN6A 3RAMA 3LP5A 3MG9A 4B2LA 5IT4A 4AI6A 4EGAA 1E79D 4B5LA 4DM7A 3S8MA 4EMUA 1BTOA 1IM8A 3UK1A 1AQ6A 5LP1A 4ZOCA 4LRTB 1DIOB 1IBMF 3NVKI 2RF2B 4U2CA 1IJFB 1GQEA 5J5CA 4MUAA 3PV8A 2JFNA 2EKDA 1Z0UA 5AKJA 3U9TA 1ESDA 1SBZA 3QKSA 2GT1A 1S9DA 1Y5RA 2BFFA 5A71A 2C00A 3UVJA 3U4HA 1MWZA 5DRKA 1N6KA 2F17A 3J81Y 5KOHB 1QUVA 5G4DA 3RYHB 1UWBB 3M8PB 2YXDA 2JJQA 4DLXA 4MXDA 4P71A 3FOZA 2XMWA 5C1OA 4WU2A 1AVTA 3TAMA 2OD9A 4R2XA 2AKAB 2Q3BA 4ZVKA 4RY2A 4G9EA 4JI7F 4EPXA 2R65A 3IDFA 1M1YE 4PC2A 2UVPA 3DBVO 2NYHA 5D5QA 3WAGA 1BNCA 4IDPA 1H3FA 3OQPA 3E3MA 3KLVA 3EGEA 5J4LA 2QXYA 3ZGNA 4YACA 5C5IA 4IJQA 1SKAA 5GJCA 3AVVA 4RH1A 1ZP6A 1SIUA 2FQXA 4U2EA 5CX4A 3BXOA 2ZYWX 5BV8A 2ZH7A 3OOSA 2G76A 2DXIA 5DETA 1ZVVA 4OJGA 3J7A1 3C6ZA 3F97A 5AW2A 1SXLA 4IKAA 4BP3A 4D6PA 1EVQA 4C5AA 1FP4A 2PT7G 2MQLA 4PSVA 3ABZA 2P02A 1E2UA 2V7UA 1A8PA 3OZIA 4JI4F 1IBCA 1CY2A 1XV5A 4AQYB 3RAXA 2QTTA 5G0RA 1LZLA 3DBRB 4PZVA 2OBVA 1M2NA 3L7MA 5RUBA 4AC9A 2V96A 3QVVA 1S0OA 2FJ0A 2DHMA 5IN5A 1QYWA 5CB4A 1DXHA 1GXSB 4XCXA 3HMJG 3L0CA 3U4QA 5CRIA 3QU5A 4EGFA 3Q24A 3O0TA 3F7TA 1AMOA 5CM9C 3S6JA 5HI7A 5C24B 1RE1B 3LPEA 3NIBA 1QKIA 4R8KA 3F67A 4Y1RA 4N54A 4HHEA 2IP1A 5AW0A 3L82B 4CT9A 1PGOA 1U9JA 4PZDA 4F7VA 5BUCA 4QPPA 4ZRDA 3HN7A 2YY6A 1MA0A 4QTTB 4DSNA 1B1CA 2EKLA 3ZWXA 2Z1MA 5HF9A 3IIEA 3FBGA 4PYRA 3DEKA 3IP0A 3NHAA 5HJYA 5LCIA 1LEHA 4TYNA 2NU7A 3K15A 3SS8A 3F7NA 1NY6A 2C61A 1K0UA 4YX9A 2LVWA 2OGWA 4O4JA 3K5OA 1U1DA 3PVCA 4F11A 4IGEA 1LWOA 2YNIA 2QL9A 5ELXA 2IZ7A 3FCOA 4FXDA 5K45A 4XKJA 2Z9BA 2GFIA 4AY5A 3U3MA 3EPIA 3CDAA 1UDAA 1QF6A 5BUSA 2PZBA 2BJDA 2ZRIA 3PUXA 3D4BA 3W4JA 2FFBA 3EDQA 5HZMA 1T9DA 3KTFA 3IMCA 4FNAA 4IZOA 1NCLA 3AI7A 3SGLA 1G9XA 2H4FA 4DWWA 3IUQA 3JTEA 1V5VA 2RU3A 3CJ2A 3B89A 2EEYA 2J3MA 3ACBA 1JLQA 3ZOKA 3SSMA 2PGOA 3QITA 2H85A 3AG5A 3NG1A 1YS9A 2FHOB 3B3GA 2ONYA 1WC6A 2WY2D 1HBNB 4Y6OA 3KALA 3K2YA 3LC2O 4JSRA 2EW8A 2P2NA 5BVHA 5CD4A 2PMHA 2ZRBA 2HWHA 2W8KA 5DI3A 3FNIA 1LTHR 2DCLA 1AK9A 2DHHA 3V2HA 4LHXA 2NYIA 5GQSA 1XU4A 1RPZA 3STVA 3HPRA 2PXXA 4RFSA 