2ZZMA

The complex structure of atrm5 and trnaleu
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
333
structure length
329
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVSYAPREYILALDFKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 82
structure length 329
sequence length 333
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zzmA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zzmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zzmA03
2PT6A 5DLYA 3VSEA 2CL5A 1BKYA 5DX8A 1PRYA 3CKKA 1RI1A 1L3IA 4KW7A 4LG1A 3EVZA 5EMJA 3OU7A 4KWCA 1QZZA 5E8RA 2LD4A 1JG3A 4POOA 2ZBPA 4EVIA 2WA2A 3KPVA 1MHTA 2CMGA 2I62A 2BM9A 2OZVA 3F4KA 1ZGAA 3P2IA 4RSRA 3PX3A 2VDUE 4OA5A 3KPWA 2O07A 5EHIA 1RI3A 3AWIA 3CJRA 3QV2A 3KR1A 4EMSA 2AR0A 2NYUA 4JXJA 5CVVA 2PXAA 3M6VA 2UYCA 4HTFB 1RJGA 1SQFA 3ELUA 3GWZA 3LCUA 2JHAA 2UYQA 4CKBA 2P1DA 5K09A 4EK9A 4EKGA 2IH5A 3KQQA 2BH2A 2ADMA 2ZIFA 2YR0A 4CXMA 2AOXA 3KQPA 3KPJA 1UIRA 2ZWVA 3R6TA 3T0IA 4FS8A 3DUWA 4QDKA 5GWXA 2AS0A 5FQNA 3GRVA 4IV0A 5B1SA 5IKMA 5K0BA 4RTMA 2IDJA 3I64A 5D1HA 3DLIA 5E1OA 2HV9A 1NW3A 2KW5A 3PT9A 4MWZA 3ERCA 2YTZA 2GAFA 3FRHA 3O31A 1NV9A 5E9WA 3Q87B 2FHPA 3HCAA 4GF5A 7MHTA 3TQSA 5GIOE 4YV0A 5HEKA 3IEIA 3UJ8A 1QANA 1OR8A 3LCCA 1R00A 3FUTA 2QRVB 3RODA 4P7GA 1QAMA 4QPNA 1WXXA 3EVEA 2OY0A 2B9EA 2HNKA 3K6RA 5HZMA 3TM5A 3G5LA 1F38A 3NWEA 2WK1A 4PIPA 2NXJA 4PYIA 4RYLA 5C0OE 3TLJA 4YV2A 1VL5A 3BZBA 3CJTA 1HMYA 1PJZA 4U7TB 5LQNA 3ER9A 3NW9A 4QDJA 4Y30A 4QTTB 1I4WA 1G38A 4DQ0A 2ZULA 4GOOD 1NKVA 3JWGA 2PV0A 3VC2A 3ELDA 4PYOA 4CKCA 3G5TA 1YZ3A 5K0LA 5LQRA 2K4MA 2UYOA 3NDIA 4E2XA 3PTAA 2ZZNA 4GOLD 5JUWA 4RTSA 4PINA 2G1PA 1R18A 3JWHA 5EMKA 3A25A 1SVUA 3DXZA 1DCTA 1VLMA 4CWAA 2XVAA 5DSXA 3UJ6A 3NTVA 3FUVA 3OZSA 3HCFA 2QM3A 4PYNA 5EEGA 3C3PA 1ORIA 4RX1A 4H0NA 3UA3A 4OQEA 4UOEA 4YUZA 3NMUF 2P40A 5EKUA 3HVKA 2VS1A 3TM4A 2G8NA 1XTPA 2IGTA 2O57A 4PCAA 4RVHA 5DM0A 2GB4A 1VE3A 1Y8CA 5BP7A 1L3BA 1QAQA 1U2ZA 3C6KA 5DTRA 3M4XA 9MHTA 2OB2A 5DXAA 3PFHA 2B25A 2CMHA 3AY0A 3T7SA 1FJXA 3BWYA 3MQ2A 1KPHA 1RI4A 5EHGA 2I6GA 3FPJA 4EKIA 3OU2A 4RVFA 4FP9A 3EGEA 2UYHA 5U4XA 3EMBA 3FUXA 1AQJA 4HSGA 4C06A 4RTPA 4OBXA 4FT2A 4KRGA 3KR2A 2IBSA 3HCDA 2IPXA 5FA8A 1MJFA 3B3JA 1UFKA 3M70A 4P7JA 2O05A 1Q0TA 5DM4A 1I9GA 4RTOA 2IDKA 3BT7A 3P2KA 4C08A 1WXWA 3CVOA 1ZHFA 2ZBRA 3PX2A 5CUQA 5LQJA 1SQGA 1X1CA 3GNLA 2ZZMA 3OPNA 3KPUA 4AZTA 3P9KA 1G6Q1 4YUWA 2FPOA 4M36A 3ER8A 5C1IA 2H11A 1JG4A 5DSTA 4C05A 3A26A 1P91A 1BC5A 2PX5A 4A6EA 5ICCA 3FTDA 4GQBA 4KVZA 1XXLA 2ERCA 2EX4A 3FZGA 5EIFA 1JQEA 4KIFA 5FULA 3HA5A 2GLUA 5EEHA 1N7JA 3E8SA 4DF3A 1NBIA 3B3GA 3BWCA 3DH0A 2C7OA 3Q7EA 4ER6A 3DOUA 1JR4A 1L1EA 5FUBA 3BWMA 3LDGA 4E32A 2PT9A 2B2CA 3KU1A 1NV8A 4RWZA 4BLUA 2O06A 3G2OA 2A14A 3HEMA 5GM2A 4CTJA 2HTEA 2ZTHA 5CVDA 1NBHA 3SM3A 1YF3A 2Z6AA 3SR4A 3O7WA 2OB1A 4R05A 5EOVA 5KQRA 3S68A 3OU6A 5HFJA 3GRUA 3HCCA 2ESRA 8MHTA 1INLA 2XYQA 1NE2A 4RTLA 5F2OA 4HRAA 4XUCA 5P8WA 4PCLA 5K0CA 3A7EA 2AVNA 1YFJA 4HC4A 3BUSA 1X1AA 3QOXA 3LHDA 1ZQ9A 4P58A 2VDVE 2YUIA 3LBFA 4PYLA 4X60A 4GBED 5EZSA 3JWIA 4XUDA 3TKAA 4AZSA 5BW4A 3FUWA 4X1OA 5HIKA 5HIJA 5KVAA 1I1NA 1AV6A 2ONYA 3EGVA 5EPEA 1L3CA 1RI2A 3UJAA 2BZGA 4M7RA 2C7PA 3P97A 5EG5A 3SMQA 3FPGA 2HR1A 3JWJA 4P7KA 4LECA 1X1BA 4GUAA 4F85A 4E33A 4FR0A 3KQSA 3KR9A 4AZVA 3SSMA 5E2BA 4IWNA 5ICEA 3FTFA 3A4TA 4Y2HA 1YUBA 1KXZA 3UJ9A 2YQZA 3ME5A 4E2YA 1XDSA 3MTIA 2AOVA 3BGDA 3GXOA 5CIYA 3EVBA 4LWOA 2CWWA 1X1DA 4G56A 4E31A 1M6EX 3DMGA 4PIMA 5K05A 1UWVA 3UWPA 2QE6A 4C03A 5EKXA 2ZFUA 4R8RA 3EVDA 4B17A 4X63A 1IXKA 1R74A 4HH4A 3THRA 3UJDA 3I9FA 3P9NA 4FGZA 3C0KA 3TFWA 3NDJA 3IV6A 1SG9A 3HTXA 4C04A 4YUXA 5HIMA 3ORHA 1BHJA 3BGVA 3LGAA 3OE5A 5DX0A 3CCFA 1NW6A 5C9ZA 2IP2A 5E2AA 2G70A 3UJCA 2AOTA 5LQUA 4L7VA 1EQAA 4ZTBA 3CGGA 4ER7A 2OPBA 3E23A 3MB5A 5GINE 3AXSA 3FUUA 3EGIA 5DT2A 4O29A 1JQDA 3KHKA 3CJQA 3LKZA 3DXYA 2NP6A 2VP3A 2N47A 3BWBA 1EG2A 5EC8A 5IH3A 5FHRA 4M37A 3G89A 4PYKA 4IKPA 2NXNA 1SUSA 2Y1XA 2QYOA 2ZZKA 3G2PA 5LR6A 1ORHA 3H2BA 1AQIA 3KQMA 2PX2A 3KKZA 5EIWA 5HIIA 4ER0A 5K03A 2PKWA 2OKCA 5E1BA 1RI5A 3NWBA 2AOWA 3UBTA 4MIKA 2HMYB 3P8ZA 5FA5A 3V97A 4BP1A 3M6UA 2AN3A 3UFBA 1G8SA 1KYWA 2JHCA 4ATNA 1QYRA 4P7FA 2C7QA 2PLWA 3IHTA 3HVHA 3FYCA 3V8VA 5EZQA 4QTUB 2VDWA 3GRZA 4WXHA 3SVZA 4AZWA 3MCZA 4PYMA 5E1MA 5GOZA 1B42A 5CVJA 3AJDA 2ZIGA 1RJDA 3A27A 2ZLBA 2UZ4A 1RJFA 3LDUA 5K0NA 3UA4A 5KS2A 1G8AA 3EVAA 3B3FA 5E9QA 3E05A 3OFKA 4M38A 5GP1A 2IH4A 1DUSA 2GS9A 2JJQA 3HM2A 3TRKA 1Z3CA 3M6WA 4FT4A 3T7TA 1P1CA 3DULA 3T7RA 1KP9A 4RTNA 2NNWB 1IY9A 1TW3A 1YZHA 2IBTA 2DPMA 5G02A 5BW5A 3HP7A 4GOND 2FRXA 3LSTA 1T43A 4XCXA 2IIPA 1VPTA 3KQOA 3MHTA 3BKWA 1JQ3A 3FPEA 5LQKA 2XBMA 2V74B 4R6WA 2P7HA 5DX1A 5EGSA 4OQDA 3FRIA 3EVFA 4CKEA 3P2EA 1WS6A 4MTLA 3DR5A 5M5BA 4RTJA 2AN4A 3TOSA 3C6MA 3EVGA 3TMAA 2PX4A 3MGGA 5ERGB 2B78A 1NW7A 1O9GA 5DXJA 4PGHA 2R3SA 1KPIA 3HVJA 3EEOA 2V7EA 3OZTA 4KDRA 1JTFA 1JTEA 1EJ6A 3GU3A 5EMLA 3NVKI 3P71T 3TR6A 5H02A 2I7CA 5FQOA 5T64A 4PWYA 2P8JA 2ZW9A 4QQKA 1XCLA 4YUVA 2I9KA 3BXOA 4X41A 2R6ZA 2JG3A 