2ZZMA

The complex structure of atrm5 and trnaleu
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
333
structure length
329
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVSYAPREYILALDFKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 82
structure length 329
sequence length 333
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zzmA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zzmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zzmA03
3OZRA 5EQJB 3NVMB 4QQKA 1NT2A 4PCLA 2JHCA 5CD1A 2XYQA 3HM2A 2R3SA 1F3LA 3OPNA 4CXMA 2XVAA 5HIJA 1NW6A 1Z3CA 3AJDA 2Q41A 3GNLA 4GOMD 5FULA 4C04A 3FTFA 3PFGA 5FA5A 3NTVA 3LCUA 1VE3A 4HC4A 3HEMA 2B2CA 4IKPA 3BWBA 4M37A 4EMSA 10MHA 2JH9A 3CCFA 1NW7A 3SSMA 1G8AA 2VDWA 2HMYB 3G88A 4XUDA 3ER9A 2AOVA 3GGDA 2Y1WA 5E1OA 4XUEA 3TRKA 3HTXA 3GJYA 4QTUB 2AOUA 4KIGA 3A27A 3GRUA 1M0EA 1XDSA 3IYLW 3G2MA 5EKUA 1X1CA 4CKCA 3VSEA 5FUBA 5HFJA 1P39A 3SXJA 2YVLA 2PV0A 1BKYA 3DUWA 1D2HA 2PT6A 4KVZA 4YUVA 1XDZA 3HVHA 2PX8A 1SVUA 3M6XA 5LQUA 3UA4A 2AZTA 4MQ4A 4PYNA 2WA2A 4X61A 3R3HA 1JSXA 4X60A 4HSGA 2EFJA 3C0KA 2AOUB 4LWPA 5EIWA 3UJDA 4HGYA 2ZIGA 3CBGA 3DR5A 2VS1A 1I9GA 1ORIA 5CVEA 3MCTA 2P3QA 2QY6A 3UJBA 3P9CA 1IY9A 1MJFA 2NXCA 2ZIFA 2EJTA 3M6VA 3OU6A 4RYLA 5FA8A 4Y2HA 4ER7A 5K01A 5K0EA 2AOXA 5KVAA 3LDGA 4AZTA 3NDJA 5E1DA 4BY9E 1L9KA 1NE2A 4C08A 5DSXA 3ELYA 3TM4A 2PXAA 3P8ZA 5DRYA 4RVGA 3DMHA 2GLUA 3OCJA 1INLA 5GM1A 2O05A 2ZZMA 2C7OA 4MTLA 4RVDA 2I7CA 3BXOA 2PY6A 2BR5A 2UYOA 2XYVA 3TQSA 2YUIA 1VL5A 1WXWA 1ZGAA 4E33A 2PX2A 4RTQA 3NMUF 3R0QA 4KW7A 1VBFA 2E5WA 4ATNA 3R9XB 5ICGA 3HCBA 4M36A 4GC9A 2IBSA 2O0LA 4BLUA 2IBTA 3A7DA 1XJ5A 4OBXA 3SMQA 3KR9A 3E23A 3R24A 3EVFA 2B3TA 2VZ9A 5DM1A 2V74B 1OR8A 2ZTHA 1SUSA 1R18A 4NECA 2GA9A 2ZLBA 3NDIA 4CKBA 5CVUA 1FBNA 3HA7A 2GPYA 2OB1A 1EJ6A 4AZWA 2AOWA 3AWIA 2I62A 1KPGA 4LECA 5D1NA 2YX1A 3FPFA 4C05A 4E31A 2O07A 2P3OA 3VC1A 2QYOA 3U81A 4YV2A 4E70A 1FP1D 4C06A 2YXDA 2OKCA 4PNEA 1PJZA 4YV1A 1DCTA 3GRRA 1D2CA 3UJAA 1BC5A 2NYUA 5ICCA 1HMYA 5C1IA 4PYOA 2GS9A 2CWWA 4R6WA 3ERCA 5CVVA 2P8JA 2OXTA 5C0OE 2XYRA 3TMAA 4C03A 4ZTBA 1ORHA 2I9KA 1O54A 2I6GA 2G71A 2PLWA 3KQMA 1Y8CA 4GF5A 3KPYA 3C3PA 3D2LA 5EMKA 5GWXA 1WS6A 4B17A 2C7RA 2O57A 1IM8A 5DPMA 1G6Q1 3TOSA 3LBFA 4O29A 5GINE 3ORHA 4E2ZA 5HILA 3EVBA 5FTWA 1I1NA 1YUBA 1KPHA 4EVIA 5HIKA 1AV6A 4KDRA 3TR6A 5E1BA 3B89A 3HP7A 3EGIA 5E8JA 3V8VA 2CMGA 1KYZA 2AOTA 5DX0A 2BZGA 2H00A 2UYCA 3GRZA 4GEKA 2IDKA 2FK8A 3DULA 2BM8A 1H1DA 4PGGA 3I53A 1B42A 3DOUA 4BP1A 3M70A 1NV9A 4F84A 1V39A 2A14A 4X1OA 2ZBPA 3I5UA 5HIMA 3MTEA 5CM2Z 2ZBRA 4AZSA 2ADMA 3B7PA 2IH4A 2BH2A 4RTJA 2AVNA 1M6YA 3DMGA 2AN4A 1P1BA 2EG5A 2C7PA 1PRYA 1JG1A 3CJQA 4GOOD 4IV8A 1KXZA 4JXJA 1JR4A 2UYQA 3MAGA 3L8DA 3G89A 3MERA 4FGZA 3B3JA 5K8VA 2WK1A 1KIAA 2OPBA 4FS8A 3UBTA 3SGLA 3ID6C 4PGHA 2BM9A 4DZRA 2FCAA 2NXJA 1XCJA 3KPUA 3G8AA 4FT4A 4M7RA 2ORED 3KQYA 4CWAA 5EC8A 3LPMA 3CC8A 5DXJA 5K0CA 1D2GA 5E9JA 4MHTA 2YTZA 2IFTA 2DPMA 2O06A 4HG2A 4YV0A 3I58A 3LGAA 4DQ0A 2ZCJA 1X1BA 5DX1A 1N7IA 3HCAA 4UOEA 3BT7A 3P9KA 4R05A 4U7TB 5GIOE 4E32A 4PYJA 1HNNA 4GBED 2VP3A 4AZVA 2BR4A 1G60A 3IV6A 1BHJA 2VDUE 3KPJA 4LWOA 4PYQA 5GOZA 4RTNA 3FRHA 3RIEA 1ZQ9A 3JWJA 4A6EA 1R6AA 3G2OA 1KP9A 1VQ1A 2AS0A 3CKKA 3DH0A 3JWHA 3PB3A 5D1HA 1WXXA 4G56A 4F85A 1AQJA 3KQTA 1XVAA 3Q87B 1VPTA 5LQNA 3KR2A 2QE6A 5GIPE 5HIIA 2PKWA 1JTEA 4QTTB 3ER8A 3UJ7A 1RI3A 4DM3A 4F86A 3P2IA 5FHQA 4RTKA 1EQAA 2HV9A 5H02A 1QAOA 3CJRA 4IV0A 3FUWA 2GB4A 5MHTA 3FYDA 3OE4A 1RJEA 2EX4A 1L3IA 5KYGA 2HTEA 1NW5A 4CTJA 3PS9A 5ICFA 4V0QA 4MWZA 5E9WA 2B9EA 1SG9A 3EVDA 2PGXA 3IEIA 1G8SA 1NBIA 5EEHA 3DLIA 1MHTA 1L3BA 3QOWA 1RI1A 3FUTA 3OE5A 3QOXA 3LSTA 1R74A 2FK7A 1QANA 5DSTA 4YMHA 2QRVA 4H0NA 1XXLA 4QPNA 1RI4A 2OB2A 1WZNA 1R00A 3EVCA 2OO3A 1X19A 3ME5A 4FT2A 1N7JA 5DM4A 5G02A 2P40A 5CIYA 2JG3A 4ISCA 1Q0TA 4YMGA 3TKYA 1UIRA 1G38A 3P9NA 2IGTA 4XUCA 4V0RA 4PCAA 2ERCA 5JR3A 5E1MA 4OBWA 3G5TA 4P7GA 1QYRA 3THRA 5EEGA 4ER5A 5LQJA 3PFHA 4IWNA 5E9QA 1L1EA 1G55A 3HCDA 5DX8A 3SX0A 5KQSA 3BZBA 4X63A 3T7TA 2IH5A 3DMFA 3KQPA 