5FDFA 3VHXB 1DS6A 3HR4A 3N2NA 3N58A 3V4OA 1R27B 1S7CA 3HVHA 2I38A 1BN7A 2ZYIA 4FLEA 2LU1A 2HNZA 3QPIA 5JISA 4AULA 1U2GA 3BJMA 1KAHA 2PL1A 3AP3A 2HRZA 2QX6A 2EPIA 4ITRC 3F1LA 4MVJH 4KMRA 4IVPA 4V0NA 1LUAA 1TJNA 3D28A 1RYBA 3I87A 3M1VA 1ESZA 1G5PA 3OJEA 3USCS 1L8AA 2Q6TA 1RAJA 3HPQA 4H59A 3TE6A 1WE2A 2YYSA 2DH5A 3G68A 3ZHCA 5SICE 2P6NA 2DUMA 4EZIA 2VQDA 5ICGA 5E0KB 4N7BA 4DM4A 5FO1A 5GMKa 2X9NA 1BOOA 3OQJA 4QWBA 3FQLA 1DEKA 2PUJA 3U0BA 3NH9A 4V0LA 5IBQA 1QNLA 4UJ3A 1OD6A 3N6XA 4PZAA 3FNRA 3FMOB 4HNTA 4GX5A 1KSHA 3AXSA 5ESXA 4J4TA 4UBLA 1TMKA 3G8YA 1NQ5A 2JI6A 1OX4A 2Q0XA 3JQJA 1DEOA 2QI9C 4D9JA 1JWAB 3NRBA 3D6JA 1JU3A 4B3TB 2YNHA 3K7RA 4ANEA 3EDYA 3E3LA 1C0EA 4OHOA 3D0GE 2A94A 3PFIA 1QWOA 4F4IA 3C6MA 1TCAA 2YRXA 1XAGA 3QEBZ 4JB2A 2GBFA 4Z4CA 1KHVA 4GWLA 1T9YA 1NM5C 1U6JA 2NO1A 2ALJA 2O0KA 1PK9A 2PZMA 1OW3B 3KZKA 3MCWA 1M5OC 4OP3A 5TT0A 3PCOB 3U56A 5CNMA 1D1SA 1YIAA 5E95A 1HQEA 3BYRA 2XWBF 2VPXB 4PCUA 3LALA 4CV2A 1C3OB 2IEAA 1PEYA 3QVLA 1U4BA 1AV6A 4RW8A 4NP6A 4ZVMA 4HCJA 2YXLA 4OX9C 3JATB 2IJNA 3CJKA 3I92A 2PKWA 3AT1A 1FO1A 3C3KA 3SM3A 4G8BA 2HU8A 5IOLA 3Q2IA 1RT3B 4WCVA 5DI3B 5H1SV 5CAEA 3RD5A 1YVDA 2W8BA 4NF2A 4NJEA 5B55A 4ECRA 3DZDA 3UQYS 3OZCA 3LE8A 4HYYA 4DEZA 3G0CA 2IBTA 3RWOA 3ZQUA 5E2BA 1MQSA 4Y9TA 5EN1A 3SKXA 1Y9AA 3LWLA 4MR8B 2Z04A 1LLCA 4DCJB 3A1EA 1AROP 4OGGA 4C7MA 1RYHA 2HQOA 3R3UA 5JSUA 1SV5B 1CVRA 1GLVA 1XNJA 1TL7B 3TRDA 5GPBA 2BR5A 2OGUA 4WFIA 3G0IA 4BEVA 3G5TA 3WMXA 4RD1A 1GUBA 3CTMA 3NTOA 3D2BA 4BLQA 4JY7A 3U60B 3T3EA 1PJAA 5E4FA 2MSDB 4NBKA 3HU2A 4TV9B 1OHHA 4QASA 1LI4A 2C7BA 5IDXA 2ATEA 4Z8XA 2F8SA 2V7XA 5DX1A 5A1IA 2SECE 2DHQA 3A06A 1KA9H 1JFFB 5CD4H 3D1QA 4Q7KA 5AM2A 3DMHA 2I6FA 3H1FA 1WELA 4NYIQ 1H1LA 1VQLS 4TMZA 3D6VA 4U0KA 2GNKA 2NSDA 1XL1A 1UFLA 1EJBA 1P2BA 2H29A 3JWJA 1NR7A 3OV7A 5CFLA 2A1UB 2P2CB 4COOA 3BFVA 5AI4A 2M98A 3GLFB 3TW6A 1CYEA 4TY8B 4CKYA 3CPSA 1MJ5A 4D4JA 1LH0A 1G0OA 5JRHA 5DNVA 1S4MA 3DHEA 5JD6A 4WLUA 3TCNA 1A2QA 5EJ7A 1ZNWA 2WSIA 3SICE 3HVTA 1NF2A 3NDIA 4KQKA 1YRLA 2R6ZA 3BEDA 4TLAA 