4FSDA 5FHQA 4GC5A 1WZNA 3BKXA 4V0QA 1ZKDA 10MHA 3I5UA 1SUIA 2PX8A 3MTEA 3DXXA 3I53A 4PNEA 5K01A 5KYGA 2AOUA 3KQYA 1JSXA 1XJ5A 3E7PA 1NW5A 3M33A 3AXTA 3VC1A 5F2NA 3KQWA 3K0BA 4CTKA 3HVIA 1ZGJA 3EVCA 3KQVA 3A7DA 2O0LA 4OX9Y 5ICFA 3SGLA 1SKMA 2Y1WA 1KIAA 2AOTB 1L9KA 3C3YA 3LECA 3L8DA 4QVGA 5T67A 3SSOA 5LSAA 4RTRA 1XDUA 1YB2A 4PGGA 2GH1A 4Z2YA 3IYLW 4MQ4A 2ORED 5GM1A 4K6MA 2OBFA 5DTQA 4E2WA 2PWYA 4LWPA 4QQNA 5KQSA 2OO3A 4HG2A 5DRTA 1O54A 2FK7A 3B89A 3OE4A 2YXDA 3UJBA 2YXEA 4RVGA 3P9IA 4OBWA 3DP7A 4F84A 4PONA 1JG2A 2B3TA 4ER5A 2XYVA 3I58A 4KIGA 5DWQA 1WG8A 2YXLA 3KQTA 3UZUA 5BXYA 1EAMA 5EQJB 3R9XB 2FCAA 3QOWA 4YUYA 5GIPE 4WVLA 1R8XA 5ICGA 2FYTA 4QPPA 2P35A 2EJUA 2G72A 3PFGA 1QAOA 3OZRA 2Z6UA 2C7RA 3DMFA 3R24A 3SSNA 3GJYA 2BM8A 5DTMA 3KPYA 4RVDA 5FADA 5HOQA 1M6YA 2E5WA 3CC8A 4E2ZA 5K0GA 3FPHA 3LCVB 3SXJA 4AUKA 4E70A 5MHTA 2BR4A 1KPGA 3MAGA 3R0QA 3HNRA 4FZVA 3O4FA 4OA8A 4RV9A 5EMMA 4DM3A 5CVUA 3G88A 4R6XA 5K0JA 5K0FA 2OYRA 1FP2A 2G71A 1WY7A 3M6XA 4ER3A 2FK8A 2EJTA 5CCXA 1KR5A 1O9HA 3B7PA 2PJDA 1TW2A 1P1BA 5CM2Z 3OCJA 3HCEA 1P39A 4KDCA 3MCTA 5K8VA 1DL5A 2VZ9A 3DTNA 4PYJA 3EPPA 1TPYA 3ELYA 4GC9A 3FTCA 4BP3A 3ELWA 5F2KA 2ONZA 3HCBA 4DCGA 2JH9A 4F86A 4V0RA 3GO4A 3DMHA 5HILA 2DULA 1D2GA 4HTFA 3OFJA 2XVMA 3ID6C 4E30A 1BOOA 4HGZA 4RTKA 4IV8A 2CKDA 4X61A 3G8AA 3LDFA 2AN5A 2HWKA 1G60A 2PBFA 2Z6QA 4YMHA 4DKJA 5DM1A 4A6DA 1XCJA 3G7UA 5DM2A 3MERA 1M0EA 2YVLA 5FWDA 1VIDA 2EG5A 1D2CA 1XVAA 2ZBQA 2IFTA 1ZG3A 3NVMB 1NW8A 2PXCA 4YV1A 1VP9A 1KHHA 3EEYA 1HNNA 4R8SA 1G55A 4FSXA 3NJRA 2QY6A 3VYWA 2P3LA 2NXEA 2P3OA 2AZTA 1FP1D 4BLWA 3THSA 3TPZA 2ZSUA 1VBFA 2PGXA 2QRVA 3GGDA 3U81A 2AVDA 1F3LA 2AOUB 3SX0A 5D1NA 5LQAA 3X0DA 1N7IA 3LPMA 1JG1A 2H1RA 2WA1A 4YMGA 1R8YA 2BR5A 3FYDA 3REOA 3BGIA 2GA9A 1IM8A 4AX8A 4PYQA 5K0EA 1N2XA 3G8BA 2JH8A 2Q41A 3WSTA 4GEKA 2NXCA 2GPYA 1VP3A 2P41A 3G2MA 2PSSA 1KYZA 2PWPA 3KR0A 3PB3A 5CVEA 3P9CA 4BY9E 1EIZA 5FWAA 3FPFA 5E8JA 1AF7A 3HA3A 5T6BA 4EQZA 2PVCA 5DRYA 3GDHA 2BR3A 4C4AA 3FTEA 5FTWA 1NT2A 3GRRA 5E1DA 2ZVJA 2NP7A 3RW9A 5JR3A 3PS9A 1Q0SA 3PVCA 3LBYA 4QVKA 4GOMD 3G2QA 3UJ7A 3LKDA 4C07A 4DCMA 4RTQA 3ANXA 1D2HA 1R6AA 5CCBA 4XUEA 5E9JA 4DMGA 2IH2A 5EVJA 2PXXA 2P7IA 3HA7A 1V39A 3PLAE 1FPQA 4ISCA 5CD1A 3RIEA 1EJ0A 2F8LA 2ZWAA 3B5IA 2OXTA 2ZCJA 5LQCA 1RJEA 5DPMA 1XDZA 3LL7A 1VQ1A 3GRYA 3LX6A 4NECA 4U7PB 4DA4A 2EFJA 1H1DA 2H00A 3DLCA 3R3HA 4DZRA 1FBNA 2XYRA 3D2LA 3TKYA 2ZIEA 1YFLA 1X19A 4HGYA 2P3QA 2PY6A 3GCZA 4BLVA 4MHTA 2YX1A 3GIWA 1JSZA 5FCDA 3EMDA 3CBGA 2JHPA
chains in the Genus database with same CATH superfamily
1FRKA 3JQDA 4TVKA 5C1PA 4MS3A 1GA4A 4YJ3B 3F96A 2JFWA 1HDCA 3RS4A 4QGGA 2WJWA 1JPNA 1T1JA 4IAOA 2HJSA 3GSIA 3L1VA 1O92A 2BM9A 2H0AA 4FILA 5CD9A 1M34A 3K53A 3OQJA 5GJVC 3T1NA 3SCLE 1SB9A 3WRXC 1X4FA 1NZJA 3K71B 2JVRA 2WUVA 2WG1A 4K8OA 1LQUA 1OYDA 1A4UA 3I64A 5JANA 1OJ4A 4P9SA 4C7MA 2ZWIA 1YB6A 1SBIA 3O5TB 3IPRA 3CJEA 4TMZA 3CD0A 5HM6A 3WNZA 5HZMA 4QXQA 5C0OE 5DF1A 1H2FA 5BWMA 2ATEA 5E95A 1FU4A 3WG9A 3OZUA 4YJGA 4DWOA 3EIQA 4LMAA 4F11A 3TR3A 1XO1A 3P20A 3VDRA 3FFWA 2Y4OA 4UE3S 1H5QA 1RJ9A 3AI3A 3AUUA 4FE7A 2JPDA 2JRLA 1W0KA 4ESVA 4RK1A 3PNMA 2JIPA 1XZBA 1OFVA 1RXSA 1XMIA 1GL9B 3TINA 1QCCA 2O48X 2EI5A 5AK0A 1XJQA 2YHIB 1ZY2A 4H4MB 4CF6A 2JGIA 1FYFA 4C21A 2PUVA 2VD3A 5EWLA 1B7FA 4EB6A 2UUCJ 3OE1A 3DQPA 1WW3A 3D0OA 2WHYA 2AMLA 1N2FA 3ZHZA 3DOMA 3WK9A 3W1YC 2KX7A 1IUKA 3ONVA 3NWGA 1T4CA 2ZAGA 3RJMA 4KHMA 3P6YC 3GFVA 2I87A 3RJ5A 3DZFA 5MF6A 3IR6A 4GVBB 2IUTA 4X1OA 4R9SA 7REQB 2QQ0A 3PUWA 1OXSC 1KE1A 3UKOA 4EHIA 3FTFA 5F5XA 3ZJTA 2RDMA 4FXDA 1AUSL 4FFRA 1LWCB 1F2VA 3RW7A 4AN4A 2V65A 2A1BA 1ZH0A 1PZFA 2IUFA 3OE5A 5C25A 2FEWB 1V11B 2FKAA 4RHCA 2CB0A 1Z6GA 3LANA 4Q39A 5JCZA 1VQ8S 2YWJA 3HFRA 4M5DA 1K1SA 2I7TA 3D31A 4AAYA 4C2BA 3H2JA 3N8NA 5K03A 1L5QA 4XFDA 2ATXA 2VRCA 4ZVPA 4BBZA 1X2BA 1UH5A 5F51A 2FZGA 3FSGA 4HDNB 3GYGA 4HTIA 4Q48A 1KO8A 2FSFA 4E4RA 2BYCA 2UZ4A 3MSCA 1G8AA 2G63A 5KFWA 5KYNA 1BQNB 3FRJA 3RDPA 1IB6A 1OCEA 1JLHA 3CKYA 5IDXA 5EGSA 1M90T 3PHJA 4TSKA 1VOMA 5ETJA 4CV3A 1XRAA 4A10A 5AXNA 4ARUA 1P7PA 3FCUB 4A92A 4ZYZA 3HY4A 4YALA 3ADCA 5LMNJ 1N8SA 3T15A 5B7GA 1XNRC 3NGRA 2MGZB 2YVQA 1GPAA 1XZQA 5EX0A 4HQ0A 3MTEA 4OSPA 3SC3A 3W66A 2E3JA 4RKRA 1QQTA 4FGJA 2CVPA 1L9KA 2IW3A 5GONF 2FFBA 1T3GA 5D7NA 1O97C 4GD3Q 4KQXA 3BL8A 2ORED 2CLSA 5DLQC 3VGUA 1C0UB 2CUTA 5F9FA 2C3UA 1E6CA 3N2KA 3E3AA 2J0QA 1IUJA 1QKKA 4RPJA 5MN5A 3BCHA 1QK4A 3PC2A 3CDAA 3QOWA 1TVRB 4P2FA 3HHPA 3G9CA 1J7JA 3JRNA 4TYQA 2HVHA 3PY8A 2D74B 3H5TA 5CXSA 2FJVA 3P9ZA 4G2NA 2JC3A 5IASA 3GLRA 2IIHA 2P62A 1WDMA 2W2MP 4PTYA 1IZ8A 2WLTA 3LZDA 2AEMA 4P72A 4WV3A 3EPPA 4IF6A 3GJ4A 1KMHA 2PV7A 1XQYA 2Q0QA 4FOTA 3EOZA 5CB4F 1OU0A 3LNTA 3X1MA 4K5QA 4X0EA 1F0XA 1V7PC 3HUTA 3FSJX 2AYGA 4JQYA 1P9QC 3KE9A 2A0YA 2HYDA 4HY3A 4YRKA 3MF4A 2WFZA 3R27A 4LSGA 5H9FJ 4LYFA 4G8JA 2C07A 5FI5A 5BQFA 2EEZA 4CI9A 4KE5A 5A2QU 4AJ1A 1HLDA 4ED1A 2V63A 3BN4A 2C0QA 1PFYA 3OR1B 1F6WA 5KSYA 3O83A 3IV9A 4EI9A 1IIBA 5FWXB 4L8VA 3KXWA 3B1XA 3NAGA 4M53A 4UCQA 4YMTA 4G5OA 3Q3HA 3KK3A 3MWGA 