2ZULA 1AF7A 4HTFA 3EVEA 5HOQA 2YR0A 1R8YA 1UFKA 4RWZA 2FYTA 2HNKA 1TPYA 2CKDA 2ONZA 4WXHA 4FZVA 4MIKA 5E2AA 5DT2A 3VYWA 3T7SA 2GAFA 2Z6UA 3DLCA 5E2BA 3UJ9A 3F4KA 1SQGA 4DKJA 2GH1A 5EMMA 2G70A 2H11A 2JH8A 4OX9Y 1P91A 3GDHA 3I9FA 2G72A 3DXZA 1RJGA 5JUWA 3ELWA 5K0FA 4EQZA 5GM2A 4PONA 4BP3A 5IH3A 4K6MA 2AN3A 3P9IA 3UWPA 2P3LA 3ANXA 3CVOA 5EGSA 3E05A 3G7UA 2JHPA 2YXLA 3FPEA 3KKZA 5EMJA 4DA4A 3FTEA 3BGDA 4HRAA 3HCCA 3T7RA 3TM5A 3FTDA 1N2XA 3A26A 1L3CA 4L7VA 4RTLA 3EMDA 5ICEA 3R6TA 1ZKDA 1I4WA 3S68A 2AVDA 3LKDA 3M4XA 2XVMA 3P2EA 5U4XA 3G2PA 4DCGA 4U7PB 3KU1A 3VC2A 2PT9A 3HCEA 5LQAA 2PX5A 5EKXA 3PX2A 1T43A 4C4AA 1EIZA 2FHPA 2PX4A 3AXTA 4HGZA 4A6DA 3BUSA 2C7QA 3G8BA 1XTPA 5EIFA 3E8SA 5HEKA 5LQCA 1KR5A 5DM2A 5EZQA 5GP1A 5FWDA 2YXEA 1FP2A 5FWAA 3EPPA 4HH4A 3EVAA 3IHTA 3SR4A 3FRIA 1YF3A 3BKXA 5LQKA 3UJ8A 5LR6A 5CVDA 2IDJA 4KDCA 4BLWA 5IKMA 2ZWVA 3A25A 3GWZA 4OQDA 5F2KA 3BWMA 2P7IA 3A4TA 3NW9A 3OU7A 5EVJA 3NWEA 4QDKA 2CL5A 4RTOA 3DTNA 1ZGJA 3P2KA 3NJRA 4M38A 3T0IA 5F2NA 4PYMA 4XCXA 1XDUA 5P8WA 2PSSA 3HVJA 3PVCA 2P1DA 5FCDA 1F38A 3EVGA 5E8RA 2YQZA 4GQBA 4X41A 3EMBA 5LSAA 2Z6QA 1QAMA 2ESRA 4E30A 3DXXA 3SM3A 8MHTA 1VIDA 3UZUA 5DRTA 3FPGA 3HNRA 1QAQA 3KR0A 4P7FA 5BXYA 2KW5A 3G5LA 1M6EX 5T6BA 2G1PA 1ZG3A 4RVHA 4E2WA 3BKWA 3SVZA 5C9ZA 1NKVA 1WG8A 1JTFA 5BW4A 3UJCA 3HVKA 5FADA 3MB5A 3LBYA 5T64A 4AX8A 1KHHA 3TLJA 3GCZA 3REOA 5K0NA 1VP9A 3DP7A 3KQQA 3OZSA 4FSDA 2K4MA 5CCBA 5M5BA 3GRYA 5F2OA 2B78A 3JWGA 3A7EA 3HVIA 4OA5A 4RTMA 2JJQA 3P71T 5CCXA 4FSXA 5DTMA 2IPXA 3KPWA 4Z2YA 4GOLD 4PIMA 3WSTA 1R8XA 3C3YA 1JQ3A 2WA1A 4R8SA 4RTSA 3GIWA 1O9GA 3LL7A 2PWPA 2IP2A 3G2QA 3EEOA 5K0LA 4POOA 4DMGA 2ZWAA 4ER6A 5DXAA 3GU3A 5FHRA 3BWCA 4KIFA 2PXCA 3ELUA 4RV9A 1VLMA 2NXNA 2OBFA 2ZIEA 3FPHA 1JQDA 1ZHFA 3EGVA 4EKIA 2Z6AA 3QV2A 4LG1A 3O31A 4KWCA 1DL5A 1TW2A 2CMHA 2V7EA 4FR0A 4GC5A 1Q0SA 4PYIA 5LQRA 2XBMA 4CTKA 5DWQA 5FQOA 3PTAA 1JG3A 5K09A 1X1DA 3PLAE 2UZ4A 5K05A 4HTFB 4QQNA 3HA5A 4WVLA 5CUQA 5K0BA 1YFJA 3LDUA 3TKAA 3EEYA 3TPZA 3PX3A 4QPPA 1DUSA 4RVFA 4C07A 4DF3A 2ONYA 4YUXA 1NBHA 1FPQA 7MHTA 3OFKA 4ER3A 3B3GA 3KQSA 4FP9A 1P1CA 1QZZA 3NWBA 3NVKI 3M6UA 2ZZNA 4GUAA 1NW3A 3FZGA 3LECA 3X0DA 4OA8A 2ZW9A 4R8RA 3V97A 2AOTB 1EJ0A 3C6KA 4DCMA 4PWYA 4YUWA 1SKMA 1YFLA 2FRXA 4YUYA 2EJUA 2IIPA 5EHIA 3OU2A 5DM0A 5BP7A 1IXKA 3I64A 3JWIA 1VP3A 1YB2A 3TFWA 2DULA 2ZFUA 1UWVA 3MCZA 4RSRA 3H2BA 3FTCA 1AQIA 4BLVA 3BWYA 1U2ZA 1KYWA 3FUUA 2ZSUA 4Y30A 5EG5A 5ERGB 5EZSA 3MGGA 5FQNA 2IH2A 3MHTA 2AN5A 3O4FA 1KPIA 1EAMA 3KR1A 3M33A 4AUKA 4EKGA 2AR0A 2VDVE 4E2YA 3KQOA 2QM3A 3C6MA 4QVKA 3SSNA 1YZ3A 2ZVJA 2B25A 3RW9A 3E7PA 5KQRA 4QVGA 2Y1XA 1BOOA 5EMLA 3Q7EA 3RODA 2PVCA 4RTRA 2BR3A 3LHDA 3KQWA 5K0GA 4PYLA 1RI5A 3KQVA 4CKEA 5B1SA 4R6XA 3P97A 2G8NA 1JSZA 3BGVA 3CGGA 3HA3A 3MQ2A 5EOVA 3GO4A 4EK9A 2H1RA 5HZMA 3HCFA 3B3FA 3MTIA 1X1AA 5EPEA 1JG2A 4QDJA 3UJ6A 2F8LA 4PIPA 2N47A 2NNWB 3AY0A 3M6WA 2PJDA 2P41A 2HWKA 2P35A 4RX1A 1NW8A 3DXYA 3FYCA 1JG4A 3LCCA 3UA3A 4PYKA 1YZHA 2LD4A 2QRVB 3UFBA 1JQEA 5CVJA 4YUZA 2NP6A 4P7KA 3LDFA 3AXSA 3K6RA 5KS2A 3FUXA 3ELDA 3O7WA 2NP7A 5DTQA 1SUIA 1RJFA 2R6ZA 2JHAA 2ZBQA 1NV8A 3GXOA 3OZTA 3LKZA 2OY0A 3BGIA 3PT9A 3EVZA 3KPVA 5DLYA 3FPJA 4ER0A 2HR1A 4P58A 1TW3A 2UYHA 2PWYA 3CJTA 2NXEA 1SQFA 5DTRA 4E2XA 1EG2A 1RJDA 2P7HA 3FUVA 5BW5A 4RTPA 3EGEA 5T67A 4KRGA 2PBFA 5K0JA 3B5IA 1WY7A 4OQEA 3SSOA 3OFJA 1RI2A 3LX6A 4PINA 2ZZKA 1O9HA 4GOND 3LCVB 3THSA 3K0BA 2OYRA 3GRVA 5EHGA 2PXXA 2OZVA 3KHKA 4P7JA 5K03A 9MHTA 1XCLA 1FJXA 2FPOA
chains in the Genus database with same CATH superfamily