1CVLA 2NTYC 2NQ8A 4NX2A 3RSFA 3K4QA 2FZVA 2EOAA 3HUFA 2Z4PA 1J21A 4H35A 1FP4B 3EXYA 2Q4BA 5F5NA 1JQAA 5K99A 4EM6A 2C4UA 4RHFA 1ATZA 1FDUA 4FLFA 1VRUB 1ZS9A 3VGVA 4J43A 3CW2C 2J6TA 3TTXA 1WMBA 3QKWA 1G1AA 5LUBA 3WLKX 1N7IA 2MHNA 3JRWA 3KUCA 1JU4A 2VUTA 4PZ9A 4OG2A 2Z08A 1E2KA 2VG6A 2FEMA 6ADHA 4N0EA 1XCOA 1TD1A 1H69A 2AZ1A 3I76A 3AEQA 4CCSA 3ONWA 3IQEA 5HNKA 3C15A 1A1SA 1Y4AE 5C8XA 3H99A 4I7EA 4BGIA 3GDOA 4HAZA 1LPSA 3DLLQ 3BFPA 2FFQA 2ACWA 4LI0A 2C4MA 4H7EA 2FUNB 3OU6A 4EA7A 2YIDA 2FMUA 3OSPA 4H16A 2VFRA 1TYBE 5DYWA 3IAXA 2FB0A 3I96A 2X7XA 1OH8A 2AC7A 3TQIA 3MINB 4H7HA 5HS6A 4ZMBA 2FP4B 2C2NA 2JCGA 1RI2A 4D0SA 3W90A 4G85A 1BKDR 3NHPA 2XGPA 5FUYA 4TV9A 3IHWA 4QJVA 1JZTA 2HZCA 2J46A 1VMBA 1DAHA 3CE9A 4EJFA 2AYGA 4CM7A 4RTSA 1JWWA 4ZHQF 2HCRA 2WE8A 3JAMY 2VO1A 5KNDH 3TQTA 1UQTA 4NOZA 3KKFA 1GTEA 1GL9B 1EP1B 2GAIA 3D0RA 5TJHA 3IAS1 4DILA 1W48A 2OILA 4MH4A 3FPFA 4WZZA 3NAZA 2H9YA 3ANNA 4Y30A 4J3JA 1J0EA 4S2EA 1NUTA 3FCYA 3P0HA 3K0JA 2C9OA 1CZRA 1Q1NA 2X0RA 3QMQA 3MRXA 1S1CA 4BKUA 1PILA 3N05A 2IYUA 1FJGJ 4GLJA 1I2BA 3O1IC 1R4MA 1IN5A 2HRBA 1R6UA 1NBOA 3LT4A 1R0LA 5K14B 3MC1A 1C30A 1ODLA 4NE2A 3FD8A 1OPXA 1CJUB 3ADOA 5EVJA 3T1YB 1SMKA 4N0MA 3U44B 1NP3A 2R7AA 3C39A 1XLTC 5FFNA 2QQ5A 4AL7A 3HKEA 1OYDA 3PX4A 2AA3A 3GEHA 4BEJA 4AURA 4Q4JA 1KHWA 2P9BA 3FPHA 1KU6A 3MM8B 5LZ8A 2I8EA 3DLGB 3COJA 1C9MA 1N4LA 3OF3A 2YZ7A 3UPFA 2CKDA 3OIWA 4H1VA 4C7KA 3UPTA 4I6EA 1W4BA 4LHWA 3OZAA 3JSRA 2JSXA 4U2GA 4OQPA 3BPDA 3ZOZA 2RIJA 2FUCA 4B7AA 2OO3A 3UKOA 1KSGA 1XQVA 2R84A 4RH0A 1TOAA 5ADUS 1EK0A 1HR0B 1BJKA 2O2DA 1YZYA 4DL7A 1M66A 3VNVA 4I6YA 5AJZA 3RGWS 3WLEA 3PQ6A 1WOMA 3I8XA 1ZBDA 4W90B 3HV0A 2BR3A 2V4UA 4BB5A 5D0HA 3QHQA 4R7TA 3N6LA 1ZXXA 1GCGA 1R37A 1VBZA 4E5VA 3W2VA 3M33A 3KQWA 5BXYA 1DDOA 4OF4A 5KT5A 4CWAA 4GKBA 5A8KA 1HWJA 7FDRA 3I2KA 4WESA 3TG2A 4EA9A 2ID7A 4L3KA 3N0VA 4MKHA 4OGWA 3G2QA 2ODQA 3Q3GE 2WAQD 2HHQA 1GTRA 3EF1A 2WHRA 2BGGA 1F8GA 1LBTA 2I7TA 3C74A 1U90A 5B3AA 3BICA 2XB2A 1NOIA 1QTRA 5T8KA 3QUQA 3VH2A 2E49A 4PC6A 4LBPA 3B8EA 3A10A 