2PD3A 2VWGA 5BMVF 2F59A 4JI1B 4YRCA 1SU7A 3PKZA 1IKVA 2W2NP 1X9WA 2H1LA 4DLPA 3KS9A 1BXGB 2G06A 5TS2A 1F60B 2CJWB 3ECCA 1E5XA 3V8PA 4DSTA 4YOEA 3BE4A 1XVLA 1Y3KA 4A8QA 5EAIA 4JI4J 1CULB 1DQSA 7AT1B 1EM8B 4DUYJ 1LFDB 3HS3A 5DOVA 1Y48E 5C2GA 1NI3A 3K92A 3IQHX 4IWYA 1S12A 1NQOA 4CLHA 5LMUF 3MOSA 4WKOA 5LXRA 4WLUA 2YXBA 1FU7A 1BYUA 4PU0A 3VX4A 5ARDA 1N32C 1SEVA 5DG7A 4R1TA 5EUHA 4RD0A 4ZVQB 4GWGA 4NH0A 4WZ6A 5JTUA 2RCYA 3DOJA 4IIJA 3UMGA 1U1NA 4ZCIA 5DMHA 4RVFA 3WIDA 5G0WA 4PZAA 1XYVA 5IKOA 3O92A 2I7VA 3QX3A 4URHA 2ORYA 5KFRA 4TLRA 4NYIQ 4MW4A 3DOKA 4F06A 3JTPA 1U0HB 1KC8T 1QAYA 5L6MB 4W7SA 3ZZNA 4QJ4A 4F60A 4OI3A 5CLJA 2Q2WA 3K6SA 5E3QA 1KP2A 2QPOA 3W3AH 2VYCA 4C9DA 1V9OA 2CCGA 3O26A 1PQUA 4MYCA 1MU2B 2D5LA 4UBLA 4RU1A 2CKMA 5FPKA 3FCYA 1DBVO 4M7RA 5EG5A 4ZO4A 1IN1A 2WU8A 1N2EA 1PWHA 1WXGA 1A8PA 2HMVA 2Z58A 1DLJA 2ENWA 1QCZA 3K57A 2XZLA 3ED1A 4MKFA 2LQ9A 3UJDA 4ADSG 1EVJA 2GNOA 5HKBA 4XSGA 4KQ6A 1ISJA 1GHTA 1NLFA 3H7AA 1RG9A 1NM5A 3OHSX 1W1IA 2YWEA 3INTA 2J0SA 4KH0A 1N4LA 1G66A 2VJKA 4BPRA 4C4OA 3SHVA 3GFXA 3W2VA 3L4EA 2V7TA 1S2MA 1EXVA 4UZSA 2RQKA 2O2DA 3QPBA 2FRDA 5JNVA 3R6GB 2OAUA 3KG2A 4RH3A 4ZI2A 3A8IA 5AK4A 3RKRA 1VB3A 1Y8RA 1RHQB 3K9NA 2ZLBA 4YIKA 3H0EA 2VODA 4HNUA 3G4SS 1DTWA 2LP4A 1UBMS 3CYFA 3WDKA 1PG5B 3AX6A 2QFJA 1VRTB 2IYEA 3K32A 3RSZA 2PZAA 3G5UA 1WS6A 2Z5GA 3FYUA 1NLZA 4KXUA 5EE1A 1U4BA 3AP3A 2IT1A 2GRUA 1T1IA 3VKHA 3C6BA 4TLQA 4JJ4A 1WF2A 1BU5A 4AQYF 3KJVA 3F44A 2HHPA 3BMNB 3BD9A 2GI4A 2UVRA 1N3IA 5F2NA 1UBCA 3C7KA 2ZWOA 4Q9IA 2XNSA 5AJ3J 1X70A 3IYLW 4UPVA 1MXHA 1A1SA 3GMSA 4D82A 4I36A 2AW3A 5KHLB 6ADHA 3K4PA 3UV7A 1IULA 2I8EA 3PPWA 2NPOA 4A0FA 4PXEA 3H5VA 2HFVA 3HB9A 3FPHA 4EDFA 2IZ0A 3IA2A 3DJYA 4HACA 3B52X 4WESB 4CM8A 3C6TA 3BTVA 5LP6A 5CH7B 4IYRA 2WHEA 2ADBA 5EERA 4EB3A 1E4VA 4UDNA 1E3TA 2JDID 1AZTA 5K8FA 3HHLA 1GN9A 5IV3A 5AW9A 4GZ5A 3SIRA 5ALOA 1NK5A 1XIQA 1KFDA 5A5EA 2GBGA 3EYZA 4Z4GA 4DLTA 4LSLB 2P3LA 4INAA 1QH8B 1HLWA 2AOUB 1GJRA 3QIPB 3GUVA 4B3MB 1G5IA 4C5BA 4BY9E 1O95D 2N1MA 4BLTA 3ITKA 3HJFA 2RHQB 4PRZA 4JI2B 4CEHB 3ZJUA 1VSUA 4GOMD 1BJTA 3V4LA 1T36B 1LWXA 2R8PA 4CODB 4DPLA 3W0LB 3D1OA 1RA6A 3DCAA 3EMDA 4MA4A 2CXXA 1LB1B 3SQMA 1NYLA 1N34F 3QV2A 3PX4A 3BRWD 4EJSA 5F8NA 2IELA 3GCDA 1RT9A 3W1VA 4MYUA 5CHYA 4NDNA 3UMJA 3KXKA 4O4GB 2ZUDA 2ZC4A 1TK3A 3IEPA 4KJZA 1RQ2A 1X9HA 4YCBA 4XJVA 2EK1A 1M2OA 2H06A 3L3CA 3T5DA 3EOBI 2VPZA 3ZI4A 2PFSA 1UZAA 4MAAA 1K08A 2ZH7A 4RF3A 1EXMA 3ZO7A 1I1QB 4AY6A 4DZTA 5H4GA 1CQJA 4CWAA 2OCLA 2Y1OA 3K0HA 3D0GE 5TV2A 2MOKA 4UOEA 4F3RA 1I6MA 1XN1A 4ZOEA 3PFFA 4A8MP 1ZXLA 3A37A 1L3BA 3HLTA 5JE8A 1U8YA 4W9NA 1YCFA 4L72A 2ZUCA 2VDQB 1QE0A 5A0YA 4CP5A 4X3OA 2EGGA 3KDPA 1TEZA 1XVVA 1GNRA 2YZ7A 5BR7A 2NQTA 2VV5A 1BDBA 1R10A 3OEHD 5EE0A 2W01A 5KPJA 1UT5A 2UXCB 2N3OA 2GUGA 1WMFA 4DQUA 4EJ0A 2TS1A 1RTJB 3QH4A 3F3MA 3WL8A 5JUMA 4Z3DA 3QVSA 2AN1A 4ER6A 2C2OB 4E32A 5C46F 1K4KA 2IODA 3FNNA 5P8WA 1GZVA 1XQ6A 3GJRA 5L7TA 2WF7A 4OHPA 3QG1A 3KUEA 5HANA 2WJVA 3BH7B 2YH2A 4RXMA 1CW2B 3VR1A 2AE2A 3PROC 5FP0A 2HK3A 3A0RB 3GXOA 4S1OA 5JNWA 4HNTA 3MXOA 4DN0A 1S3IA 2ZSHA 2ON6A 4F2HA 4CIAA 3THRA 3TFWA 2KB2A 2X9VA 3D6JA 2VF3A 3CTMA 5JWOA 1A5BB 3MTKA 1EGAA 2R9LA 4G6ZA 5LQUA 4KV8B 1QVFR 1WKJA 2FSHA 3QEOA 3AXSA 1YBMA 1VMKA 2V6AA 2B4KA 4CIBA 4RV4A 3O3NB 2XLJA 1DUVG 4MIKA 2JEJA 1O77A 1G6HA 2AXNA 3TP2A 3O2IA 3E1SA 1KYWA 4LY3A 3VUEA 4RFVA 1HRKA 3OJCA 4YRRA 4JM1A 3PGA1 4BC7A 1ZK4A 5CYOA 3QYJA 4CW7A 5KS2A 3HBNA 3O8RA 2GF2A 2NGRA 1ZIXA 1JKFA 4JELA 2E37A 1XXHA 4MNTA 2BLNA 3WGOA 4GMKA 3KJQA 1BQMB 1YKGA 2JGMA 4AU1A 4UMDA 2ANBA 1Y6QA 4M1KA 3LGNA 4WFNQ 1DZIA 3LT2A 4ZFNA 3A6JA 3EDQB 3C7AA 1BS1A 3FHTA 4DSIA 4YRPA 4LF4F 3VQSA 1NJIT 1MN7A 4MITA 4EGFA 4D9FA 5AK3A 3E6AA 4PNEA 1DC8A 4PR6A 2YWRA 2F65A 3VU9A 1ZGJA 2FX5A 4CMIB 3R2CJ 1LFAA 4YECA 3UN3A 2BH9A 3O3CA 1ZM4A 2CNNB 1IBKB 1G5TA 4G1PA 5LYJB 2TMKA 4P83A 4IDDA 5A6SA 2V8VA 3IE1A 3ANLA 2XB4A 3ILHA 1KEWA 3G9XA 3CC8A 5ALVA 1NXVA 2DRAA 2ZM6B 3WK7A 1KFBB 3MOZA 4RVNA 1RQRA 5CB0A 2LW7A 1ZS9A 4CCHA 4Z9AA 3GHYA 4F4YA 4KPCA 5I9LA 4AMUA 5IHXA 3TZZA 3OXFA 2KRRA 3T4PA 3MEDB 3R9XA 4V0RA 1E79D 4FNHA 1KOJA 1BOOA 2V97A 4X61A 4P4SA 3D1LA 3M9OB 5JNTA 2YDXA 2C7GA 4UULA 4MUXA 3KOUA 3G8DA 4JLKA 3GV5B 4XVRA 5LOVA 4QBTA 4C8KA 4RVSA 3WV5A 4QU7A 2W90A 5IM4A 4TV9A 4FHGA 1HG0A 1UP1A 4NXMC 1QV9A 3KBOA 3MAJA 2XD4A 1RT4B 4C4RA 4AS2A 4HXYA 1GQOA 4EELA 2A0KA 1E5VA 2EP8A 2XULA 1Z3IX 2ROQA 3KLOA 3IIKA 4KFRA 3P0JA 4V0ME 1BLUA 3TD9A 3BIOA 4GRIA 4AECA 5E2QA 3P0EA 2FGJA 4UU1A 4WBNB 1NJ8A 3IJPA 4DR3J 3CR8A 4ISCA 4DSUA 1Y5RA 3SIPA 4QE3A 4EUFA 2JMPA 3KG4A 1IWPB 3NYRA 3HDVA 1CXZA 5DX8A 4Q66C 5SYNA 3LH2S 2ODAA 4I9NA 3NHAA 2V9WA 1MHTA 4FI3C 4NMWA 4ZCLA 1OH7A 1XERA 3ZWBA 1DPFA 5TGZA 5IG2A 4CMCA 2G5GX 3ZGYA 3GP9A 5CDYA 1QRSA 3A14A 3RC8A 3S2UA 2DY0A 4NATA 4HL9A 5E9WA 3A32A 4MV5A 1OB2A 3N53A 3H5OA 2GPBA 4JL6A 1P1IA 5AM3A 5A3VA 2A2CA 4R3UC 4N1AA 2EWWA 1YZTA 1UKKA 4ED4A 4LF7J 3DRPB 3I07A 3E53A 4B9TA 1RRGA 2C4NA 1HNWB 3X2FA 3B38A 1QH9A 5AVWA 5D00A 1T8SA 5KMGA 2PI4A 4PZ9A 2PMFA 5DQIA 5H81A 2SICE 3D43A 3NUGA 4MVJP 5AW3A 