5DISB 1S1UB 3SBMA 5BO5A 2VQ3A 2ZR7A 4TL6A 2CNLA 3K96A 4CM4A 4B75A 3E3LA 2HMYB 1YTLA 2RI0A 1ABFA 1IJEA 2OPHA 4PNHA 3A27A 4DV0C 3CLUC 4JL5A 2Q4BA 2W4DA 2GK7A 5LMNC 2QX6A 3K2EA 1N34C 1JQGA 4YY3J 4I5FA 5DT9A 2H51B 2WUVA 3D8RA 1R8QA 3F96A 5DYYA 4BVAA 2YNMC 1U6IA 1H0SA 4ELVA 2BSAA 5KVAA 3UDEA 2CQ4A 3DZBA 3JAMU 3UENA 1SBYA 2WHPA 4W9NA 4XXHA 3AH8A 2Z5FA 2OZEA 4DCOB 4OJ3A 5IG2A 3ZTSA 1AMUA 3WADA 2FSSA 1LSUA 4PSCA 5CPBA 3LT0A 3R9XB 4G1QA 5F3DA 1VBNA 4EKDA 3E2EA 1O6XA 3NM4A 5BWBA 1VJ5A 1WG4A 4CODB 3U7FB 3WKDA 2OEJA 3E3MA 1IKYA 3W8DA 1BGXT 5BQOA 2D6FA 1XNRB 1BU8A 4HAWA 3DHWC 1SXPA 2B5JB 4UDXX 2REOA 4MARA 4BNGA 3OEED 2Q2QA 2X0IA 5BN4B 1XPJA 1DUIA 5IBRA 4YCAA 4R9RA 4GGPA 1L4LA 3WKCA 3PTLA 2BJ9A 2E9TA 3SJ7A 4LBVA 4PGHA 1UM9A 1TKXB 1QH8B 2UVWA 3KPUA 2ORED 1KS9A 4AF7A 1PZHA 3L93A 1RWWB 1U8TA 3N59A 5BY2A 3O8OA 4JR2A 4LGCA 3KQNA 3IBFB 3JWJA 1S48A 3BIWA 4EY7A 1OS5A 1M5KC 2WIKA 5EJ2A 1PEKE 3HJGA 2H9YA 2GB4A 3OFVA 3QPUA 5EQTA 1U1FA 3EDOA 3ILHA 1U24A 4EHDA 4Q7JB 4DSNA 1NRXA 4N6GA 3LSTA 1VLZA 1KE1A 5M2PA 4TRRA 1WZNA 3SX2A 4YMGA 3AU8A 4G23A 3DOMA 4JOQA 3GJQB 4HT5A 2F43A 1TYZA 3SC2B 3DOMB 4RH3A 4ZAVA 4ZPVR 4WPAA 3VO8A 5E2BA 5K8PA 5JFGA 2FHJD 1RYMA 1R31A 3PCOB 1DG9A 4W6QA 2IJGX 3VU9A 1H6BA 3OLQA 5TIIA 4U2BA 2A9VA 3I31A 2IJFA 3FOWA 2ZKTA 1P9WA 3QEBZ 3WMEA 5A5DA 3IM9A 2VCEA 1JF8A 1A69A 1XQ6A 4XB1A 2YVAA 1PJRA 4Y6IA 4BO9A 1J5EB 4X8MA 3DFUA 2YXEA 2I1WA 5FWAA 2ZUWA 5IZ4A 1LB1B 1YCHA 4RUBA 2JAXA 1QXSA 1NZ8A 4ANEA 1PR6A 4RJKA 4WACA 2J4FA 3HNRA 1U47A 3OH8A 5T4FA 1TKDA 2PN1A 5BW4A 2QL6A 4FYDA 2FVSA 4F45A 2KTQA 4OHVA 3WGZA 4LDJA 2XNKA 4MO2A 3GVXA 1ID8A 3LY9A 3HYCA 3O3CA 2HIHA 1V5EA 3K1YA 2PXCA 3IURA 1VLVA 5I9SA 1Z6AA 1S4EA 3KYBA 1G8PA 2VBIA 1FTNA 2FZCA 3WP0A 2IP4A 5AMXA 4YLYA 3B51X 4QYXA 3E22B 4YR0A 4NBVA 3TEFA 4K03A 1HNWF 3IVRA 4I4TF 3BSNA 1EGQA 3PUVA 4PWYA 3JS5A 2GT1A 3UOAB 3QKRB 3RAQA 4Y34A 4DY6A 3LP0A 4EHLA 4Q5VA 5CA0B 1HNXJ 1QC5B 1GFWB 3VAYA 3K5OA 4LSZA 3AUUA 4DR2F 3M33A 1YZQA 4Y98A 4JI3F 4I6YA 3FMGA 3J81A 1QS0B 1XDBA 5B1SA 1ZONA 4O2BF 2CPDA 2Y3IA 2C4VA 2F48A 4Z8XA 4O4IF 1X14A 1GXSB 5AK5A 1X4EA 3C8HA 2WF8A 1MOZA 1ENPA 3FYCA 1MNAA 3I6IA 3RRGA 4TPSB 2ZIXB 1OHHA 1QG2A 3L6UA 3K6RA 5FR1A 2R68A 1CQWA 1HEYA 4C9DA 4C0BA 1H3FA 5CJPA 4L9AA 3O8NA 1NYQA 3NCRA 3D6NB 3SFTA 1O1YA 1GKYA 4X91A 4LF8J 2R3SA 2NU8B 4B3HA 1YUNA 1YASA 1VRUA 5FULA 5LN1A 1JBKA 1S1XA 4AURA 5ETOA 4PHFA 4DM4A 3LA6A 1GTVA 4O44B 1MG7A 5LMUF 4JI6C 1T4GA 4OZNA 2G7MC 1NG9A 4HPJB 4B34A 2OPSB 5JI3E 4OXXA 4ENSA 3GHHA 3WSWA 2RUGA 2WA2A 3LH2S 1I32A 1QHHA 3MJFA 3HFZB 3PENA 1DWPA 4MK8A 1Z1ZA 3SKVA 4ER7A 3D6HB 1IBKF 1XC7A 4HB3A 4TWRA 2YKMA 3KD2A 3CT9A 2WHPB 4YP1A 4BNYA 4A03A 2PY6A 2XB8A 1L3SA 2PLAA 1RAFA 4IV5A 3EXIA 4D56A 1V9LA 3U5TA 1W36D 4ZT7A 3BTVA 1U3CA 1VC0A 1KPGA 1VJGA 2Z4RA 2JLWA 1GO2A 3SHOA 2DB3A 2GS8A 1UAGA 1Z0SA 1DAXA 1KFSA 2LCWA 2Z8QA 4MIBA 4BMOB 3CA8A 3WIUA 1FNOA 2AUNA 1TA0A 4MQFB 421PA 2HG4A 2WQ7A 4ZN1A 3DBIA 1GG5A 2FN8A 1RT1A 3OTOC 1A7KA 2EG5A 3UK0A 1K89A 4DR7J 3ZW7A 4FR5A 2DH8A 5KFFA 4IIJF 4UNRA 2VSQA 3WC0A 2FCAA 2QSWA 4UCWA 1B1AA 2IC3B 2JLUA 1W5EA 2IFTA 5LXTF 1R0RE 4NBNA 1V35A 2CUKA 2F9DA 3A4NA 4G8BA 1ZQ9A 2XSZA 3LUKA 2QR2A 4DW8A 3Q87B 4BX9A 5ESDA 1KTIA 4O3MA 2XMPA 3E03A 1T1JA 2ZS8A 4C6HA 4G0XA 1E4EB 1L4NA 3ND9A 4GDFA 5ER6A 4RKFA 5EXTA 4FXOA 3RI3A 2L48A 4QYTA 1RZVA 3AM5A 2LNDA 4QPNA 1HH4A 3I4PA 1FX4A 1IBLC 5JATA 3A3NA 1M5SA 5IAAA 2NVWA 4FMCF 5E9QA 1NQWA 1G55A 4PICA 2X5OA 4OHYA 1I94J 4HYQA 2VA8A 1YDFA 1X4AA 2ZYVX 3ELWA 5C8DA 2CPIA 3LQVA 5KC9A 4EI8A 3BF4A 5EGSA 5BOVA 1MC5A 1J6UA 4W1SA 3SEOA 2XNDD 2R00A 3GTYX 5EP3A 1JVNA 1RPNA 5YASA 3K1ZA 5J5VA 2WTMA 5K45A 1H05A 3W3AA 1S0MA 3C8UA 5C42A 4QELA 4QE3A 4IDOA 4X4UA 4JITA 5L3ZA 1CK4A 5LR6A 1T36B 3MCSA 1SB9A 4TTAA 3PITA 4QZVA 1T9KA 3G8QA 1XP8A 5DO9A 3BPSP 4WXWA 5LMUB 1N6KA 2J7PD 1BS2A 3ZDBA 3SM3A 1ZTTA 4MQEA 3ZG6A 1ZETA 1RWPA 3E9DA 5CFPA 4B8WA 1RGVA 3GIKA 1BYUA 2BJVA 3BQ9A 2R85A 5AXLA 2C2OB 3LKVA 2Q3PA 3EMVA 4LYFA 5EHZA 3LFTA 5EKTA 1TM7E 2GYVA 3QBJA 1HNZB 2WA1A 3ZE8A 1V5IB 4C11A 4DUGA 4H4KA 3ZZMA 1H2UX 3RVOA 5C37A 4UUQA 3VR0A 3O31A 1CUWA 1E9BA 2Z0MA 3NOXA 1ZYQA 3T4PA 4YRJA 2Q3CA 5KNDA 4MVXA 3F5MA 4WLNA 4O4IB 4DE5A 3FHOA 3FZBA 1MN6A 4G24A 2J08A 5JTTA 3FZEA 3L0ZA 1VPWA 4JLKA 3DT9A 1JWBB 2R7WA 3LLSA 2WSLA 4A3SA 4NMHA 1ZD5A 1CEZA 1C30A 4CM0A 1IATA 2ZVJA 3HUEA 1HI9A 4KPCA 5T8SA 4Y2YA 4I55B 2AF6A 1RT7A 1UFWA 3IIJA 4MGEA 3JQKA 4MKHA 1V3SA 4YP9A 3ET6B 1YDGA 3G0CA 2E7XA 1EP4A 4PZ9A 1O94C 5I9NA 3M6IA 4IMRA 2QZ4A 4NPAA 1BH6A 1S01A 5C1OA 4YRTA 4F91B 4K3VA 4AWBA 4ZCLA 3PT9A 1VYAA 3H4IA 1SQFA 4I99A 1BQXA 1U8UA 4B3TF 