2GX8A 1WXFA 1EHWA 3H86A 3PRDA 1UQRA 1Z5WA 1YZTA 2PLNA 3R0IA 1KMQA 1QBKC 8ABPA 2Z1NA 2ZTVA 4NCJA 2PYIA 2JCBA 3TKYA 3KB2A 4NOMA 2DTDA 3HK2A 4ML3A 5I7OA 3OL6A 4Z9YA 1E7YA 3PENA 2UUCC 1T0BA 1ENPA 4HZUB 3KD2A 3S44A 1NJ1A 2HOQA 5I6DA 4F8JA 1Z2ZA 5CYQA 4PLHA 4ED0A 1NKCA 3RC1A 1SBCA 1QZXA 1Z39A 3KJQA 1KI9A 2RJ3A 1Y3DE 3B8HA 1S7GA 4H2DA 3OPYI 4LVNP 3QEOA 4KYIB 2C4KA 4DDUA 2XO7A 5AHRA 4N6GA 2O1EA 4P9SA 1RWMB 1BJTA 5FKJA 3KHLA 5L4LA 2GS9A 4ZEOA 3LTEA 3JSMA 4JELA 1TVCA 1O95A 4GECA 1NW4A 2IV3A 3IP3A 5EESA 3IP5A 2G4BA 4QUJA 2AG5A 3KYCA 2V68A 3LCUA 3M8WA 3NXZA 1N0WA 3AVOA 4Y98A 2F1FA 1C80A 5JO9A 3F3YA 2AB0A 1P2TA 4DVJA 1CE8A 3GR1A 2XUDA 3ZE6A 1HEIA 2B2NA 2WJ6A 5I8ZA 4D9GA 1N36C 4FXOA 2AYAA 4I8XA 4MI9A 4Q6BA 1KOGA 1XTQA 4JUBA 2VG8A 1PN3A 3PQFA 1X7HA 2UZ1A 5AR1A 2ZRAA 3DE7X 5DLQC 4R7GA 4RY0A 2HEGA 4U96A 1CC1S 3FDJA 5FV4A 2ATWA 3W2HA 4XCVA 1F1JA 3HFKA 3WGGA 4NBRA 4FW9A 2E4AA 1JJVA 2YS6A 2GJ8A 2O48X 3H40A 4WBSA 1SIBE 5CCEA 2GCNA 2A1BA 4LMPA 3H97A 3UV7A 3UJBA 1R0WA 3LH2S 2GPAA 5J3JA 3T3GA 1EIYB 4NS4A 4X94A 1M9NA 4DR4C 3KB8A 3ORSA 1OJLA 3LUSA 5IG2A 4HLUC 1S9EA 5HG0A 1KZYC 4U3JB 2IRWA 1GMWA 1KR5A 4D3SA 4D2IA 2PHZA 1UFKA 1GSIA 3ZIAA 2BJ8A 5BYKA 2CXUA 1S8FA 2OXRA 1RWQA 5BMVB 3NUQA 4C4SA 3N0TA 2IIQA 3RVJA 2QW0X 3ZWBA 1RZRA 3HGQA 1WUTA 4WA7A 4WECA 4QWAA 1BRMA 1RHKA 1CQPA 4AN0A 5L3SA 2I2FA 3WJ7A 4QUAA 1YBHA 4FNHA 2JLGA 1YZQA 1D4AA 1Z5GA 4KL8S 4N9QA 3DZKA 4UHJA 4LAFA 1DIBA 5LMUJ 1FDVA 4PN3A 2Q1XA 4JV5F 2EJCA 4HR2A 1KFSA 2BKNA 3KZNA 4B85A 2XAAA 1DWQA 2MM9A 4NDNA 3WLIA 1RE0A 4J9SA 4DN9A 4IIEA 4BE7B 1W93A 4ZYLA 1GL6A 2XRYA 3HSZA 3HN6A 2XNQA 1KDVA 1NP7A 5DU2A 1F2UB 2FB9A 1N32B 3RSCA 4X65C 2IC5A 3SS9X 1XPOA 1FLNA 5CUQA 2QZPA 4WKYA 1H8ED 2E8CA 3ROQA 1Y9OA 3VV3A 3NFRA 5BMOA 1Y1KE 3LCRA 4W5HA 3ZZ0A 2GO9A 4ZVQB 4FYKA 4XPZA 4LJRA 2IE8A 3SYKA 2QM8A 1TAGA 2JVIA 1DXYA 1WC5A 3URKA 2VYVA 4RKFA 1BXKA 4PQRA 3WWPA 3KWLA 4M22A 5KT7A 2ZYVX 1SPBS 8OHMA 4BP8A 1C8VB 1A5SB 2VJBA 3ESXA 4HNAA 2GQ0A 1CG6A 1PFVA 3DNCA 3P2OA 3SLRA 1TU0B 3N7UA 2H18A 1OAOC 2HXYA 4MGKR 3LRPA 1TJ4A 