4B81A 2UVUA 2YCBA 1Z63A 1C1DB 2UZIR 2PAFA 2KG0A 1XD2B 3W6UA 3QF4A 5K8IA 1C80A 1SBZA 4ILRA 1TJNA 1CLEA 3GNLA 2ZZMA 4UTRA 1S72S 3SPXA 2DIUA 1MOQA 1KTIA 1ZA1B 4G63A 4PSDA 3FKQA 5BV0A 3NGXA 1ZN2A 3PGKA 3THVA 3GJQA 2OR3A 2I7DA 2BQUA 1JAHA 2XUJA 4OHMA 4EBCA 3OLVA 4FKBA 3KAKA 4IR1A 2W8BA 1Y4SA 4OMDA 1EBFA 1F7UA 1Q95G 1UF9A 4LSWA 1U28A 2JLRA 3G8YA 2WF6A 5K4GA 4BRWA 4EF4A 5KVAA 2X1AA 2D6FA 4P2MA 3CCJS 4UU8A 4Q3NA 1OIVA 3VTKA 2D1CA 5H9EK 4X54A 4RR5A 4MPRA 5LMCA 2I1VB 2K7ZA 4UE6A 4RF4A 2DF8A 4JKIA 1WLYA 4YCAA 2NO0A 3I6YA 4MUHA 4II7A 3EA5A 5HMXA 1PLKA 1JOSA 4E09A 4QOGA 1JDNA 1CUJA 5AQEA 3OTOJ 3BFVA 3EVMA 1R0CA 2FEAA 1NK8A 5D8HB 4EK2A 1DJPA 2NO9A 2D0PB 1G2QA 2JJ2D 3EXHA 2HHWA 1JHVA 4QYZJ 1GMVA 3WLEA 2ZIGA 3KCNA 2ATVA 5IAKA 5JRZA 1ISFA 3ROGA 2B4QA 3TNDA 3NAQA 2GVZB 2B9WA 3AUTA 2FRXA 2Q3CA 3B1ZA 2R66A 4XH9B 3B7WA 1KI4A 5B7WA 4IDKA 2ZFHA 5TF4A 1K0UA 2WWTA 3GRCA 2QJRA 1A7JA 4MTCA 2IY5B 3LBAA 3D67A 2C59A 4OM8A 4U0JA 3VAFA 2A9PA 4MVJF 4KAXA 1FEEA 3OCUA 3WMEA 1FD2A 4NYIR 3ROKA 3MM8B 4ZVOA 1MB2A 1USPA 1CZLA 3RUBL 3ET5A 2XCSB 2YWCA 1ZPDA 4ZVRA 2FY8A 5HXAA 4ND3A 5BYJA 1J7KA 1VCIA 5BSGA 1RWOB 1HNXB 1K63A 1PFVA 2EWVA 4H2DA 5CFPA 4DPOA 4M8NE 3SDEA 5LKRA 4U2FA 2C61A 2PS1A 4ER5A 1V5VA 2Q3FA 4YJKA 2J85A 4O4JF 5ICGA 1WY5A 1NDUA 1MW9X 4S2UA 4UQOA 4B3CA 1C30B 1E2IA 1L9XA 2H8GA 3VGPA 4G84A 3KUCA 3PDWA 1JR2A 4C0AC 3RKSA 4AXJA 5GV8A 5HL7Q 1AKRA 4NJMA 2JLEA 3DLEA 4I6EA 1BX0A 1QTNB 2C2MB 2B2XA 3WYCA 4IV8A 3WKBA 2P9FA 2DQYA 4N9QA 2HHUA 4JJZA 5TPWB 3OE7A 2ADOA 2ZBQA 5MFZA 1U3VA 2JLCA 3EEYA 5B53A 2Q0HA 1UFOA 3GILA 5LP1A 2A78A 4DZDA 3LPMA 4L5AA 4G5RA 4D9NA 1I2MA 5F7OA 3I05A 1R5NA 4NEHB 1Q8LA 3SKYA 1I5RA 1P0MA 4FMBB 4TKLA 2VRWA 3N86A 2PBRA 1U6FA 3E3NA 2RHCA 3PUVA 1DMSA 3WNDA 3VAGA 1ACJA 1R6TA 3LYUA 1T3SA 3RRXA 3ESRA 2PSEA 4OQ4A 3JSMA 5ESXA 3EIWA 4Q16A 3GC6A 1QLJA 4OTZA 3EZ5A 2L18A 3VJMA 2RBKA 5HAOA 1E7WA 4ZVTA 4KX5A 4EFAC 1SHJA 4DV1J 3IBCA 5HR5A 2Q0XA 4BTEA 1D9XA 3IEUA 5ALUA 4IXWA 1VMIA 4Q9LA 1JB9A 3KQPA 3TB4A 2QTZA 1R27A 3QLEA 1HYGA 4UHBA 3DW3X 3UAOA 4Z9BA 3NHFA 1YBVA 3I6IA 4CMAA 3HVUA 4M21A 1YR9A 4JV5F 3IAHA 4K4VA 1PYOB 2PA0A 5CH5A 2ZE2A 2GN6A 1U0GA 1C0LA 1NURA 1YDHA 2ZSEA 1Q1AA 5K3EA 3V32A 1H1LB 3A25A 3HR7A 4ZC1A 2H5EA 1ZITA 3RYHB 4CM4B 1E6UA 3C3PA 4AF7A 3OIGA 2BGRA 3BYRA 3VZHA 2KG1A 1CJTB 2DRBA 2HA5A 1CLFA 5ETQA 3A3OB 4H3KB 3AY7A 1TPZA 1CK4A 3DE5X 2MU1A 3NBMA 3H8WA 1XZLA 3PVSA 1RLTA 3F73A 1DU4A 3IUPA 4JYBA 4K03A 4BNZA 3M6AA 2WUWE 1OUMA 4WXRA 3LVBA 3AY3A 3GB9A 4CETA 1AB5A 3QFHA 3CZCA 2QP9X 5ECYA 3CMCO 5HSPA 1ITPA 4NZMA 4E08A 2QT9A 2YRFA 4RUCA 2GD2A 2EKLA 3AEYA 1E9CA 5F78A 4E4YA 3PP8A 1UM9A 3S68A 1E6EA 2BFBA 2X6RA 5C32A 3V81A 1CY2A 2HLDA 5KDLA 4MUGA 4ECVA 1L5KA 1FTYA 1E6VB 3TUIC 3TWOA 2MY8A 2R4QA 4NWBA 3UFXA 2ONYA 4DJAA 3WXBA 4B3RJ 4J29A 4JJKA 4YB1P 3DD5A 1E3IA 2UXBC 4YXWD 4I6GA 4HDHA 1IQ0A 2BFEA 3QBDA 4FD3A 2XWSA 1G2PA 3AEUA 3EW9A 4KVFA 4RBTA 5FLXY 4P80A 1HWJA 3OPYA 1DARA 2DR8A 1V6CA 4EY6A 1CHNA 3FUUA 5G1NA 3DXYA 1X92A 3PUZA 1L5ZA 3VNVA 1YI2S 1G4CA 3CRQA 5IT5A 1PU2A 3ZJ5A 3COVA 1ICEB 2NQ2C 3OM0A 4EPWA 1QHGA 4LI3X 5KYYB 2C7QA 5E6UA 1EDEA 1TAGA 3FWPA 1KAOA 4Y6IA 3N5CA 1JHUA 5I7WA 1MQ8B 1DUSA 2RHSB 2D5CA 1L5YA 1YZHA 2QAGA 5LFAA 4LVNP 3H8VA 5E7JA 2SCUA 5FL7A 3NV7A 2V8PA 2DYAA 5AJYA 4IL5A 3I09A 1EWVA 3N87A 4U3JB 2FY1A 3N07A 3VXKA 3GFFA 1FVOA 3QVJA 1OY8A 1J8VA 1XZNA 1SU8A 3AEKA 2QJ3A 3I9V1 4WXPA 4D9CA 3DRSA 3BE8A 3EHDA 4N12A 3OUYB 2Z30A 1TQ2A 3KQYA 1WMEA 4TY8A 4FUTA 3TSOA 5ICFA 4RTRA 2DHEA 3TPCA 2V3VA 4EMUA 4D6PA 5HQ8A 2NVWA 3TIIA 1V9LA 2FW0A 2EP7A 5H9UA 2OV2A 2X8BA 1TJPB 3L4BC 4DQRA 5CYQA 4IH6A 3TOXA 5IF3A 4ENSA 1VLZA 5AI4A 3TUJC 3IUJA 4DU7A 3ZTWA 1G1AA 5JAQA 3EZ2A 2WW4A 4YRTA 2DXEA 4V2IA 5FUYA 4ZVSB 1GO2A 1OV4A 3LA0A 4CKZA 2W6IA 3UNXA 2GD1O 4YMSA 4KKXB 2MQLA 5M7EA 3SAJA 3C15C 3QATA 1XB2A 1Z35A 2D13A 1P75A 3IB3A 2D2VA 2A0FA 2E66A 1E2DA 3G8AA 2ROPA 5ITSA 3TW4A 2H59A 1ZHHA 1IEWA 2V7QD 1GRVA 3KHGA 2BGUA 4ZO7A 1W36C 4G1IA 3KKFA 4BJ5A 2NZCA 4YHHJ 1MO4A 4J75A 8RUCA 3AL3A 4EA9A 2V0GA 3D8SA 2JKZA 4LR7A 3ICLA 3A3NA 1WXQA 4GR5A 2DWCA 3LQKA 1P0IA 4KUEA 5TEWA 5D4NA 2NP7A 4KNVA 1AA9A 5JR3A 1ZVKA 2D2XA 1JT9A 2R8OA 4DXDA 2MSLA 4G0XA 3PLAE 4Y2PA 1XK6A 2WYHA 1A6LA 1TTHA 2IAJA 4FF3A 1WV0A 2XYRA 3MCUA 4PXYA 5FOWA 3NI2A 1TTQB 4NF2A 2CUNA 4HHJA 1S1MA 5LSOA 5EWGA 1RHUB 4JV1A 2HBRA 3ZE9A 2G67A 2I2CA 4LBWA 2CMFA 4ZCTA 4DV3J 3AWIA 1R89A 4KY3A 5KSWB 5CVVA 4GKJC 3BSOA 2ZU6A 3EAFA 4ZCQA 2P3SA 2YYSA 4I5FA 4KR0B 1QWSA 1U81A 5HEKA 1XRSB 2HL6A 3DEHA 2IYWA 4L4ZA 3ORSA 1I5OA 5F8MA 2PV0A 1C8LA 2RIJA 2E4ZA 3W60A 2OMOA 2P0AA 3H5NA 5JUWA 3CLHA 3H1TA 4OJHA 1GFIA 3RVSA 5KFUA 1M2EA 1AMNA 2ORWA 4ZS6A 1ZRMA 5B57C 3FFXA 2FMXA 2HIGA 4BAGA 1PBAA 1D8TA 2MQNA 5DXAA 5GJBA 2BFDA 1HARA 3FCAA 4AMZA 3PRJA 3G2JA 3H4MA 4N7RA 1K9SA 4WA8A 1NQUA 1Q14A 4X93A 1TU0A 3D3CJ 1U7WA 3F56A 4R5PB 4JBLA 4KVZA 1XKQA 2H9AA 1Z83A 5GOTA 1DCFA 3B3GA 3MM7B 1JLBB 3H4BA 1K0FA 3W6PA 3P26A 3EXG1 1LW2B 3D8RA 3WP1B 2AGVA 1P6UA 5KT7A 4RTLA 3Q3VA 1X7ZB 1QK5A 2IVYA 2GWHA 1ZAWA 1ODKA 3NGLA 1V1RA 4NE2A 3UQZA 2LXFA 4LQCA 2X3DA 3ZJYA 2ZEJA 