3CIMA 4DV1C 3RUPA 2KZMA 9MHTA 4I55F 4WT7A 5LQMA 1KLNA 4V0NA 2QU8A 1JJAA 1K08A 2QN2A 5LZ8A 4FXWA 4DV7C 4C88A 1Q92A 2DIUA 1VKOA 4C04A 3OTEA 4JY7A 1C0UB 4K0BA 4XGNA 4WEOA 4JI6J 4M0LA 5EGNA 3DWIA 5IJ0B 1O97D 3CCMS 1U49A 1PSDA 2YHUA 5G40A 2E87A 5AVRA 2QMQA 3UOGA 3I04M 1SOVA 1G3OA 2O3SA 1E9DA 2PS0A 3FVRA 1BTOA 4KVAA 3OPMA 4OLOA 3PXEA 2EF1A 2C2KB 3HEBA 1RBOB 4NZYA 3RJMB 1DXQA 2HK9A 4D6XA 2IYTA 4EJSA 1E4EA 1O77A 1U2RA 1F4VA 3IDOA 3NMUF 4FQ8A 3KOYA 3LG2A 3E23A 5BWLA 3PPVA 1NI4B 1NJ6A 3PGKA 4HZGA 2DLCX 2REQA 4DVJA 3W1EA 5T8KA 4I1YA 2LVWA 1D9FA 1MJHA 5E4JA 2CNOA 3GK3A 3IOYA 3WKEA 1S9HA 3PV8A 2E7WA 1EVKA 1NLZA 1QOQB 2QM8A 2I8LA 3F8WA 4RFSA 2BHRA 4CYUA 3S4YA 2UP1A 4M0FA 5IU6A 2FSPA 3LHKA 1AV6A 2HQSA 3GWGA 1FZQA 2BZGA 4MZXA 3IAS6 4AKEA 5C24B 1N2IA 4UMDA 2FZKA 4KSBA 1QOZA 4O59O 4KLCA 1QC5A 4MGZR 2BLNA 1CY4A 4PO9A 4JXJA 1X1TA 5K8OA 3HB4X 5GJWC 4B84A 2BQUA 3PKZA 2X7IA 1MU2B 1VE7A 4ZEWA 5KOJA 4LXGA 2BBOA 1Z2EA 4Q82A 4ZCIA 2ZXEA 1FP4B 2XT9A 2TSYB 4BO2A 3EBLA 3QNWB 2Z56B 4ZVLA 4JEUA 1KFKB 4LZWA 1EE1A 1NSPA 2JZOA 1W52X 4ZYXA 2ZPAA 2GF2A 2F4VB 4ND3A 1FSSA 1PEAA 4WN3A 3VZIA 3A12A 2Q2NA 4Y3CA 4PC2A 5K4AA 1X4CA 3O2SB 4QXRA 1L8LA 2HM7A 2ZVQX 2MZJA 4QA9A 3AFHA 4HUJA 2BFCA 3HLYA 4MR7B 3LTOA 3NTQA 1XTUA 3UF0A 2R7AA 1SUDA 1TDJA 3UDCA 4I9UA 1RACB 5FBKA 3MZ0A 5L9NA 3D0QA 4JI2J 1UBEA 2XB6A 3IR7B 1CIVA 5H1YA 1HDGO 1L6IA 3WWZA 3KEFA 1NXSA 2RBEA 3ZEAA 4GX5A 4TY9A 3BMQA 4I2NA 3I1YA 4YH1A 4DUYF 4NZNA 3UJ9A 3PRBA 4HNAA 1QE5A 2HJRA 1QCCA 2JBWA 3TMYA 1PJ5A 2PHZA 3JAMY 2EIHA 3H5AA 1Z34A 3IE0A 3S44A 1UMCA 5KJCA 3TINA 1L5WA 3IDZA 4YECA 4IIJB 2FQWA 2DSTA 1PKXA 1EFLA 3JVUA 4DCOA 3BSCA 1B0VA 4EITA 1SR8A 3DLGA 3DGPB 4RFLA 1GSAA 4IILA 3FIUA 3NH9A 3SEZA 5CH5A 4WS9A 1NVXQ 1PG4A 1HQUA 4C5CA 1NKBA 4GP9A 3GLGE 3T5TA 1BX1A 5HKKA 1CBKA 3BWXA 2ZROA 1KOJA 1FTQA 2FFHA 1IONA 2I6QA 3F8SA 1TCBA 2HBRB 1I0ZA 4KIJA 1L5RA 2NTNA 3PL5A 3NT5A 3SVZA 3RVNA 2CQ1A 4ZKAA 4IFYA 3F6RA 4RQTA 4OHZA 5AXNA 4X4VA 1DC7A 2CG8A 4P6VF 3EZ6A 3VPHA 4LF1A 3QVVA 3KMSA 2D4HA 4DFDA 3WSTA 5DN6D 1R8XA 2P2CA 3BRWD 1N6OA 4Q8EA 4OG2A 4X1KA 3UQZA 4TSFD 1FMFA 2QLJB 1OJ7A 1W1IA 3QXSA 4FM9A 4RLEA 4BSZA 3I3SR 1DTQB 2FY1A 4JUDX 4CTKA 1SOUA 1WLSA 4MQMA 4PZZA 2C2ZB 5AVJA 4WQMA 3G0GA 3UR0A 2GZRA 4WZQA 1YOVA 2DEUA 3K53A 4BEVA 4RXUA 4LMAA 3AIIA 2R8BA 1L4MA 1IEXA 1KKHA 4ZPCA 3WC2A 5BR4A 4DV6F 1FRHA 5KSWB 4G8DA 3KR1A 2VWGA 1GPNA 3DBLA 3R5XA 2FLWA 2YBVA 4ZOAA 2XY6A 4CKYA 2UUOA 5JT1A 3O3MB 4NXNB 4PSKA 1UZNA 3VZSA 1FD8A 2HEIA 1O51A 4LF2A 3E3OA 1K0TA 4KKOA 1I2MA 5DM6Q 2VP0A 1HBNA 1NW8A 3GLHA 3MYYA 3ROKA 3A1SA 3K32A 1O58A 5CH3A 3DNPA 4MP6A 2PT0A 1X60A 2BFWA 2J3IA 4AY4A 2ZYTX 1A4IA 5AVSA 2POQX 5U9CA 1J0EA 5HE9A 1VRWA 3W0LB 5ETPA 2FN4A 1S2LA 4BO7A 1S8NA 4EELA 1XF9A 2I34A 1GRCA 1SQ6A 3K4QA 3HKEA 1QM4A 2RMLA 2PMWB 4R0JA 2I6UA 5DI9A 3DF7A 3WK7A 2C03A 2JFKA 2FEXA 1TR0A 1ZJWA 3QPBA 1ODTC 2J3JA 1BC6A 2WJ3A 3OF5A 2GDJA 3IWNC 2G0CA 5LM7E 3PD0A 2F65A 3RVLA 1ULHA 4D3ZA 2RS2A 4HZUB 4RYLA 4ROSA 3OVAA 4K2XA 1TVKB 4JX8A 3Q6IA 3DNCA 1P5RA 3UVEA 2C8KA 3UNYA 2IF2A 1K4KA 5HQMA 4M76B 2FP4B 3QFTA 2XKKA 5DBFA 1CTQA 5JAPA 1HRKA 4B7CA 4XIIA 1M1YB 3CG0A 3QLUA 5KBYA 2ZFHA 2WP0C 4DSIA 3BXZA 3HHPA 1G5TA 3DJFA 2DRDA 1GZ4A 4LCEA 4CG2A 2AMCB 1K1QA 4AJ4A 2ZRFA 4U3JA 4KK4A 2PRJA 2ATVA 1OFIA 2QD2A 5EWMB 2P9GA 5HDBB 3Q2OA 1RTZA 2XCRB 3KSBC 3FFIB 1KLMB 3WK6A 3UAZA 4AY5A 4LHZA 4DWOA 2NYIA 1R8JA 2IDLA 2RHQB 3SSAA 5J4LA 3L7PA 3HFSA 2VUHB 3E7WA 1DTSA 3MCUA 4JLNA 2Q4DA 4FNIA 1GDHA 2Y1FA 3RC3A 4QWBA 4DQUA 2E55A 3IHKA 3RARA 4WU2A 4C0WA 2WYWA 1ADJA 3HSZA 1EWRA 2CFOA 1ZWLA 3FXAA 1NPTO 3PNLA 5TPZD 5MHTA 2PJUA 3VH1A 2M6SA 3L8MA 4O4JA 1SG9A 2RUSA 3FSEA 1UJMA 1T5BA 4J2HA 4GD3Q 1N2HA 4L76A 3EGCA 5C42B 5E3HA 2P6MA 4UM9D 4C2BA 3K9WA 4BUCA 2JJ8A 3FWPA 3EBOA 5KSPA 2JSXA 7ADHA 3PKMA 4EB6A 2QUHA 1U0JA 3BHJA 1EFPA 4DSKA 5FUMA 3OOEA 2XOEA 3DLCA 1KJIA 1XGKA 1P0QA 4IFTA 3V1KA 4J4TA 2LECA 3TXXA 2X23A 3PJGA 3E05A 1ESEA 4CEJB 3MUOA 5L4SA 4LOLA 3T3HA 3A26A 1BVYF 4EGSA 5F1KA 4RACA 4TTJA 1AOXA 2IHZA 3RYHA 1GKKA 1BLUA 3MOGA 1S7GA 4YB5A 1FJHA 3M6FA 4GI7A 1N9GB 3E2MA 1ZU4A 4AO6A 