1IHXA 1DEAA 3ZNOA 4BX8A 3M5DA 3H5WA 2ZSDA 4CMEC 3AR4A 4QTYA 2AQKA 4MRMB 3OLQA 1TZCA 3OOEA 4X6YA 4P2FA 2W2MP 1RHRA 1RXIA 1FP6A 4E98A 2XD4A 5K0EA 4DR3B 2EIXA 3NJRA 3IWNC 1CJKB 1VIOA 1OGYA 3KYJB 3AZOA 2C2GA 3ZS9A 2A6MA 4OV6B 1Z15A 4NMWA 2BJVA 5COBA 4ZGBA 1ZH5A 1Q3TA 1QH1B 2HMYB 2HS3A 1M10A 3VZQA 1UXKA 3JD2A 4AZWA 2YY3A 3C8YA 5KTSA 3C48A 3HFGA 1GKLA 1AZSB 2G28A 4XW2A 1N2ZA 2HSEB 3BWVA 3KD3A 2MKIA 2QTVA 2EHDA 3FGPA 4I9FA 2H5JB 5J2UA 5KOJB 4UMEA 1UWVA 1YRUA 1Z68A 3D7LA 2MSNA 2WQ6A 5A03A 1YTUA 4ISCA 1XDGA 2EW1A 3GTYX 3WYGA 1AXEA 5CURA 5KKCA 2PX0A 1QTMA 2WUFA 3AZPA 3QELB 5AUQA 5BMVA 4DQKA 3THWA 3CKLA 1DKLA 5B7PA 1V9SA 4CM4A 5HCNA 1I9CA 2AOUB 5AXMA 3WLJA 1IM2A 1PWHA 5JMTA 1B64A 4QAQA 4EJMA 2VTBA 3K71B 1KVSA 4E0BA 3AFOA 1UM9B 1YZ6A 3T4PA 1WA5A 1AA6A 3RO7A 1XRPA 2ZWMA 2DY0A 4TQAA 2EWWA 5F3ZA 5M29A 2BC9A 2BPOA 3P4XA 4ENVA 1A8IA 2R4FA 4PLVA 2FPGA 3EXEA 3DMYA 1AKTA 4GOXA 3WC0A 1I94B 3WWEA 2OTLS 4GOND 4R6WA 2F7SA 3KVVA 4LCJA 4LOJA 2XECA 1Q86T 5DKFA 3C3BA 3HP4A 2DFVA 5DSXA 3I73A 4ND7A 2JH9A 3UMYA 1U8UA 3MM9B 2ZUFA 4RPKA 1C3JA 3T5AA 1V5IA 2PC6A 1P0MA 2COEA 1IKVB 1JI0A 4MI1A 1EGHA 3A9UA 1W25A 2XZLA 4JUCA 4MIBA 5J5AA 1X1QA 4X3CA 3THXB 4NMXA 1A77A 4Q45A 1WH9A 4LXQA 2VSNA 3JYLA 3R7BA 1EJ0A 4IKOA 1AA1B 4M1KA 1QYDA 2VYFA 4E3ZA 5TGZA 5FH9A 1KGSA 2UU9J 2Y0EA 2XGJA 2RKIA 1CY1A 4ZODA 2R7UA 1NK7A 2OBYA 4X1OA 3A3PB 1BFUA 4DMHA 5IRCD 1E89A 3M8SA 3FI0A 1NVGA 2H0QA 1D8TA 5GM1A 3H42A 4ROSA 5HJ2A 5C7PA 3B85A 3Q15C 4M7WA 3PI7A 4MZXA 1OR8A 2BM9A 5CX1A 5JU6A 3I55S 2IVZA 4DRXB 5TEVA 4N82A 2C2KB 3WY9A 4KR9A 1C0UA 3CEAA 4PFJA 3EQ2A 3AB8A 4ZP9A 2KG1A 1VJWA 4DV6F 4QD3A 4BB0A 2R2AA 1PWYE 3EQZA 1FJGC 1JKIA 1I94J 4LDRA 1QAOA 2FDXA 4XVRA 1NUEA 3ONEA 3QZ7A 3RC3A 3MSXA 1CNFA 4L0MA 5H68A 2J30A 1QVRA 1X3LA 4DCOB 4YY3F 3ZWPA 5IYZF 1II9A 1NWHA 3DCYA 1B42A 3Q5DA 4Y00A 4GGOA 3S7RA 3TQ1A 2PBFA 4D8VA 4RVFA 5P8WA 1DXOA 2Q6LA 3O5AA 2V58A 2GZOA 3WL3A 4MEBA 5ALHA 3EX7C 1P2UA 3H9BA 4MP6A 1HE5A 1RKUA 1MNEA 4HBGA 3KB1A 2JEOA 3NBPA 2WPDD 1HNXJ 4O4GB 2RH5A 1UBEA 3BEOA 3ROFA 1JEEA 4BNJA 