3UMBA 2W5UA 4MDYA 2A92A 1P29A 2R7QA 1QO9A 1OWXA 2QRQA 5SZKB 2BKNA 1S3GA 3UBMA 2KI2A 1RWNA 2J41A 2IOFA 5DB4A 3LGAA 4J2OA 4IIHA 4BO9A 1P0QA 1KZHA 3GRKA 1Q8KA 4NBWA 1W4RA 4KQKA 4ZJOA 1WSDA 1YA4A 3KKZA 4LOLA 5JW6A 1A5TA 4QW9A 4J5OA 3EARA 4K9DA 3IHKA 4CLFA 1UP7A 1EK6A 2XY7A 5KNBD 1BUXA 4OB7A 2P5UA 1QGZA 3EZYA 1JV2B 4BHQA 4JSYA 2QMUB 4CO4A 1A9ZA 4KOAA 2OUGA 4NZ0A 2RB5A 3HQ4O 4Q47A 4IEFB 4BASA 1EI9A 3D0IE 4DMMA 1ZD1A 3JYQA 2H1IA 1VLLA 1W4BA 3UOWA 5G3ZA 3JTOA 4M9XA 2DK2A 4ZPAA 4KXMA 1JILA 1WNEA 1N6OA 3TB6A 2GAOA 4URGA 2DYKA 3IWNC 3PHBE 2PZLA 1C9YA 3EX7C 3R5GA 4DUGA 3V8EA 3V6DA 4JEMA 3HCOA 3I9NA 2VIHA 1TL7B 3NBAA 1MF7A 4OHOA 4J2HA 1T03A 1LQ2A 2RDJA 2O8NA 1SKMA 2XOEA 3EWIA 3T3PB 2R7MA 2OHHA 4NARA 3JXOA 4YWHA 3N6RA 3L46A 1EUDB 2TMYA 2RIRA 2PDAA 3HB7A 2PH5A 2HKIA 2OBXA 2O1SA 3BWEA 3AOCA 3MWEA 3MBKA 2V2KA 2IC5A 4DEVA 4O0LA 1BRMA 5BXYA 1F1BA 5FOXA 5L3SB 5TQ2A 3UNYA 2F4VF 4E14A 4GS5A 5IXUA 4XJSA 3UCZP 5H59A 4UDYX 1UJNA 2BR4A 2V6JA 3GLKA 3VWSA 2DB3A 1O89A 3DOCA 2GBIA 5HLFB 2J32A 5I5EA 4FFSA 5GADl 4O2AF 1RSZA 4YT4A 2JGDB 4HEJA 1OXUA 1GV1A 1J5EF 4OV6B 3ZE8A 1DLIA 4TS3A 3SZRA 2O8DA 3B6JA 2JJYA 1PDVA 3GEHA 1XV5A 3QITA 2Y71A 1HNIB 1E1YA 1FRVA 4JYCA 3WWOA 3OFHA 1A50B 2C8JA 2XPCA 4XYMA 2ZHBA 1EX6A 4ZDWA 4B4DA 1RYYA 3AVWA 2E5LF 1R8HA 1GFWB 2H08A 4PSVA 3F0TA 3ETHA 4IOJA 9RUBA 2HBYB 2XMSA 2ZUUA 2H5IB 4EL5A 4DWJA 3PQ3A 4BCAA 1MGPA 1N4DA 3SI7A 2H57A 3Q8RB 2HFKA 2BN4A 1EPUA 3W2TA 1XMVA 3IUMA 2AE1A 5LIRA 1FFYA 2I6QA 3E8XA 2PNFA 2BUBA 5F0UA 5CFOA 2JFZA 1C50A 2VPYA 3ZWYA 4RZIA 1VQLS 3NNNA 4YBZA 4KWCA 5HYVA 1RT3B 1VE6A 1S9FA 2NOAA 1NRIA 4CMGA 2QZPA 5E7OB 1H0SA 4G1CA 1UPBA 4MW7A 1ZCJA 3AJRA 1JF8A 1WNFA 1JNXX 2RE1A 2NQPA 1RDRA 4AO7A 3W5JA 3HL0A 3BDPA 5AXBA 3MM5A 1B23P 4LHVA 2H4XA 2FHPA 4IIFA 1G291 4UVHA 4GC6A 3GOHA 3NBPB 1LS1A 2XGSA 3M30A 4Y0NA 1HFJA 3ZLBA 2XMAA 2P1ZA 2WVDA 4GM1A 3DMTC 3U1NA 1G38A 2I2YA 4ZU3A 3IX7A 4PYRA 4H1TA 4CL8A 1TCUA 1JHQA 4Q1BA 2ODEA 2VJUA 3TPFA 3PF9A 3QVVA 1ZH2A 1N1GA 2V9KA 2QMYA 3HYNA 4CH1A 4MKAA 4V0SA 4UE2A 2W2OA 3HD1A 4TL9A 2Q1UA 4X7PA 4UMFA 4LGVA 3LWLA 1J2RA 3G82C 1MJFA 1UBLS 3YASA 2GBLC 1I0LA 2PZ8A 4FLFA 1L5LA 1NVEA 4RQTA 1XXLA 2IRWA 1RTHA 1JU4A 4W8HA 2VT6A 1RI7A 3H5SA 5JMNA 2WZ1A 2WYOA 2LXUA 3VDNB 3GGGA 2BJ3A 4K9OA 5LMUJ 4KIUA 4NHOA 3FGZA 1NSFA 1MX5A 2AFIE 4BGIA 2YIJA 2ZTSA 1RMYA 2UU9F 1B1AA 4QBFA 1Q1GA 3UJPA 3X1YA 4TXMA 1YUBA 1G3RA 3WGVA 4RGQA 1IKXB 1TVKB 4CGZA 2A1TS 5L3VA 5F9HA 3THWB 4QGBA 3AR4A 4P84A 3QUBA 1Q7CA 3D6AA 4NRUA 3H9UA 3WLPA 5BPHA 4MWEA 4RIGA 2ZTVA 3DVRX 3KEOA 1J21A 1OQ6A 1W76A 4DVJA 4OYRA 3AD8C 3KUDA 2EXUA 3QJJA 1DRUA 3M1VB 1LC3A 4UXHA 2BP7A 4H3HB 4B3SC 3J7Z5 3J7AC 4ZAYA 2QBYB 5CX1A 8ATCB 1HQEA 4WJBA 4OUDB 4NESA 2PZKA 3GROA 1RJDA 3O8BA 1Z47A 1TX4B 5IM0B 1V71A 3WX4A 5REQB 2MIIA 3CE6A 1TMMA 3T06B 3AKEA 2V7BA 1FXSA 2N3LA 1FVSA 1IM5A 5IFKA 2W4IA 2HAFA 4AJOA 4YIHA 1G2OA 5CCLA 1FXLA 3GTYX 3ZC3A 2I6FA 4L57A 2C96A 1RBZA 1XMPA 2U2FA 2LEBA 5DXJA 1QVWA 3ZHQA 1WE2A 3GLHA 1TYCA 1VC0A 4TROA 1U0SY 4MYRA 4QPCA 4I7EA 1M5VC 5KFCA 3SXUB 4DLZA 1SUIA 5C8YA 4M5NA 1IBMB 5D4PA 3DSRA 1RT2A 2QNBA 3F3SA 3QJLA 4PWUA 3RS3A 3TRDA 4MCAA 3FVVA 3QI2A 2PL5A 1JQKA 1QZUA 1E6WA 4DA7A 3W04A 3I5YA 4PAMA 1E89A 3ZE2B 4XGQA 3DHWC 4LY9A 4Y2JA 1ZVVA 2H48A 1KJJA 1IKYB 1PTJA 2O4CA 3MM4A 3CEJA 5LXTA 4FJ2A 4ZLNA 4OFZA 2JZOA 3K59A 4BMPB 1NJ5A 3DZBA 2J3JA 2R5WA 1SJRA 2HQFA 4F7VA 1O96A 3A2LA 2OZLA 5CP8A 2VZ9A 1FDTA 3PK0A 4QAQA 3C7DB 4MHSA 3V8BA 4X62F 1NBMD 2FFJA 1Y3HA 1VBKA 1A82A 3ER6A 3FI0A 1Y7TA 1T5TA 4B3TB 4F5YA 4QDUA 4EG8A 4AQYJ 1SXJE 5BOSA 5HP4A 3OVBA 4DADA 3W8GA 2RH5A 1KI2A 3C98A 5K14A 1GPBA 3M2VA 3A8KA 4X91A 4DR4B 4FKYA 3D66A 4F4KA 2WD7B 1I94C 2MZRA 2PT5A 4NXNB 2GHIA 1GSIA 1ISPA 2DHQA 2Q41A 3O94A 5KWIA 2PL3A 3E9NA 3WYFA 2D00A 2O23A 5TVKA 3VJKA 4IQXA 4EVRA 4HLUC 5I4KA 4PQUB 3KTFA 4A1FA 5AO9A 3H5RA 5JJLA 3FJ1A 3W2HA 4ROSA 3K96A 2JIZD 2WAYA 2XNKA 3N2YA 3DLCA 2L9WA 3TTYA 3RR2A 4QYXA 3A1NA 1CY1A 1HWUA 2DBYA 5CK4A 3PT5A 3KAQA 2ASLA 1AFJA 3OOEA 1X1EA 1LD3A 2LD4A 2GA8A 4DS3A 3KHRA 3EGDA 3A9SA 4UAJA 3UN5A 1RYRA 3E5NA 3NEJA 2VOOA 5C8XA 2BJEA 4DR7C 3NDBB 5DEIA 3PEUA 1T2CA 1FWLA 1V37A 4H1VA 1H8HD 4MVJE 4HXGA 1RHJA 1N75A 1UEIA 5HOEA 1E1CB 3QPVA 1U1QA 1MAVA 3TLAA 1QCDA 2DNRA 4C9BA 1JG7A 1PJZA 4L5CA 5DNAA 4ZMMA 1PNOA 1V8OA 2OXCA 3N5KA 3EGWB 4BLSA 2I65A 3OJFA 4EZ9A 3MFYA 2H9IA 2WTMA 2ECFA 2Z51A 4DT1B 3D02A 4MJ7A 1ZICA 3RF6A 3OVSA 4Z9XA 1F2GA 4G07A 1T5DX 2ZD1A 3KLFB 4ND2A 3N54B 4K4ZA 3CLTC 1V45E 4LHWA 1PV4A 3SBMA 1SMKA 4OK3A 4AZTA 4DR5C 1N34J 2B36A 4C7XA 3U6BA 1BC5A 4KXQA 5ICCA 1Q2UA 4NBUA 3WQSB 4HGRA 3H9JA 1FJHA 4WEQA 2BLLA 3R5DA 3IMQJ 2JAHA 4EYGA 3LIIA 3NS7B 3PSHA 3U1LA 3TDKA 1JH8A 3H42A 2RHDA 3NAZA 3P4UA 3CBQA 3V6JA 4Q2MA 3JQ7A 3D7KA 1L4LA 4NV0A 4RZUA 3M7VA 1AK2A 4AZVA 3ND7A 1NVKA 4F04B 4Y34A 3TA1A 2ZIXB 3KJNB 4MI3A 2P2BA 1DKMA 4GG1A 4OQLA 2EOAA 2JLAA 1W93A 3THTA 1Y7IA 3UDLA 1ACMA 2FKNA 3Q9LA 1QO0D 1L7XA 4F4JA 3T99A 3WRYC 3C97A 1YOVA 1S1UA 4M37A 4KRFA 1EE1A 2VPTA 2QZSA 4OD0A 3MFIA 2PX2A 5IBQA 4C3LA 3AVXA 5AE1A 2ZP1A 4JWKA 1SZJG 4LS3A 3ZD9A 5EP4A 1AC5A 3BFKA 