1KD1T 4XYBA 3GLTA 2H5JA 4OFXA 3JB9k 1KAQA 4YAEA 2KI5A 3K5HA 1HG0A 2DQKA 4J0CA 4C3KA 3VAZA 2IY7A 3GLJA 4EG5A 3H6HA 3PIRA 3FOBA 5CFQA 1G3UA 4L5JA 2ZI4A 3I0SB 3DAYA 1E2FA 4RTSA 2VIHA 4L08A 4N6OA 3E2PA 4D4HA 1RYRA 4IKOA 2MMYA 3CC7S 1DAPA 4J7XA 4F50A 3PUIA 1X1DA 5CUQA 1AT1B 1JAIA 3F9CA 3M2UA 3QJJA 2HBYB 3TAQA 4GUAA 3X44A 3ZNNA 1OBCA 4QDOA 4BP8A 2VDHA 3RIEA 4HGQA 1NRWA 3H9BA 3GD5A 1Y3BE 3IPRA 2OBBA 3W9SA 5D6OA 1JDSA 1TMOA 4QVGA 5FJ4A 2ZSAA 3FCWA 5A0YB 4I8DA 2BUBA 2SKCA 3ESQA 1LW2A 2NUBA 2ZUTA 3V2UA 2NNWB 3HC7A 3D7KA 1U0HC 5DEIA 1FEZA 3KSDO 1G98A 1Y5NB 3JQGB 2KHDA 1ETUA 3LDFA 1NM5C 1L1QA 1FJCA 5DTIA 2OK7A 4A8WA 4BE7B 3IIIA 5AM4A 5DTRA 4AROA 2IVFA 4CM9A 4ZVFA 1WHXA 3GP8A 1DQ8A 4PLZA 2BYTA 2NU9B 4P08A 4ZIWA 4R16A 2GD1O 1N5TA 2BA9A 1GPLA 1ULSA 4DVGA 2FHOB 3KTAB 3ROPA 1MV8A 4M1SA 4IRUB 4EW1A 2QRRA 4HLBA 4OL8A 5CYFA 4LF5J 3HCRA 1FS5A 5AE3A 4MP3A 4KQ1A 2IIVA 1EWYA 3DFEA 2E4ZA 4K6FA 1ABEA 1SC1A 2PX8A 4M9XA 3CKMA 2BBEA 4DXLA 4X60A 2V55B 5EP4A 4FN5A 2MM9A 2ZIXA 4Z49A 4JU9A 5K01A 3H0KA 3L02A 3C6UB 1N33C 4MJLA 2DBBA 4C1BA 1GR1A 3KJXA 3ENQA 2JGKA 2GO1A 3PPYA 5DFAA 2IBMA 3FVQA 2W8KA 2QJOA 2W11A 4DV3F 3EE6A 3TUFA 2GERA 2Y1CA 3OSZA 1Q74A 2GXUA 5F8NA 1ZOOA 3U81A 5LA6F 1OBHA 4BJ3A 1H3EA 3DKRA 4WCFA 3Q2TC 2YNIA 4F3QA 5BWNA 2C96A 3PQ7A 1KTQA 2H2DA 3DBOB 4IOMA 4YCLA 2KRRA 1V5FA 2GK4A 2D3ZA 4GXTA 2QLJA 1W5SA 1XTJA 1KYZA 3IB6A 3EX7C 1F0XA 4DR7C 3VTAA 3CN7A 1QE1A 3D4LA 5GADl 2ISSD 4RMNA 1ACLA 4EQ6B 1NJ8A 4BOYA 3GRCA 3RRFA 4PFSA 4XEHA 2QTVA 3UBTA 5C8ZA 2DGVA 3DNFA 1O4VA 2BMJA 2WT4A 4UCXA 4ITVA 2GTPA 4I1IA 1AGYA 1RPAA 4IMJB 5IJWA 2WAMA 1QF6A 1S6PB 1U1NA 2VK2A 2P27A 1WKBA 5KFRA 3T5MA 4CMIA 3IVAA 3ZY6A 4DSJA 2G9OA 2J6BA 2IVYA 1Y3HA 5TS3A 2FUG1 1VQLS 4I1RA 2OHFA 2GLTA 3O93A 4JI0J 4LC0A 1MMLA 3QXJA 1Q3TA 3KM0A 1XWLA 3FGPA 3H9QA 4EPYA 2FUKA 1JDBC 1GAJA 4V0RA 2DNGA 1KR4A 4DA7A 1W7AA 4FF3A 1CW2B 1PU2A 1VBYA 1V37A 4NXNC 1L8AA 5D5HA 1Y9ZA 4JBXA 4NLTA 1G8YA 4IIHA 4MIKA 5TGZA 1V7QA 2P2MA 4ZVKA 4TV8F 3H75A 4C0SA 4DSLA 4ICIA 1ZGBA 1YNSA 1YS4A 1FFEA 3EW7A 2XIJA 1MO4A 1FRXA 3KK3A 2QUJA 4UZEA 5FUXA 2DAPA 2KDOA 5H4HA 5GP1A 1UT5A 1IN5A 1JDNA 2X42A 4INAA 1Z5VA 3IILA 2IDJA 4GSKA 4WIQA 4L8YA 1G2IA 1XVLA 2P7IA 2QQ0A 3K1AA 2DGQA 3KAJA 4ZP8A 2BFDA 1RQGA 2C2MA 2YQZA 2MZTA 2QP9X 1VSTA 3X1KA 4ECEA 4TMTA 1MJ5A 1E62A 1UXIA 1TK2A 2PSEA 2EC2A 1R8SA 2CQHA 1GG8A 1I1GA 2RH8A 5F12A 1QIMA 3LAWA 3DKPA 4XCVA 2DY1A 2PKXA 1SJFA 1EUCB 4N0EA 4AMZA 2QZ9A 4WE1B 5K0LA 2Z95A 1L7OA 1E3WB 3HSDA 5IKPA 1U6BA 4DPLA 4NENB 2XUQA 5LQRA 4PYIA 3W2VA 4WE3A 4TMVA 4NBKA 1PJ4A 2YH1A 1CFJA 1MO6A 4PAAA 1V26A 1YRLA 2V4JA 3C43A 3MM9B 3HKWA 2DNPA 2IW1A 5JJKA 3PEFA 4YAFA 4RNHA 5FOTA 3O2EA 4UHKA 3ZJ5A 2O52A 3NHWA 1XJ0A 2HU2A 4J0DA 4OI4A 5KYKA 2VFRA 4RVOA 4JA0A 1H1LB 4NZ6A 5IFIA 2ANBA 4V2IA 3I2YX 4Y6PA 2CFRA 4K6CA 2ZNYA 2JI4A 1RAOA 3PYGA 1SKRA 3PIIA 1RKUA 4W1RA 4WRRA 1XNRJ 4M46A 1ODFA 2H2FA 1S79A 2G1AA 3F3KA 5LBUA 3RAFC 3LNCA 5B30A 3QVJA 5EOVA 3FPAA 5CH8A 3TVKA 1GXLA 1F9FA 4G5FA 1SVOA 4BZWA 1JDUA 3D0KA 1PT8A 3NMRA 1YRHA 1FUEA 4RU9A 1U8YA 1J8VA 1N78A 1IAVA 4KBGA 3WE7A 4PZYA 1Q7BA 3SF8B 1BWEA 1SUIA 4DOZA 2BJ1A 4DQXA 3AD9C 4GNKA 1BW9A 4U6PA 3WBZA 1M1YE 1RRFA 2VC1A 4RDCA 2X7XA 4KQCA 3CWCA 2HBQA 4YWJA 1SBRA 1JAXA 2CJWA 1QGOA 5CYQB 2WSCC 1OXMA 5J2PA 3V1NA 3SOPA 2NZ8A 2Q28A 4HC4A 5ESXA 2VDWA 4PLCA 3MMJA 1U0NA 3ORYA 3GJYA 1U2DC 4JI1B 1Y5RA 4NOZA 3EOAI 1L8QA 2YWXA 4NLPA 2IEIA 3HKDA 1RXSA 4CLRA 1W34A 5GAGU 1DZ5A 3P5TL 1T3GA 3RPEA 4S2UA 4LVCA 3JW8A 2OUGA 4JH0A 3GFHA 2HLTA 3ZK8A 1QU2A 3MCTA 4YAIA 2D69A 4B3OA 4X7RA 2JIQA 4YK7A 5EHXA 1NH8A 2ROGA 3EGWA 2O05A 3L9ZA 4EO7A 1NDUA 3DSRA 1XMXA 3ED5A 5DYGA 5CFRA 2IAJB 4AT1B 2HNBA 1DG1G 1NN0A 1WOPA 4ZP6A 5A4AA 1IG3A 2IAJA 4FGJA 1KEKA 2OXRA 1XA4A 2V2QA 3DDNA 4BVKA 1FSPA 2A4MA 4YT2A 3D81A 2X8JB 5KFMA 4F04B 5D87A 2ROQA 4UE2A 2VUSA 2XYRA 5D78A 2QBYB 4OP1A 3AESA 2YFKA 1KVJA 2ZATA 4BQPA 4FDVA 1XRQA 4KDRA 2A6MA 5D86A 4EKYA 2VT2A 1FWLA 1LFWA 4X20A 4IFVB 2YZKA 1YQXA 2DGTA 4OX9C 1FK8A 1SXJD 4LF7B 1BMQA 1AJEA 2YYYA 2F8MA 1GU1A 2C61A 2VTKA 2G0TA 1H4VB 3I45A 3SCIE 3X1LB 1FU4A 3ZX5A 