4PQYA 2LWIA 4RE6A 2FJXA 4MO2A 4RBUA 1NLYA 2CXXA 4XARA 5FBRB 4O3QA 4DSTA 4IVNA 2MKKA 4BDTA 1FLVA 1RRPA 4L8YA 1U6FA 2DOKA 4DSOA 4KYZA 1KRPA 3SJZA 4LCBA 2H4WA 1XMOJ 3R8FA 3G0DA 2EG2A 2BFWA 2RGAA 3A1SA 3T7KA 3B51X 2NZXA 4CMEA 4AW9A 2XZDB 2BANA 2BFCA 3WWDA 1ZHFA 4Y2PA 2Z30A 2PYDA 4G1FA 3SG0A 1WVGA 3IESA 2VUUA 1Z4MA 2DD8S 1S1XA 4MHSA 2ZIGA 3WDSA 3J81U 2Y9PB 2CXSA 3OWXA 3H84A 2WV7A 5AKLA 2MZJA 4JBCA 1RABA 4JZKA 1RQNA 2VHCA 4GMXA 4ZI2A 4FS1A 3VPXA 1BCSA 1ORVA 2AMLA 4K9RA 2MKYA 4A47A 1QG2A 4JNKA 5ALUA 3HHKA 4K1XA 4JP1A 1QP7A 4A1FA 3OR2A 1KY5A 5ILOA 4KMSA 2FRXA 1RBYA 5AI5A 1UDRA 4DV0J 4J49A 3RUBL 2QDXA 4ZO6A 5DG8A 4LRSB 4LY6A 2OTJS 3R5JB 1S7HA 1C4CA 3NTXA 4DFMA 3CZCA 2JRCA 2YOGA 5DSZA 4WN9A 2OC4A 4AICA 2EATA 5DHAA 5KG2A 5KX5B 2P4QA 1UDBA 2XNSA 3NT5A 1RWKA 2RMLA 2X86A 2W8BB 4AQYC 4RD0A 4QR2A 4PRYA 2BH9A 2F4VC 1BX1A 1QR6A 3WAJA 1VC0A 2B1IA 2FFAA 5WRFA 1E1NA 5K09A 1EP2B 1ZEJA 3IAS9 2XE7A 3UDEA 1JKXA 1RW4A 2HSEA 3CC2S 2QD2A 1QK3A 3FPAA 2NUAA 5KFLA 2FKNA 1D5WA 4YAIA 3HBLA 2LDBA 4GP7A 5I9MA 3VR5A 3MR7A 3CSDA 1E6UA 1VQ1A 4OZ2A 2H5IB 2RBKA 3A4TA 3FEZA 2V6AA 1Z36A 2R5NA 4JC0A 4JR0A 1ISFA 1PYDA 1FBTA 5E1OA 2P2BA 3CU5A 2ATLA 1R18A 1I36A 3NHLA 2ILYA 4ER6A 4AL4A 1FESA 3OBIA 2B1RA 1QRRA 3BIJA 3ODPA 3L1IA 1GA4A 1HEUA 2IZ0A 4EBFA 3ETMA 3T5MA 3HBAA 4FYVA 2DR6A 3HL4A 3QV1A 2D1SA 3K9CA 2J5AA 3R44A 3M4NA 1THGA 4MRNA 3PZPA 1GTVA 3JQ6A 2VLBA 4OMFG 1BQNA 1TD9A 3CG0A 1BQMB 1FKPB 5JXJA 4O2BA 1ZUNA 1P75A 4Q4AA 3DYAA 3M6IA 1TQ8A 1QHNA 3KBOA 4RO0A 3PC4A 3V7YA 1VR6A 2GEVA 1YB4A 2AF4C 2GBCA 4U6NA 4ZPTR 1XRLA 4CG3A 2Y0BA 5LQRA 3LVBA 1GJRA 1VRVA 2QGFB 3J7Z5 3GVHA 2CZGA 5TJ9A 1RJ9A 1WHVA 1ZJJA 4F4DA 4X9XA 4G3IA 2JJ8A 5JD4A 2Z8YA 1MJNA 4P0PB 4TWBA 1WUJS 3QFSA 3LP6A 3ZLUA 2KDNA 2X51A 5K8PA 1G64A 5A4IS 1DL5A 2CCJA 5L3SB 3BWBA 4F3YA 3BFJA 3BBBA 1OTHA 1RWBA 1SCUB 1IOLA 2JHFA 1HM5A 3RS3A 2OV3A 4ZLLA 1TQHA 2HNYA 3ILSA 4EBCA 1PYOA 2R6GA 4X1KA 3AXKA 1OXMA 3ZU3A 3RVKA 2QYHA 3A1WA 3C16C 1TKAA 4ACBA 3DR5A 4QTZA 3GFHA 5KWIA 5C3UA 3RODA 5LQSA 5BPFA 3LZDA 4FYPA 3ZQ4A 4UOQA 4EWTA 