1VRVA 1QYCA 4WDQA 4DPWA 2BEFA 1Y3JA 4LF6J 2R751 3KSMA 1Q0LA 3JAMD 1GTHA 4UVGA 1Z3CA 4FFVA 1C9DB 1Q22A 2AZXA 3BX1A 2YOGA 1VFPA 5B2EA 4K4XA 4I6YA 4PG8A 5J63A 3CNHA 4CCAA 3W34A 4ENUA 2V6MA 1O0CA 1MNAA 1VQKS 2O2CA 1HLPA 1JQLB 4KGMA 4MV7A 5AOVA 2W4CA 5HQLA 3C7CB 2VONA 1K8RA 3L6EA 4WAUA 2JJ4D 1DADA 4HAYA 3CF5Q 4A0SA 1SJ4P 2A67A 1VIAA 3U4HA 1UXJA 1LWOA 5DW0A 4RWEA 2AQIA 1PK8A 4K5SA 1X3LA 1SRQA 2FW9A 5BR4A 5G1PA 1VISA 2FVSA 4BQFA 3RV4A 3KBBA 2W2VA 4WINA 3ITHA 4DRYA 3RC3A 2QX8A 2VDKB 3T1YC 1TJ5A 5K2OA 4J16A 4KACA 5J2PA 3OQIA 4TZ6A 2FN9A 4IXDA 1XR7A 1Q1QA 2Z6UA 2XMDA 3AIIA 3R24A 3GFRA 1FJGF 3D3JA 3KJEA 1O9BA 1AVTA 2CPXA 3G6WA 3QU4A 4DR6B 4F21A 4LFAF 3KOMA 3QKRA 5CCMA 4X20B 3HI6A 4K2HA 4MR9B 1P1BA 3F1LA 4AZ0A 5B6PA 2QSJA 2AF4C 4D45A 5IWAB 4WE1A 2MKJA 3EA0A 3KVOA 1MR3F 5IC6B 4ZXFA 3ZW8A 3LDFA 1QR6A 1IRIA 3FMVA 4LF4J 3FHLA 4JB3A 4JYAB 3EZUA 4H7PA 4QICA 2AMCB 2ZUAA 2QL7A 2BFMA 4I4TA 2VUUA 4M6WB 4U8YA 4W9MC 1ECJA 5J5AA 3CO0S 5JEDA 1RADB 5LM3A 5IBCA 3MRTA 3STVA 5SZTA 2JCGA 3EDRA 3MIZA 2J7KA 3IAM6 5A4MS 2ECQA 2E5GA 3Q7PA 1Z22A 1N77A 4UOQA 2XVYA 4BYMA 1GX5A 1S1XA 4JODA 4UBIA 4U7PB 3TZCA 2OPSB 4LFBF 5LZ2A 4P53A 1P17A 1QGYA 4G5QA 5TPZD 2XSFA 5KTSA 3KPVA 4AF8A 4EKYA 4B9SA 4QQBA 5KIAA 4LDQA 5DYWA 4HTFB 3CNQS 4FF4A 2N1BA 3E5HA 3TEFA 4ZLJA 2W83A 1SVSA 2JL1A 5KFTA 2R60A 3USCS 2LTAA 1YJVA 2QTMA 4YRDA 3O31A 1GL6A 4KV7A 2XB9A 2AN9A 4AJEA 3ROFA 1QIKA 1OX6A 1NASA 1UPMB 1LBIA 4HEA1 1RM5A 2EGTA 3QAEA 4GXTA 1UBSB 3LLUA 3G5TA 4KSBA 1YRYE 1EP2B 3H17A 3KLIA 3IR7B 1R18A 4QW8A 2UVQA 2PSJA 1PR3A 2BGTA 4DR2B 1I6JA 5IJ0A 3ZCVA 4ENPA 4F4AA 3EPIA 1SUCA 3VVUA 2DU8A 3NMRA 1N2SA 1U8CB 4MV9A 5ELLA 2YTCA 2R7WA 2HMIB 3W9YA 2VYVD 2FFRA 1S9GA 4PQGA 4EARA 4W5NA 4YY3F 3F8TA 2H4ZA 2YICA 4NENB 2Y1EA 3UKDA 4MS3B 5HKAA 2HJHA 1ZW6A 4CO0A 2ZBRA 2FJUA 4C97A 1SWWA 4EMDA 4D98A 1HNZB 4B9NA 3QKIA 3AF3A 1P91A 1A96A 1M34B 1F3FA 5FULA 1GAEO 4YFUA 3DCJA 3B13B 2DLNA 3A3KA 3MR2A 5ALTA 1JA0A 3BERA 3PNBA 4G2TA 3V8NA 4OK5A 4UAGA 4PZYA 3L1KA 5BYSA 4HFMA 3FHOA 4UAUA 1LTKA 4LECA 1WHYA 2YW9A 3OEEA 4YJGB 3NRCA 2HPVA 4ZZ0A 4GOJA 4I1IA 4RZ3A 1RJ9B 3PQ4A 3PQFA 4E51A 1DY3A 4NLLA 3QGGA 4PE5B 9ABPA 1ZP6A 2AI2A 3CF6R 4KO0A 1T34A 4K4TA 4WJKB 4AL5A 4I1UA 1EWKA 4Z99A 4G97A 3K31A 2XZTA 3IR5A 5KOWA 4G85A 2BF7A 1GA1A 2UZ3A 3DKPA 4OHFA 2ALZA 1GPJA 1PT6A 4WUVA 3GZ7A 2NSCA 2AQKA 2VJPA 1U1DA 4LSZB 3DPIA 1YAJA 1ENYA 4IPTA 3IS3A 3TL6A 3R7DA 3HFGA 5B0GA 3DOMB 2HLUA 4ER8A 2Q7DA 2B8PA 2YNMC 1MJHA 3THXB 3PYFA 2MMCA 1T4CB 4A0QA 5JMTA 2JAWA 3RJMB 2BFOA 2DPMA 5IXJA 3NDPA 1FCJA 5JDCA 2Z9DA 2XC9A 1U7XA 1Z8HA 2O3JA 3IR6B 1W0JD 2OD2A 1CSJA 1L0BA 4BN5A 5KYUB 1CYDA 4Q02A 4O5OA 4LBVA 4QQFA 3AFOA 1ZVJA 2KO1A 2GN8A 3RTAA 3MJHA 3KMSA 1RQ0A 2VEOA 2I7CA 4PWYA 4R2IA 4XSHA 3LYHA 1CPYA 4MV8A 1WUJS 4GBJA 1R66A 4TSFA 3I53A 5CDHA 1VYUA 1UKEA 3EVCA 2YPYA 1NJSA 3VPSA 5C25B 4JI7B 3A9RA 4NBSA 2DR2A 4FKMA 3SHQA 4BMOB 4G67A 2CF6A 3ILIA 4EHBA 3U61B 4KIJA 4CG1A 2DR6A 3UE2A 1VGRA 2KYXA 4ZVPB 1C9NA 3OECA 3SF0A 2RNEA 3TZLA 3P96A 3H18A 3ZHSA 4BKQA 3WICA 3KKOA 3KUKA 4YMLA 1KAEA 2QD4A 3VR6D 3BGOS 1MEEA 3VTZA 2ZT6A 3AERA 4HDCA 4LJKA 1RP7A 3ZPXA 1OI4A 4RKFA 1KR5A 1DHMA 3MJTA 3S7RA 4DNQA 2D5AA 5FBWB 4JI0C 1IWAA 1AE1A 3QK7A 4Z53A 3DDWA 2OWEA 2HWKA 1G60A 4NV1A 4WE3A 1SJ9A 2CJBA 1QUFA 4OLHA 2GN0A 2ACKA 2IFTA 1ZG3A 4MMZB 2NXUA 2JIMA 2P3OA 3H9BA 2JIDA 3SF8A 4MWTA 2PGXA 1XA0A 3AVVA 2XCAA 3UX3A 3NCTA 1X4EA 2MDAA 3S2GA 3TECE 3WSTA 1IOVA 3HEAA 3D54A 3RUFA 1ONNA 5J4HA 1RCOB 3K70C 5HM8A 2HHVA 1W1UA 3BXZA 3AB7A 3AUFA 4KYTA 3IVAA 4C07A 1LV8A 5LA6A 4UARA 2R65A 3KOAA 5E9JA 5EVJA 1QSLA 3KKQA 2WDPA 4NE9C 4X6XA 4L2IB 5I48A 4P31A 2DQKA 2EFJA 3TKYA 3ZBQA 4QFDA 3R7NA 3LRPA 4KPEC 2O1PA 4CT0A 4WWHA 4B74A 4B76A 3SFUA 1P1RA 4FWIB 3O9VA 1BWPA 3FLMA 1ZTWA 4A2CA 5G0VA 1OB5A 1RI3A 1KMHB 1XZEA 4YP3A 2G77B 1QQBA 4CKBA 5IFLA 2C2KB 4GP9A 1S79A 3N5BA 1T5SA 2P2MA 4YTEA 3GX1A 1NSAA 4AJ9A 3X1ZA 2XAUA 1ZW1A 3IQXA 2YNFA 1WEXA 3FEXB 3WJ2A 4DV2F 2R8XA 1GTVA 1HHQA 2RAVA 1Q84A 1VTKA 2ZSDA 1EFLA 2I91A 1WVIA 2NLWA 1BQXA 2FDRA 3TLMA 4RAQA 3NW9A 5BJRA 1T6BY 4LV8B 5KWSA 4N18A 1K8AT 3BIJA 3U5TA 4DDTA 1Y33E 2VH7A 3U7IA 4LZAA 3GJXC 4KTTE 2HA0A 3CS3A 4I56A 3ELHA 2LDXA 1JJVA 2LU1A 4LJ6A 4DSEA 3IO5A 3AR9A 4L95C 1RPAA 4RTPA 3T7CA 4YLYA 4WFQA 1Y89A 4CMEA 2KXFA 2XTNA 3H5AA 1NOKA 1O6XA 3W6ZA 1AIPA 2ZJ4A 4OAOA 4L9SA 4ZANA 1U7LA 2OV6A 3FZGA 4WK0B 5HBGA 3HVTB 4G0ZA 1D3AA 4LKRA 1DKRA 1EGHA 4AXXA 1XDDA 3UFCX 5IC4A 1C1XA 3OJXA 2RGWA 2UYYA 1GA6A 4IO9Q 4JV5J 4W9RA 4ACBA 4P58A 4U7FA 1G41A 4YAUA 4HMPA 1ZSNA 3I45A 4HFRA 3MURP 2NZVG 3ND6A 4QHYA 2KLHA 3R97A 2F3QA 3OIVA 1X1BA 3P9PA 3UK2A 1P31A 4MI9A 1O6CA 5EZ6B 5KSOA 1IN4A 2VQFB 2MQOA 2VQ3A 4NLVA 3G9TA 4O3RA 2PMKA 5IQ6A 4LCEA 1QTQA 1CUWA 2VTBA 1G3QA 3GEPA 1TZBA 4IIJB 5ALDA 3IN5A 4P2XA 3OVMA 1ND5A 2WIBA 1MMLA 2QQEA 5B1HA 5BN4A 3MZ0A 2Y1XA 3G6KA 5HUJA 3NOOA 2V58A 2FSVC 1IBRA 3VKFA 4XJXA 1EFUA 4DDWA 2AHOB 2XUHA 4DUZB 4BWJA 1OT5A 4JJ7A 2FUKA 5HK8A 5JJ5A 4DYDA 1E99A 4XDCA 4JASB 3K6SB 5JNRA 3AF2A 5KDDA 4X65F 1YDFA 1SPBS 4BRUA 2GHWA 1YIJS 2KJWA 1KP9A 5IT9A 3T5PA 4CWBA 4HUQA 4RJIA 