1OXUA 3H1AA 4IDKA 1XJCA 4ECZA 4CG3A 1ZVVA 3IAFA 5EXDA 2WB4A 3TK1A 2IJRA 4QJVA 4BZPA 2R7OA 3R3JA 4Z0NA 3BN3A 5ES3A 2PKWA 5EUHA 4AQYB 3EGXA 5LJLA 1A2QA 4MI3A 3UC5A 4XA8A 2CZGA 3B4DA 2JCYA 4EA7A 1LRJA 2GN8A 4JQCA 3UH1A 3BERA 3JQ9A 1C8BA 5JZ9A 5EZYB 8ATCB 4HDKA 2AJ1A 1R0YA 1V4NA 4KO4S 2ZTLA 2NPOA 5HCNA 2OC4A 3RHSA 3BH6A 2AF3C 2W2PA 5TARA 3TXAA 1Y9EA 5J1PA 4OMUA 2CBZA 1UADA 3B3QA 2MQ8A 3MS7A 3R2CJ 3PYMA 3DB2A 3RIMA 1P6XA 4HLCA 2XY4A 4H3HB 3WHKA 3IDFA 2HMIB 3WGOA 3K6SB 1R8CA 1Q7YT 2JFBA 1X2BA 4Q48A 1Z6QA 1UXOA 5IF9A 2NN3C 1T5HX 4KBYA 2CNNA 3BGUA 1RM5A 5IULC 2P79A 1RLJA 4OQYA 5EVJA 3AR7A 3BQNB 4HVTA 2OH2A 4DDWA 3T0IA 2G4VA 3R7SA 1V16B 1K73T 4DR6F 4EB6B 1HBJA 3PKJA 2KZZA 4XQEA 2VSNA 1PEYA 1NK4A 4B3DA 4FZRA 3LBYA 5JOQA 1VP9A 4TXHA 4LV8B 1XKLA 2I54A 4QL3A 1YZKA 4TLLB 1NDLA 4ICLA 3SQDA 1AKUA 4QXMA 3KVYA 1DLJA 3IMCA 3OQPA 4DZDA 1W4CA 3V4PB 3VHXA 2PGLA 3OCYA 4JNKA 3ZQJA 1GPH1 3PW5A 4IJVA 4S1VA 4UREA 2X0FA 2ZM6F 2J5BA 1VFPA 1PLJA 3D3BJ 2EK6A 2RAPA 1JKFA 2DJWA 1NBHA 4RVCA 4OV1A 1N4LA 1P1FA 2GTIA 4EJMA 3CCVS 3G2JA 4WK2B 1LWCA 3B54A 3ED1A 4E8UA 5K20A 1H74A 1F2HA 3DVLA 2DBYA 2UU9C 5BR8J 2GJSA 1IXKA 3KFXA 4KPGA 2JRLA 1ZLXA 4Y2MA 3OTOB 3NDBB 2WU8A 1XPRA 3R8YA 1Y4SA 4EUFA 4QDXA 2EZ9A 3OIYA 4Z9XA 1XK8A 4BLSA 2W4IA 1GZ7A 5JZOA 5HZMA 1Z4MA 3FHLA 5D3KA 2BCGY 2XSZD 2E82A 4DR3F 4A8JB 2ZUEA 2NPIA 1XEXA 4MKIA 3BWVA 4P4GA 2Q45A 2JFHA 1TRHA 2XKAA 5HP4A 1PQWA 1USPB 1K75A 1ML4A 5D3GB 4ILRA 5G3YA 2PUJA 4J49A 3H87A 1O9HA 3ZVLA 1V9CA 1ZP6A 3EXHA 4FBTA 4EW2A 4XUGB 2JCBA 2LMIA 2VBFA 1E9EA 1GTG1 3UV6A 4V19X 3D2AA 3W2GA 1G8AA 3FFBA 3GLIA 4YP7A 3ZJ4A 1XFAA 2MSLA 5C25A 4HQFA 5K0TA 5EKUA 3GARA 4AF6A 1BKYA 1DX4A 3DUWA 3VF0B 3MR6A 3ST7A 3OTHA 1I9CA 1Z73A 2N82B 3H13A 4L2ZA 4CT5A 2UVVA 4I5EA 3OU6A 4B76A 5AW7A 4OB8A 3OE1A 1VGQA 1CF4A 4LF5B 2YWWA 3H0PA 1GKIA 1LC3A 2UUCC 1SQ0A 2XAAA 5F8MA 1KJJA 3N8IA 1NKTA 3LYLA 1G8FA 3RNOA 2QQFA 4WLVA 2OO4A 1J8MF 1O2DA 1Y1RA 2BUAA 3N0TA 2JCGA 2GEFA 3FPLA 1S96A 2HRCA 1TUWA 3AHGA 2QTHA 1F2UB 2HHCA 1CYDA 2PRZA 3ORFA 4RCZA 4EJ2A 4MKAA 4XFJA 4YDHB 4GLOA 2XDWA 4C5AA 1C7JA 3C2QA 2MYPA 3MECA 1NMEA 2JL1A 5EXEA 4YMVA 4ZU6X 2A33A 2HQGA 3A3KA 2ZBDA 4U8HA 3MTEA 1XN4A 3SIXA 4KMMA 5J4VA 2Q3HA 1ZNWA 1CIJA 4LOKA 4W5JA 3RIHA 2OKQA 3DYAB 3OOYA 1CR4A 3FHCB 4IXMA 4AUMA 3EGWB 4FF4A 3LPYA 3PQ2A 2XNSA 1KI1A 3BGSA 4QJ3A 3R2DJ 2KT3A 1YIOA 3ETDA 4XTRA 1Q1ZA 2NO9A 2OHOA 2CJYA 3CJKB 2JVJA 5IUJC 3F5FA 4B3CA 5I4KA 1AQYA 3WBJA 1ZVMA 5GADI 4TUYF 1EM6A 1WHYA 3FEXB 2KM8B 4EFDA 2ZKIA 1XD8A 4LY6A 3KSAC 4BHQA 2CV0A 3VR3D 1NXVA 5CB0A 2UV8G 4EFNA 3I73A 2HSJA 2JZCA 1J8DA 3U9TA 5ETQA 2HO5A 3ABZA 2PJZA 3U3ZA 5T41A 3V6DB 1VLQA 4BGEA 3EWNA 2PA8D 3IQZA 4ISCA 1DP4A 1Q0TA 1T94A 3QX3A 3DZCA 3EG5A 1OX4A 1RAEA 5G4KA 1QZ3A 1A76A 1Q0ZA 4JP8A 3WYBA 2ZUDA 2PI5A 4ZVQA 3KK3B 3S8MA 4KV8A 1Y8RA 1VJRA 1HNWC 1B7YB 4K6MA 1POWA 3G7UA 3TQQA 3LO3A 2V6BA 5L7WA 1FL9A 3QM1A 4I6GA 2XVMA 4Q47A 2V5AA 3KU1A 3HP6A 1V43A 4CM7A 1KY4A 3T9EA 3UHFA 1V5VA 3RBAA 1IBCB 4LJ7A 4Y2QA 3ZE6A 2B0JA 5EI5A 3OWHA 1NRIA 4KE9A 4JV0A 2NO0A 5ALYA 4WZAB 2OFFA 5CU7A 1UP4A 1V95A 3EMBA 3VTKA 2AGPA 1IVZA 3PTWA 4AG6A 1QF9A 4D3HA 1K5PA 3AETB 2C5GA 3UJCA 1ECJA 4CKEB 1Z29A 1NUAA 5HF8A 1QIJA 4UQOA 4OBBA 2ZJQQ 1A88A 3NNAA 1J8QA 1RRPA 1ULAA 4JUFA 1RTDB 3GXBA 1Y34E 1W5BA 2O2DA 3S1SA 3ZV7A 1NR5A 1T6ZA 2PU7A 1GUZA 2A6OA 2DKOB 4MWBA 3D0GE 5DG8A 1T02A 4EQ6A 3WGQA 4AJPA 4EKIA 5D7BA 5CAAA 5B2ZA 1VSUA 3W2TA 3GJTA 3WMGA 5DWDA 1Q7CA 2GZAA 4INPA 1ICEB 4RELA 2CNLB 2DECA 3TH5A 2K8GA 1P2UA 3CMCO 3SMZA 3OU2A 1NK8A 3GFRA 1GXTA 3Q3JB 1YB2A 3UYLA 1UDRA 4ZT4A 4E98A 1K92A 2ZH8A 4RETA 3GQBA 3W5UA 1L7NA 3PWZA 1QQAA 3MGGA 3CVYA 2FPRA 4FONA 1M6XA 4CUZA 5MGNA 3OV7A 4XH9B 3BRQA 5BN3B 4EUKA 4BUZA 1DSSG 1KI7A 1W73A 4P84A 3S2EA 1AFJA 4HAZA 4YJGB 3MBKA 1RI5A 3THXB 4RVSA 1KDZA 1L2FA 1YJCA 2IWRA 4LFCJ 3MWJA 3VR4A 1ZGZA 2X9NA 1P0MA 3K9LA 3PRYA 3G2NA 2WVGA 2KO1A 1QGUB 2GJ2A 5KT2A 4V03A 4MYTA 1L5ZA 4M1ZA 1EGVB 1N33J 5A4IS 3UMJA 4ANCA 4MX8A 1P9OA 4YP5A 4BV3A 4R8LA 4RM2A 2YH2A 1XFDA 4QICA 2HHPA 1HM5A 2IZ6A 1JLEA 3AV3A 4FFDA 3Q10A 1TKZA 3UPUA 1RYZA 1I3OB 