1U5BB 5CK4A 2IRUA 4OI3A 1NK0A 3NCHA 3VDNB 4RKUC 4NI5A 2OHXA 2R6DA 4I99A 3AU8A 4URYR 4DV1F 2H4WB 1PEKE 2E3JA 4OIXA 5ERXA 4DR5B 2QN7A 2IS6A 3RYCB 2R7TA 3ES9A 3KMQA 1M8GA 2W8ZA 1JR2A 1BFKA 1VQ6S 2Z83A 4YDDB 4D4KA 2G4VA 4TYAA 5J4VA 3NJ4A 4OB8A 4KKOA 1O9TA 3AXMA 1SC1A 4R1PA 3CE6A 1FLOA 3ETDA 5A3VA 4LJMA 3QLVA 6LDHA 2BANB 2BFCB 2EHJA 1F9FA 2IYRA 2AX1A 3TOXA 1AIPA 2HRRA 3UD5A 3A0UA 4DNFA 3F6RA 1IZ7A 3OQOA 4G84A 3WB9A 1LLUA 5EKDA 4H6XA 2HZVA 1ZISA 4Y1RB 1T5OA 4N6NA 2DH6A 2RSLA 1ZBQA 2HJ9A 3L8MA 1KZ9A 4X5OA 2W9CB 3DDKA 4GSKA 1DHMA 2QMHA 1IBLF 3BZWA 2WTFA 4YRIA 3CIZA 1U28C 1CP3A 1V8PA 2XUJA 3G13A 5EGSA 1WKCA 1FFDA 1RM4A 4FF2A 5DHQA 1J9ZA 5A1JA 4GNKA 1C7ZA 4QC2A 2XHCA 3FTDA 3TTTA 4EEXA 3AVWA 3N01A 3L7DA 2F1IA 3AHDA 3HGTA 3IG1B 2Q66A 4EF6A 1SJQA 4Y9RA 4RL6A 3DXSX 2AWNA 1WABA 4RD3A 4A92A 2ZM6F 1QH9A 2ID4A 5K05A 1QHXA 1PU2A 3PJEA 1SB8A 2ZFUA 3RYIB 2C3UA 5K4GA 1CULA 5LR6A 1RU2A 3T1QA 1NUUA 3THXA 3GPAA 5HSGA 4ECXA 1VSUA 3GARA 1WBBA 3ZV3A 3UAYA 2ASBA 2H1WA 3RJMA 5JS6A 2HHWA 2PZFA 1E1KA 4NNPA 3JW8A 3WR5A 2NSBA 4DYVA 4E5YA 3PUYA 4O59O 3PLRA 1PG5B 3UUGA 3H42B 5TS2A 3V32A 5LVAA 1TUWA 2VPWA 4XK8C 4DA4A 2W2KA 5FPSA 2DH9A 2VC2B 3GQBB 3A3PA 4GI2A 4XM0A 4KRGA 4KWIA 1IIRA 4Z1OA 1AT1A 4OHUA 4JLUA 2JFFA 4LI3X 1A7KA 5JYDA 1B7GO 3FSJX 4JCOA 2CPFA 2O8BB 1NPKA 2RJZA 2HA2A 3RANA 4YRJA 1CR4A 1KAEA 1VHIA 5SYNA 3IA7A 4KR0B 1LK7A 2D9PA 2Y1LA 2Q79A 2I1RA 1TKRA 3F3KA 3O8WA 5D4OA 1IN0A 4QG3A 3L6EA 1TECE 1M2FA 1QRAA 1NN5A 3L0PA 2QLFA 1J06A 1JLLA 5FLEX 4M0MA 2JEGA 4PXBA 3SQXA 2HBRB 3BRWA 3C3EA 4PXEA 4KN6A 3SC3A 4HI1A 4RFSB 2XMBA 1GRNA 2OHVA 3EBPA 4B6GA 2BLNA 2XY4A 2HSDA 2W9CA 5LJIA 3RV3A 2FPPB 2WP0A 1X0PA 5KVVA 5HF6A 1LOUA 1NFQA 1WI6A 4ZVNA 2QN8A 3QWBA 4NOHA 4O1MA 3TR5A 3GROA 3W5UA 4NFSA 2V6IA 3O3MB 2F1JA 1CF9A 1RWKB 4RW4B 4DSFA 1FJCA 1UBLS 4GNRA 2MINB 2A1TR 1Q0PA 3EULA 1JEQB 4ELVA 2GRJA 4WY5A 2W4CA 2WHYA 1RAIA 3H6HA 4DV7J 5KG6A 1L5RA 4NXNF 4WOJA 5ALKA 2KHDA 1GCAA 2PEHA 2Z3VA 3PUZA 4EARA 5GTDA 2DQ4A 1LSSA 3D5MA 2PRSA 1ZEMA 2HB6A 1T6YA 5PNTA 3LKBA 3WDMA 1YRBA 1ZVJA 