3QBVA 1BQ4A 4KBIA 1XMJA 1TM2A 2LEPA 1RVV1 3ZQJA 2VBFA 4N8OA 1M0WA 1PR2A 2HREA 1NW7A 4CLRA 1Z34A 2UUBB 3NC4A 1EGVB 1Z16A 1YJXA 1ZUWA 3R3XA 1YJAA 1A27A 1Z15A 3MC1A 3HNOA 3H9EO 5C8VA 1ZLXA 3LHFA 2AMFA 4IUYA 2IP4A 1P6QA 4KH0B 1W25A 3QSGA 1OPXA 4DSAA 3W2VB 5DRTA 2PJZA 4RY2A 3GEBA 1M5UA 1U9IA 1KI9A 3RT7A 4ZIRA 1S6QB 4LHZA 4WLFA 1NYTA 3VR4A 4OYOA 3PR1A 4K9SA 1Y8RB 2ZRHA 4FGWA 1ZD3A 1QKIA 1MNQA 2P4HX 1WU8A 1X9GA 1OE0A 2ZT5A 5B3LA 1DTWB 1R9NA 4D8YA 2ACMA 2WJYA 4RK7A 4IIVA 5KKAA 3SYTA 2NYIA 3CD7A 1CYEA 1SAYA 3R7BA 4EVSA 4HS4A 5JAIA 2BOVA 1ONSA 4FEEA 3WGHA 1YRXA 3ZQ6A 3S70A 4FSXA 2D9OA 3KJVB 1O5TA 5EKDA 1FSSA 3PGJA 3NWJA 5AIAA 2WABA 1TELA 1OC4A 4MI1A 2DH9A 1XJ0A 3TAUA 2PSSA 2Q5LA 4NCHA 1Q53A 3PKYA 1BRTA 1NXQA 2O52A 1J23A 4IFTA 2FDCA 4N01A 5DYGA 3WWYA 5H3CA 5EQTA 1FLVA 1W2IA 4DLRA 1Z39A 3PDUA 3IPXA 2GEJA 4F5WA 3GUHA 4HACB 5HBMA 2B0GA 2PY6A 1QFZA 4CM8B 1AY0A 3C6TB 2Z98A 3QF7A 1GPMA 8GPBA 3JAWB 5GZ1A 4MLPA 4W82A 2RS8A 5BRAA 2Z2JA 3TRFA 1PGQA 2HT6A 3GK3A 2APOA 4DFJA 2GC8A 3FDZA 4CMBA 2YNHA 3ULHA 3PHLA 2WHQA 4FIZA 3CCZA 2IKQA 4K6FA 4BMZA 2RU9A 3RRJA 4AY3A 1T0JB 3SU8A 5A19A 1FFXB 3IERA 5ALXA 1OY1A 4XIYA 3Q8KA 4PHTA 3UOAB 4DMRA 3NBUA 3ZZ0A 3TQTA 2VIIA 2Z3WA 3K6RA 1Z73A 3H04A 4C01A 1J2TA 3WLQA 3CJTA 1JHPA 2P2JA 4CO2A 2A84A 1YZ3A 3ANYB 3H87A 3LG2A 3LX5A 1WCYA 4ZOQI 3PE3A 4NV3A 1H1TA 3UEOA 2I2FA 2J8ZA 1ZZNA 1T95A 1RU2A 1GAQA 3TH5A 3NALA 3C6KA 4UHEA 3K6JA 4R8KA 4UEJA 2PKQO 3HJUA 2ZBVA 2CQHA 3OUZA 1X5TA 1BJRE 1NG1A 4WY2A 1RBQA 1H0HA 3IOBA 3L7YA 1I9GA 4CO1A 1ISSA 5LQJA 5CUQA 3GVIA 2KKHA 1SBYA 4KGKA 2QZ4A 4RBUA 2XXJA 1WUTA 3AD7C 3SNHA 3QZ8A 3QU9A 1DAFA 1XEXA 4EJSB 1JK9B 3E27A 2KBFA 2HZ7A 5FUBA 2BEJA 2GJIA 2A14A 1KJYA 1JIKA 2QTNA 4I67A 2YJGA 2TMDA 1NE2A 1VCHA 4I55A 1RRVA 1YFJA 4IJVA 4UJ3A 1M2OB 2CPEA 4ME6A 3LBFA 1RT6A 2VFVA 1T3LA 5HIKA 3TG8A 3JS9A 2VPZB 1AV6A 5KTKA 3VZRA 3P97A 4RCYA 1PGPA 4ACAA 3HSJA 1CJVA 4RW4A 1WQ1R 3B48A 2G0AA 3JQBA 2ONKA 1SCIA 1P8JA 5F3WB 1T10A 1CQJB 4MCHA 4OXYA 1YR8A 2SKCA 5B09A 4FGZA 1JWLA 3D9QX 5K7SA 2I9SA 2XY6A 1IOWA 1RQ7A 1D6SA 2OK8A 4L72B 2O7RA 3UWDA 1NKSA 3PA8A 5AE3A 3QZUA 5EC8A 3URKA 4IVNA 2PVSA 1YRUA 5L38A 2R6DA 1NU6A 3RIYA 2WU4A 5BSFA 4ZI3A 3NL0A 3UMVA 3BFXA 3HVHA 2CHUA 2Q50A 3N01A 3DU6A 1B15A 2BMWA 5HIAA 4KRXA 1D8AA 3GMGA 3FNEA 2LYVA 5KFFA 2B9VA 3ZD7A 4YRLA 2I54A 4DYVA 3NIWA 3GWCA 3MWDA 1IG3A 4HI2A 4QAJA 2DECA 3TNJA 2WINI 2PTGA 1K2WA 4IUDS 4PC3A 4X66C 1ONPA 1FRLA 2L42A 2RH9B 1IUOA 2V69A 8AT1A 1TMYA 4WOCA 2HK8A 2VDHA 4L4RA 4GYYA 3D5EA 4K7JA 1ZKDA 1CUYA 2QT7A 4AE5A 3N0VA 2M6RA 5K8CA 3N76A 5BRJA 3U7RA 2WG0A 5F73A 2BPOA 4U1RA 2BX6A 1JIQA 1T8YA 3DDOA 4CO5A 1C9EA 1Y6ZA 2AC2A 1RE1A 3HHDA 4KWTA 3HK2A 1NATA 4B9MA 1JDTA 5JSKA 3DM2B 3P9IA 4B8ZA 4ID3A 4FFLA 1B0PA 4BVLA 2OEPA 3SQLA 1Q95A 2GM5A 3SEAA 2M3DA 3JYTA 1G1XA 2IQ5A 3QLVA 4M9SA 2JI7A 4EO6A 3KLPX 4IDAA 2JLQA 1FDDA 2E9RX 1FQOA 4JU9A 3C3DA 4OXKA 1C14A 1W85A 2BQ3A 4BQQA 4LJ9A 4DMCA 3KJQB 2VJYA 2VNKA 3SSRA 4J1TC 1XALA 1ARZA 1XDGA 2RF2A 4FOPA 4MRMA 1T9XA 1GXUA 1CUCA 4EG0A 2C0CA 1XHFA 1KI6B 2PMHA 1U6KA 2PKCA 2XMGA 5ALEA 1C1YA 2TRSB 1T8EA 2RGXA 1N33B 3MEQA 1IN6A 2EX0A 4JI6J 4JIGA 2OM2A 1UAWA 5D4LA 1I1HA 3PF8A 4TTJA 1G3UA 1D6MA 3AFIA 3GG0A 4G86A 3IOMA 5KNCD 5A6SB 1R6AA 4CLYA 2F4VJ 1GCOA 3IQZA 4KPUA 4V1CA 4O8ZA 3FUYA 5EJ4A 1JIHA 2WJPA 4QXPA 4IH7A 1TK5A 1XEWX 2FV8A 5EZ5A 4EMBA 3ZWXA 4PAAA 1SC4A 2INGX 4N39A 1PRYA 1YMUA 4ZYXA 4CM9D 3KHUA 1IBLF 3OWOA 1J5EJ 1ZD4A 3KPWA 4M1TA 4RUHA 4EGJA 4JEHA 2Z56A 1RTZA 1KGDA 4P4SB 2C2YA 3EC2A 2VUSA 3KK0A 5LLTA 3MUMP 2H3EA 5EA2A 5EXSA 3F6CA 3FRHA 5H3LA 1WUIS 4Z8YA 3IMLA 2H1FA 4X3CA 4ZVMA 4BO5A 1AF4A 1HT0A 1RR6A 5CDFE 3HP6A 4TV9B 4OBBA 2JATA 4PIPA 3TO8A 5LQNA 1GAWA 2E5LJ 4MK4A 4DQ0A 3UMYA 4DQDA 4MGIR 1QYVA 4B6JA 3K1ZA 2AD1A 4LPSA 1MAAA 2PEBA 1EZZA 1KOGA 4D9MA 1V5FA 2VBYA 3N39C 4ARCA 4JI3F 4RVHA 1WF6A 3I3SR 3SIPB 5PNTA 1B6RA 2R6R1 2WM3A 4XGKA 1GQEA 2H92A 3GVHA 1QRRA 3TX8A 3H2LA 3K8WA 3AAWB 1N8NA 2FTRA 3KV1A 1SL1A 5FFMA 2YJ4A 3I4CA 1BXRA 1TMJA 3HA2A 2GXAA 4RNNA 2Q6BA 3GLJA 4KIWA 3PYMA 1FXWF 4Z7YA 3QBEA 1CQIA 5HDQA 1CNFA 3WLHA 2C2XA 4KXVA 1U4NA 5F2OA 3TI7A 3MPVA 1QHNA 2I9PA 1DGQA 1YGPA 2Q9BA 4DW8A 2D2IA 4R8UB 1RRKA 1UQRA 5EJ5A 1V2HE 1RWBA 4EPYA 3L82B 2XQKA 1MJGM 3E9EA 1B3TA 2WV9A 3EK2A 4JI8J 1Q3HA 4WUTA 2PGLA 5HIMA 4A03A 1BHJA 1V4VA 4W5TA 5B64A 4ENOA 2AQ8A 4OI4A 2AOTA 2ISCA 2EZ9A 5B2ZA 4LZWA 1SUBA 2EZUA 4ND8B 5K9FA 1H85A 3M34A 5LNK1 3T3OA 3QF4B 1Q7TA 3DHNA 3C6UA 4A2PA 1TKRA 5FOVA 1QVGR 4GO5X 4EF5A 3B20A 2XODA 4N0DA 2KFNA 1K3UB 2VFTA 3GJQB 3B36A 3RUAA 2O6HA 3V4VB 4D44A 3LWZA 2DPIA 2E1AA 4ZAFA 1NO8A 5KYWB 1CR2A 1VPTA 2C1XA 1W5AA 4FCVA 3B2QA 3DL0A 1Y34E 4AX4A 3D4BA 1MO3A 4NMMA 1QM4A 3ZIAD 1N4AA 4LJ8A 2HNDA 3EVGA 2UU9J 4DL3A 4AD6A 3QKWA 1KPIA 3EEOA 4NZ6A 2AG5A 3BFPA 2ZXUA 4O25A 4PEOA 2R86A 2Q66A 1P9RA 2BFPA 4S35A 3CQ3A 2Q6OA 1R6YA 3CUVA 1YL5A 3ZUGA 5J40A 4N47A 2GPSA 3UUGA 4LQDA 1T4DA 1J00A 2ODNA 3HBLA 2ILVA 3T7JA 4LF9J 1KIAA 1MMNA 1N3BA 3RYLA 3L6BA 4JI1C 4RJVA 5AW8A 2D7VA 3H2UB 1HE2A 1I01A 1R0CB 3I1JA 2QDXA 2DEIA 2X1VA 1O1YA 2ZANA 1ZMTA 1P8AA 5EFOA 