5AUQA 2R44A 4PXSA 1WZ2A 1IC6A 4WJKB 3HMJG 2JGDA 1D8AA 2AYEA 2R5FA 2ZYHA 2FETA 4AZ0B 2HHHF 3QIPB 1O7JA 4EHNA 2GF0A 2ZH7A 1NMQA 2JNJA 1MWZA 2AZTA 2WHRA 5ENVA 3R3HA 2IM3A 2YMLA 2P9EA 3BFJA 3C70A 5THQA 3BBBA 3ZJYA 3RHZA 2VS1A 4DQLA 2C22A 2ONKA 4KXFB 3NIBA 1ZW1A 2O0KA 2IYVA 2B9VA 3UUGA 2A2DA 1JHPA 1LXJA 2GN2A 3TQSA 3VQTA 5GONF 2IPNA 5MAOA 4U9HS 1Y5MA 1NX6A 3L1JA 4IDCA 2ZUGA 2JLAA 2NU6B 5D1NA 4EKNB 4JI4J 1PUXA 2WNSA 4YUAA 3M7IA 1A95A 4B7UA 1SULA 3ZGNA 3UMBA 3A9VA 3S70A 1M2FA 5G0UA 5F9FA 3LNVA 3ORHA 4J3NA 4O3FA 2LE0A 4OX9B 2CMFA 3KYIB 2CQDA 1JXEA 5DKFA 3QLHA 2J45A 3HPOA 3K5NA 1DC8A 4A8OA 5B57C 3N2LA 5L8RC 3FIJA 3CC8A 4JLOA 3KNAA 1HNWB 4ZICA 4P2SA 2MYFA 1ZB9A 4ARVA 1U0SA 1UJNA 4EMUA 3U60B 1SV5A 4ASUA 4A8TA 4L0QA 4RTNA 3Q9NA 4MWTA 1W36B 2C07A 3WWYA 4YGYA 1WUHS 3NS7B 5HBMA 2ZYDA 2EKPA 3UD4P 1DS6A 4ND1A 3VO2A 2GJFA 3QPCA 5KT3A 5KTOA 1E3TA 2GVDB 3FJ2A 2A78A 3CLHA 2QZZA 4MJ3A 2PEZA 2QY9A 1I24A 3UBMA 3QSGA 4F1WA 4Q4HB 5TEVA 3NY0A 3ULKA 1N9ZA 2OB2A 4M5MA 5DM4A 1RWPB 2GZMA 5AVWA 3RUAA 2XYPA 3OLVA 3JWEA 1G7SA 2ZJ1A 3ONNA 3RU7A 2PH3A 3CVKA 5BSGA 3W62A 4JGBA 4GWKA 4J76A 3I9ZA 4I2VA 2A9RA 4JVOA 5EX0A 1T4CA 1ISRA 2ZRJA 2NUPB 2ZUAA 4H35A 5BN5A 2IM1A 3ORQA 4BO1A 3F73A 4I3FA 1J2EA 2E1MC 3SDSA 4DQKA 4C7BA 2MKCA 5EXPA 4U1RA 4IO9Q 4EG4A 2P1RA 3FRIA 3W34A 3HI9A 2IITA 4MO9A 1AH2A 4QU9A 5DHTA 2VG5A 2ZWVA 3FFAA 2P6NA 2XGOA 2IYAA 3JRNA 3UXYA 2HFOA 1O5IA 1OAAA 2CL5A 2B30A 2K2PA 3MMBB 5AXBA 2YYSA 5AI8A 2HYIB 3FCHA 4WNAA 3UCZP 4QEZA 4G6VB 1DX6A 4J9UE 1EWQA 3GGSA 2GSWA 3FSIA 3HXLA 2APJA 4H60A 1UAWA 4ENRA 2H1FA 1ZFNA 2IEGA 2QZJA 3OZBA 1HI0P 1TLTA 2WWXA 4G25A 2JLQA 1TC2A 1Z7WA 2UUPA 4MW9A 1YTUA 1OWNA 4BASA 2Q8PA 3TAPA 1R5BA 4QPPA 1GITA 3I37X 5ETSA 4UARA 3UHOA 1XMVA 3EICA 4DL2A 4P38A 4AG3A 1TPZA 2H0QA 5EMNA 2PLRA 4WLOA 1T9ZA 4FFBB 4UOZA 1HNIB 3MTKA 4RK7A 4RZIA 1Q82T 4AZ3A 2VRCA 5LOVF 1ZU5A 2Q3MA 1H23A 3KT3A 1Z0JA 4KXQA 3VU1A 2MPUA 4Q3DA 4B08A 4HDNB 1UXHA 3WHPA 3NLCA 2WU1A 2XUHA 3B3FA 4TMYA 2ZJ4A 1WMAA 4MAAA 4RE5A 4UXIA 3IJEB 2OVBA 1NO8A 3TQHA 3QU5A 1IQTA 5E41A 1YFZA 4HWOA 4G4SO 4TZKA 3PO5A 1E1QA 3KSZO 1H4SA 2AYMA 2CUZA 4HI0E 1HFEL 1SKSA 3KIPA 4KYZA 3EJWA 4NP6A 4JLDA 4PXDA 2EX0A 2AWNA 4LXIA 2XYQA 2FJEB 1BJRE 4RF3A 3BGLA 3V80A 4O4HF 1NVWQ 1ZK1A 4RZHA 5F4BA 2PS3A 2VL1A 1NUUA 1M6WA 3EW9A 2Z3WA 4XVUA 4YP0A 1N8NA 3AYZB 3B6ZA 2HRQA 1GQOA 2YPYA 3R44A 4AKGA 4RZ3A 4WEQA 4GMDA 2D74B 1TAHA 1LSOA 2XS2A 3L5KA 1RXVA 1S2IA 2HSGA 1SWWA 4ZAFA 6PFKA 3KEOA 3P96A 3FWKA 1ENZA 2ZIAA 3M8QA 4QYMA 2WW8A 3FNFA 4NBSA 1PT5A 3UVJB 3U7EB 4Z51A 1EJ7L 4EEYA 3PW2A 5G0RB 3UNXA 2DHSA 2HA4A 3HSSA 3MJEA 3N2NA 4AS3A 2I65A 4F8EA 2W4PA 1UA0A 4KPFC 5JAUA 5FO0A 3RSQA 5JO0A 5CDHA 2VRWA 3M5PA 3X1JA 3T5PA 2BHTA 1L8OA 3PRJA 2W4QA 1BYIA 4XWOA 4ZOLB 3WQHA 3OT5A 5B7QA 3D1JA 5BSWA 1UC5B 4B9TA 1QH1A 2J3DA 2FLPA 1I4DD 4UU0A 3GGJA 1YRBA 3GAAA 3H1FA 3OMWA 2IHVA 1NLKL 3QG5A 1XE3A 3Q86A 1NF2A 2NVUB 1OMSA 4YJDA 2PUHA 3BMOB 4O2AF 2OKGA 5HDQA 3LGAA 1Z2PX 3MSXA 1ZSYA 1EHWA 4ZEOA 5F3ZA 4DCUA 5GAHI 3G8TA 1NI5A 3KPJA 1I5OB 3N8NA 5JDIA 4H7HA 3W04A 5J2PB 2WQZA 5F0WA 4PNPA 2AS0A 4B3MC 4NMLA 3KLBA 4R7ZA 1UMDA 3M8KA 2I6SA 2VT6A 4CE6A 1AKTA 2D4AA 3PEEA 3TVYA 4X9XA 4CCYA 2B7BA 2ATWA 1QAOA 1DOHA 5KOHB 4CRWB 3VUFA 1RHRB 2OTLS 5AVTA 4H4EA 3KOXA 1G2EA 5T7LA 3HDJA 2GSDA 1WACA 3UGQA 3FUTA 1E2PA 3TLGA 3A8TA 4INZA 4DUYJ 4YHHB 5TR9A 3ZCUA 5LP6F 4Q66C 1HBOA 4MW2A 4AG5A 3SI7A 3OQJA 4LI0A 2YR0A 2VP9A 1DTWB 4AJ9A 3MR3A 4KR0A 2C8VA 3L7UA 3A6JA 4ECTA 4O4IA 1CJTB 3IUQA 3R74A 1FYWA 3EAQA 3O03A 5DSZA 1QDLB 4DGQA 2CDNA 3BJMA 1ZH5A 4YJFA 3S7TA 1RAGA 1LLQA 4N39A 3NIGB 3DKKA 2FD2A 4MKXA 4L3NA 5L38A 1BXKA 5A5EA 4KPYA 2A9QA 3ICQB 2M2BA 1NN3A 4HQKA 1P6UA 1UWKA 5FWXA 4UEJA 4OKIA 4IGIA 4G5GA 2WT8A 2DFDA 3U1BA 2HHHJ 1RAIB 4Z4IA 4JGGA 5C9ZA 1RM3A 1SBTA 4OHKA 5KHLB 2AMVA 1EXDA 3EZ2A 2PQ0A 4BN0A 3PLRA 5LMNB 3L8GA 4Q16A 4PIMA 1GOTA 5AW4A 4P3XA 4DGSA 3SMVA 4CH7A 1DAIA 2R8YA 1BMQB 3G7NA 5IZHA 3GN2A 3DWGA 4ZAZA 4KODA 4BC7A 3R09A 3C8DA 3TOQA 3T7IA 1B15A 4LG1A 3EGDB 3IIEA 2Z58A 2C4MA 1VYTA 3VYRB 3DFFA 5J2TA 5KC8A 5C2CA 5JASA 4OGFA 2PUTA 2HVIA 