4V2UA 3EIUA 3AR5A 1NVEA 4X91A 2OT3B 3HBNA 1Y6JA 3QYPA 3KDPA 1CUHA 1RWXA 4IUCS 1ZM9A 1T6NA 3CR7A 5JOQA 1L7XA 2FU5C 3P2YA 3FPGA 5TT1A 3RRKA 1AHNA 1WNEA 2AOVA 4F3CA 1HQYE 1UBTS 5HMYA 2DR8A 1E5LA 1S49A 5TPZD 4F5EA 2OCXA 1C0LA 3BCSA 3HYCA 5HDBB 3G49A 4AIRA 1B6RA 5FLXA 2W25A 4WA8A 1HT0A 1TCBA 3PFFA 3DQQA 3L4BC 3FTPA 1C7IA 4FI3C 1FPMA 3ESCA 2JLXA 4DHEA 3EZ2A 4HDKB 1VC5A 3RIEA 3VGUA 3BKWA 4AVYA 1DNPA 1W0KD 3LCMA 3OPNA 1L6IA 4MA0A 3DFUA 2B9WA 4E5KA 4A8QA 3DL4A 1RAGA 3PQ8A 3OZWA 3AHIA 3F6PA 4YUYA 4U8HA 5M34A 3ROKA 2FYTA 2VZ0A 2AEEA 1PFYA 3QE9Y 3IGNA 4K26A 4LGCA 1PT9A 3TDKA 3MA0A 3FDZA 4DGSA 4XUCA 4BVEA 2HQ3A 1CCWA 3ZDRA 1VRTB 2IHBA 4M49A 1IBMJ 2RK6A 2QORA 4JA2A 5EUBA 4NE7A 2CYYA 4JU8A 3LPNA 4D8YA 2VBFA 2BGWA 2QA4S 2AJBA 1TLTA 2ZH1A 2WD9A 3RG8A 5IMSA 1YR7A 3FDZB 4UHCA 2Y92A 3L0YA 1E8MA 4XFJA 4MWTA 3WDKA 1S9EB 1G60A 4HZGA 5B0EA 721PA 4IHAA 4LRUA 1YOVA 2I5PO 3TFWA 3EXFA 1OQAA 3HLKA 4QDUA 4RUBA 3OZTA 4RJVA 3ZZTA 4EEZA 5JI3E 4F7WA 1JEYA 1G41A 3ETGA 2AGQA 2QUIA 2G17A 4N6OA 2HLHA 3H5OA 3GLFA 3U6KA 4KITB 4CLDA 3M3HA 5GGYA 3KDOA 3DLKA 3WBBA 4P4LA 1NG1A 4AYTA 1HFKA 4DV0C 2J0EA 3EVGA 2WF6A 2OI2A 2QM0A 2W2OA 4TKZA 1Y89A 2VHTA 2DNRA 5K5EA 4WXEA 4B6PA 1IR2A 4WE1A 5IT5A 2EQBA 1TFRA 1JDUA 3ZX4A 2HQRA 1DQNA 1U24A 2BR4A 3AF6A 4U8GA 3C14A 3LWDA 1KP2A 2VP5A 4IZIA 1C81A 1C7QA 4RLFA 4L9AA 3GEEA 3JQ7A 2CMGA 2QUAA 4PONA 2ALYB 2B69A 2C92A 2IGBA 1N1MA 4R81A 5CH8A 2AZ3A 2DFTA 3QVTA 4NH4A 1JLMA 1CUAA 2ZTLA 3D6FA 3GLFE 5KNBH 1V26A 3KR1A 3CWZA 1FRFS 5IM0B 4QUDA 5FL3A 2PZAA 4RGVA 2GJ9A 1LF0A 2LA6A 1VHLA 2E48A 4LF7B 1OWXA 2CQHA 3E51A 5KYXA 2E5LB 3N86A 4EATA 1IJEA 2JBAB 4BNUA 4DFDA 4EZ9A 5L3VA 4E2WA 2ZB4A 4IFTA 3JQKA 5K6RA 5C9ZA 2ZP1A 3QLVC 5KHAA 2J6SA 3KJHA 2YYYA 3P9RA 4HXEB 4AKIA 1DRUA 3PFCA 2XT0A 2ZE6A 1GNTA 1JH9A 2NCKL 2WAAA 1HDCA 4YJKA 1S1VB 1RHJA 2W7OA 2I6XA 2LEAA 2AYZA 1RQ7A 3C6YA 1VRWA 1WCJA 1WKKA 1G8SA 4JEHA 1Z1ZA 4PC7A 3UGKA 3BQ0A 4UE3S 1NZ8A 1NZFA 5MLCV 3O9ZA 3R3ZA 1DJNA 1JG4A 1W36C 3SQGA 1UBJS 4DMMA 2PWPA 3ONNA 3AA9A 2R96A 1KPIA 1WV1A 2CNLB 4J9RA 3DOHA