3EXHB 1YZQA 1MG0A 2ODBA 2UAGA 4OAPA 2ONFA 3FJ2A 1U1LA 2KB0A 1KPGA 1CULC 1CS0A 1Z62A 4DV4F 1Z5PA 4DM3A 1TQ8A 1JNRB 3QMMA 4AYBD 4YCLA 1DL5A 4GGPA 1OLXB 3CC4S 1RBLA 1YDEA 3LJKA 3O2QB 3HHKA 4B40A 2XVZA 1ZNYA 2IX3A 1JYFA 2HZVA 2E2WA 4HVTA 2Y6VA 3AJ8A 2QA4G 1ZMXA 1L8XA 3JQAA 2F3PA 2FMFA 2CSUA 4AMBA 4WZAA 4FS1A 1YRHA 3A6DA 5KYXA 1K89A 2O0HA 4DFKA 1Z8FA 4K6HA 3O93A 3NH9A 3OETA 4ZVOB 1UL3A 1USPB 1J0AA 2DKFA 2QRNA 1HMPA 3FNFA 1N6PA 4IFEA 4JI5F 4R9RA 3CVVA 4BCCA 3ZYCA 2AFVA 2DHSA 4MS4B 4A46A 1KYXA 2WB4A 3AETA 4Y00A 4OXQA 4GVPA 4PC1A 5H9VA 3HBFA 3SDEB 2IRUA 3CCLS 5D5PA 3RS9A 2OOKA 4M7OA 2ZOFA 3ASZA 2GJKA 2CG4A 3B70A 4A4DA 1U0HC 3M4YA 2IJFA 2EL9A 4BO4A 4YJ2A 2BGIA 3L6CA 5AYVA 3VSEA 1UCNA 2SXLA 1P73A 4NJMB 3PXBA 4X62J 1KO5A 2PL9A 4M1ZA 3VRHA 4QX6A 2W48A 1U2QA 2QJOA 2EHDA 1IB0A 3C14A 3L3BA 5DM60 1MOPA 5SICE 4W5WA 1LW6E 2C77A 2FOXA 2AS0A 2FWRA 1IY2A 3G7NA 2O7VA 4P7GA 4F5EA 1ECLA 3L7BA 3WLRA 5AM0A 3N9IA 1E2UA 4DG1A 1PYDA 4BQEA 2E7ZA 2ZDPA 3G17A 4PFJA 3EIOA 3P4XA 1L3SA 2CNBA 2O8BA 4ID5A 3IXQA 2G1PA 4PVCA 5A6PA 3TW0A 1VPDA 1UOQA 4HTJA 3PD1A 1M2JA 3RAEC 3QIAA 1E61A 2MTBA 4KQCA 3HVKA 2V96A 3L02A 5A8RA 2B37A 1LNSA 3VZSA 1TP7A 1AG9A 4L9RA 2D7SA 4QSMA 3OHAA 1FVXA 3JSMB 3GEIA 4HSGA 2E7WA 3LXRA 4LF8B 3RRBA 3EIXA 3IPAA 3OZCA 3H5XA 3O8CA 5A4AA 2XF8A 1FFWA 2O01C 3AR7A 2EYUA 2JEYA 3BGWA 3OQ6A 4ZVTB 3O8DA 4PFSA 3IBCB 2AGPA 3UWKA 2V2ZA 3LK6A 3BH6A 3IEKA 1LWEB 4DLUA 1WDDA 2VPQA 3WWZA 5KOIA 4C48A 3HWRA 2J4CA 3OLZA 1MP0A 4Y2YA 1Z5GA 2CK3A 4EUSA 5AUNB 5EPEA 1LPSA 2ZRFA 1G7RA 3PEEA 3KQSA 2CJYB 2CV2A 1JAZA 1F0YA 2XSJB 4E5VA 2G9OA 2VXYA 3CX8A 5HMWA 5BR8F 4DVGA 4IDHA 1J0EA 3UT6A 5EIEA 3V4FA 4M7PA 2Q3DA 4HZUB 1NR5A 1X80A 2BANA 2HLPA 2XE4A 4QWWA 3OMLA 3S8YA 2O7QA 3CWQA 2F43A 5HIIA 3GCGA 2OPRB 5J2NA 3EZFA 1AHHA 3WFJA 2AN3A 2XB8A 1HEUA 4YMIA 4HT5A 3L84A 3VVCA 4PAQA 5JT1A 4DABA 1QTRA 5KJFA 4KC0A 2WVEA 3BO2A 4IVRA 4QWMA 1ADYA 2ZYDA 4J9RA 1G6OA 1Y8AA 1VHWA 4HGNA 3D2AA 4JU8A 1FTRA 3PJWA 3BHMA 4BX0A 5JS7A 2EVWX 4YBRA 1J39A 3PYGA 3V81B 2RGGA 2HS3A 3ZLTA 5JAMA 2P9GA 5A8WA 4OXRA 1TYAE 4QD3A 2VQEB 2ZXFA 4Y6LA 4B3MC 1V1MB 4JJIA 2F1JA 2XTJA 2YZNA 4J0IA 4ID9A 3V4IB 3BGFA 4JI2C 3QJYA 4I1PA 1LDEA 3AEUB 4H7HA 1YL7A 1H0RA 5A2GA 3FOWA 3M9WA 2ETVA 2MYPA 3MILA 2J8SA 1KDZA 2AG1A 4HB2A 2P67A 1YJ7A 4E12A 3GYBA 3NHLA 3AVUA 3OPYB 2W2QP 2Q9UA 4NG5A 3I55S 4HDOB 4PGGA 4EYQA 1ODSA 1MVOA 1XTJA 1DAEA 1HA1A 1VYHA 4LVCA 3WB1A 1X7HA 1EZ1A 3T5MA 2R4UA 2ZJ1A 1OXTA 4OBEA 2NV0A 1AGNA 4BE7B 5K0GA 1EWTA 4PLZA 2P65A 4MX8A 2XLKA 3TQOA 2BWJA 3CWZA 4FS2A 2O7NA 1UBJS 1NQXA 1YWXA 1CC1S 2QAGB 4O4HF 4MEAA 5JSQA 2SCUB 4R3WA 2J9CA 4DLAA 2W6MA 2H29A 5IYZF 1CT9A 2CKDA 3O21A 2EX1A 5BV2P 4A2QA 5KC9A 2D1RA 5JQGA 3T3IA 2R6GA 4K9LA 1JAIA 1M1ZA 3JTEA 3VYUB 3AEKB 3QELB 4AFNA 1L6RA 2MQ8A 2FIUA 3DRSB 2A6OA 2Z30B 1GL3A 4GUDA 1TUEA 4YQFA 4TY8B 4GX0A 1KN6A 1DLOA 2VP9A 2VT3A 1XE3A 4NNOA 2W9BB 2Q2OA 1NVUQ 1TDJA 4XD7A 3RUDA 3NHPA 4AWBA 4RX6A 4OL8A 5FTWA 2WOMA 4MKXA 1JSRA 2UXCC 4EHKA 2A18A 4ND7A 3FG9A 3MAHA 5HJEA 1WKBA 4L6AA 2YFHA 4UFPA 4C8MA 1M0TA 2MY7A 3G0OA 5AESA 2GJ4A 4E88A 2IJNA 4JLMA 1MW7A 1MQAA 4LFAJ 1JR3A 4YX9A 1IRXA 1M8PA 3AVQA 3ZDEA 1Q82T 4OJ3A 3H1GA 1KH2A 2OKQA 4WY8A 2CG8A 5CA1F 2HQRA 1Y9EA 5IAEA 1HQDA 2XW6A 2XUKA 4B7ZA 2ZRAA 5C2JB 4P9NA 4OHZA 4Q6BA 3BXPA 2A0FB 3C6ZA 1PV1A 4MH0R 4BNHA 5KX5A 1DG1G 2ADMA 2IZOA 2C28A 2ZWVA 3DWGA 1R8SA 3JPYA 5B1SA 2G0NA 3QWBA 5ETRA 3U3ZA 4MWZA 2GAFA 3PXEA 4TU9A 4DF4A 2WLSA 1X4CA 2QB5A 3ZJVA 1HDYA 3X43A 3AQOA 2GN4A 1KETA 4K9MA 2CL0X 1FX4A 2ZITA 4KGXB 3BPDA 5FKJA 4RC9A 2FHJD 1ESZA 1ZU4A 3A3NB 1WDLA 4RBVA 4IO1A 1AX9A 4CUKA 4KHPB 2GDZA 1BX1A 3MBIA 3UDVA 2VC1A 3Q12A 4QBHA 4XRRA 4YJDA 4ZVLA 1E6LA 3GLGE 2I7XA 3FY4A 4LFBJ 1ISHA 4EKIA 3TD6A 4TY9A 1R4MB 3F9CA 3FUXA 4QELA 5GMEA 4QOEA 3ZXXA 4ENQA 3NONA 4BBYA 2IPXA 3LNCA 2H31A 3Q1LA 2HBRB 3AF4A 4DV6F 4NC9A 4YUWA 2F3JA 4I7FB 3N70A 4PW0A 2IA0A 5U9CA 1X5PA 1YJ5A 3OC6A 1J8QA 1KF0A 1N6IA 2ES4A 5IUKC 4CDIA 2O0JA 1Y5NA 2B2CA 4UF4A 2PR7A 4IG0A 3BE6A 2GPNA 1SN7A 1HSZA 2ZTMA 3C6XA 4H7FA 4JP3A 4DSJA 1VK8A 3EGVA 2X7JA 5JDIA 4Y18A 5FV4A 1I5OB 3JQ8B 2HRBA 2X7IA 4EI8A 4A48A 1N7HA 2R2UA 1IBKC 1CUAA 3IQIX 4KDEA 3RROA 3GHHA 1M1YA 2QN2A 2VHYA 1HYQA 5KFLA 1UWVA 4C3UA 5KCZA 1U11A 1LQLA 1PP4A 1XMOB 2VO1A 2FVRA 4IMJB 4TKMA 3VAKA 3UGKA 1OYVA 4PVDA 4DRZA 4YY3J 5H80A 2M4MA 2ZM6C 1SKQA 3NOXA 5DM7Q 5JCJA 4MVJH 2Q9CA 3NOGA 2SKDA 3GDGA 4ECXA 3NKVA 5FA5A 4QPZA 4YMWA 2VASA 1JE1A 1TU0B 1E69A 4RDHA 4ATNA 4XARA 5AHKA 1ODFA 1ZESA 3W3AA 3TMKA 3ZIDA 3ZEIA 4WXHA 4ZI7F 4JWTA 4F5ZA 4D9BA 2X14A 4Y67A 4DANA 1VKHA 4HL6A 2UVWA 3LI2A 1Z4IA 1VDHA 1ZMBA 2W9CA 3KQOA 2OAP1 2ZQZA 1H8ED 1NMXA 5K45A 4D4GA 2PK3A 1UJCA 4YCCA 4FK8A 4DFPA 5JSYA 1O90A 4DCOA 3DOOA 1Z7EA 1EFKA 3VNAA 3DMPA 1Q19A 5H9EJ 4RM2A 1V1RB 5B55A 4V0NA 3EE6A 4G1EB 4PGAA 4R3NA 2FXVA 3CJSA 2XYGA 4CIDA 4YJFB 1OIXA 1E20A 1S7IA 4KR9A 2RBGA 721PA 1RWNB 3NASA 1POXA 2Q1SA 3EGXA 1CDEA 1KA9H 1QFMA 1U1CA 2OD4A 5JVGQ 5FX2A 4FMCF 4CM7A 4Y1RA 4N6GA 4YRJA 5BQ3A 1AB6A 1RTTA 1O5IA 3UXEA 5HJ7A 2ASBA 2Q5IA 2ZRLA 3B5EA 2WSBA 4ARIA 3PFGA 3LWNA 2QSYA <