4RW9A 4HHJA 2N7YA 4OLJA 1ZJJA 1Z7EA 3OPQA 3N2ZB 3ZWCA 1JQAA 2DITA 4OZ2A 2EFPA 1ZHHA 1R0CB 1YJ5A 4G6ZA 1YA8A 2RHCA 2LU1A 4RSRA 4G1BA 2EKDA 4C8NA 2CQIA 4NYJR 1ZCBA 3U26A 2VDVE 3AD8C 1DKUA 3QH4A 4LRQA 1U65A 2FGOA 1B8VA 4EOGA 1JHOA 2REQB 3P9YA 3TX2A 4V38A 2FWBA 2RE8A 1SB6A 3LWDA 2JA2A 4REQB 1EKXA 3TQCA 5JWRA 5L7YA 1UWBB 3HO6A 5TNXA 1CR1A 2WTBA 2GYWA 3VR3A 1RP7A 1RJFA 3RC2A 3JPWA 1R1DA 3LKZA 1J2RA 2VI5A 2H48A 1EWVA 4CPDA 2AMLA 4UXJA 4S1OA 2PD4A 4CV2A 2Z09A 5KDOA 4OK3A 3I8OA 3S1LA 5CT5A 2UU9J 1RWNA 3OPNA 3NOCA 3KYLA 3LPEA 2WFLB 3N5CA 3D8BA 5DXFA 5TX7A 4X00A 1BWPA 1VA5A 2JLYA 3G2HA 4ZHQA 2JIZD 3SP1A 4LA4A 1X4BA 1K8QA 3K05A 4LMPA 3ZVMA 3LGHA 3NOOA 2YVLA 4I7FB 1C3OA 3V6JA 3NP7A 5COQA 3HU2A 3IJPA 3GRAA 1Z39A 2FRDC 4CMEC 4A27A 4MWOA 4BFLA 4ENPA 1UDXA 1PYOA 4YJHA 4DLAA 4FBGA 3AJAA 3M82A 3G23A 4KN9S 2OPQB 4LGMA 1XKXA 2P4EA 3I56S 2IBSA 4DR1B 4UNIA 2OILA 1S6QA 3VX3A 1Y1TA 3AB3A 1L7MA 2ZTHA 3AEYA 3LO8A 4GICA 1CLUA 1ZB8A 5DOVA 4QD3A 1EA5A 1PV4A 3E70C 1SL0A 1C1YA 3ESAA 2CUYA 4J9PA 1XB2A 3CVUA 4NBLA 3JQRA 3L77A 2CVEA 4J7UA 1TCCA 1MH9A 2VQSA 2DWPA 1I1NA 1JJHA 1BDBA 4L4RA 1J70A 5BPFA 4XW2A 4DSTA 5ITHA 3DCNA 5FLYA 2O7RA 2C9YA 4WW0A 4ZRDA 3LU1A 3EQ9A 4V0MA 1K8YB 5A3SA 2G17A 1EUCA 2DVIA 3P5SA 4D26A 1DMRA 5LB4A 3KQHA 4M63A 2VDOB 2ZB8A 3EFOA 4ZQEA 3R1IA 5LP6A 4JI1J 4IDQA 1BFKA 4LSLB 1FUUA 1FDTA 4PAQA 1LI4A 4MR9B 3IAM1 4KQXA 2W2MP 3H42B 3UWTA 3U2QA 3B6KA 3T9CA 2AD9A 8OHMA 5IK2D 3AR5A 1WTFA 4MV9A 4IIDA 3PB3A 5TJHA 4JSTA 2XW6A 4NPCA 1QPBA 2A9JA 1Z36A 2IHTA 3OP4A 4E07A 1Z83A 5F7JA 4JJ6A 3W6ZA 5H02A 1T9WA 4QX6A 2Z8YA 2M2IA 4Y6QA 2H4ZA 3JYOA 5H9WA 1N5VA 3B9QA 1ZAVA 3ITNA 3UN5A 3ZW8A 5J2NA 2Q6BA 5JBIA 4JI8B 1V71A 1F4LA 3DZJA 1UIRA 2FQYA 2WTNA 2Q4EA 1NVVR 1OXVA 4B4VA 6REQB 2O8FA 3SN6A 1H0RA 3SM9A 3N1UA 1L5MA 5DYIA 4N9WA 1HSOA 4PRZA 4L02A 5GVRA 1ZR4A 2X0NA 3DCJA 5HVHA 1RT3A 3LQ1A 2XWSA 5DIFA 1CUCA 2R86A 3KJQA 5ERXA 1RSZA 3IEXA 3KLIA 3P2EA 4LF7J 2ZBEA 2FWRA 5HO4A 2RIRA 2YL2A 4JYCA 2CJQA 1THGA 5JSYA 3G8BA 1D9DA 3OFSA 4JYZA 4BS9A 2O6HA 4UQTA 1WEKA 2R5NA 4QWWA 1S5PA 1TI7A 1FE4A 1FC0A 2FHMA 3UG6A 3GGCA 1P62B 3HRIA 3MAAC 1G4AE 4HJXA 3WY9A 4XYGA 4TYQA 1IKVA 5LIPA 3ROFA 4UD2A 1W2IA 3ZFVA 2JOQA 3BKUA 3HL0A 1OLUB 1TK3A 2G9UA 4WBNF 2PH5A 4P53A 1FD2A 2J6TA 2D7JA 2FKNA 4KGZB 3R5JB 4MIAA 3H2KA 4EM6A 3C15A 5K8UA 4FOTA 3CWZA 3LTEA 1LNQA 3DN9A 1C7RA 4JB8A 4FR0A 1FF9A 3TLKA 4DEVA 1O03A 2Q6KA 3P9RA 5A9TA 3MUTP 1O6GA 2C54A 1HYSA 4CMBA 4PSUA 4W1QA 3PUWA 4WKGA 3FPCA 1KZGB 3ZI0A 1UFLA 3DLLQ 3MAJA 4B33A 3P9SA 2P4SA 3KFWX 2HKEA 3T35A 1V11A 5EHIA 3KETA 4Q6BA 3TUIC 2F1KA 1NNSA 1E2NA 4QGSA 2VNHA 3C14A 3DJYA 3LI2A 3KQOA 1L5HA 1NQAO 2WNHA 4K8RB 1H2WA 4U7DA 2IDMA 2PLFA 3DL4A 5CVTA 2ATXA 3AWDA 1EFAA 3MQ2A 3I42A 1E66A 4R0EA 1V2GA 4KQ6A 4ND2A 1O92A 2NNLD 3NZEA 1HG1A 4TZ6A 2HWKA 1M5VC 2WKWA 1FYXA 3NV7A 4E2XA 2HGNA 3D7NA 2VTDA 1NBOA 4FGSA 4UVGA 2B4TO 1U26A 1ND6A 5TMEA 4P35A 1UPFA 2B1GA 1SD2A 4M37A 4ILLA 2CF6A 3JYQA 1KY2A 3QVTA 1ZBDA 2OD6A 1XA3A 3L95X 1LLDA 2Q5JA 2Y76A 2AI1A 4JJ8A 5CFZA 5CFMA 3MOZA 5DDQC 4NLDA 1P27B 5JSZA 3PEJA 1NU8A 4XSGA 5HZGA 3CIOA 2G06A 5AHXA 2WYOA 1PZGA 1SCAA 2XXJA 2ZIFA 1SUWA 3BPDA 3OW2R 1Y7IA 3S27A 3R77A 4XFDA 3VZQA 1J1ZA 4BMSA 1V60A 3CH5A 3LY8A 2RCNA 3DM2B 5F4ZA 1IM4A 4YDRA 1NUTA 2MKIA 2YIVX 1TL1A 1QWSA 4MJXA 4MAKA 2YIJA 1U90A 2ZH5A 2BMDA 4D5EA 2W7AA 3ANYB 4D3FA 3UD3P 4RGQA 2ZVDA 4DQDA 1DXHA 4LISA 4X97A 3BK1A 2I22A 1JYEA 4MV4A 2PM8A 1YKGA 4OHCA 5DX0A 4EBFA 5EJIA 4O8ZA 4YPFA 3T3NA 3L0BA 3WWEA 3SLRA 4FCVA 2HURA 4ZQGA 2VDKB 3TLMA 4O4LB 3VZCA 2EG2A 5KFCA 3MFIA 2AG8A 4QYWA 2W9AA 2OPBA 3ITHB 1IUNA 4JLBA 2P1ZA 2F64A 3JTPA 3H4DA 3I72A 5AVUA 3EG9A 4OKNA 1Q21A 3ZZPA 4Y2UA 1TU0A 4ID5B 1KWMA 1LPPA 4E12A 2Z1NA 4ZYVA 4A0RA 3B9RA 4HLNA 4F4IA 4ACBA 1GTSA 2WVBA 1HZZC 3FTNA 4LE2A 1VQMS 5LMNJ 1RJEA 4URGA 1JW9B 4OZ1A 4WK4B 4Q3KA 2TMKA 3ZD7A 1HQCA 2GDZA 4WZZA 1XU9A 1RT4B 4FZ3A 1ISHA 3MIIA 3JXEA 3D7SA 3EQ2A 3LMKA 3EXHC 3MM7A 2VHJA 2ZJ5A 3UWPA 2P3LA 4USTA 4NENA 5AVKA 1DV2A 1BWVA 2B8PA 1Z5OA 3G2LA 2YHIB 2BBWA 4A16A 2V34A 3AXMA 3RC1A 4BNXA 4EX7A 4MVJM 3M4XA 1W49A 1OAOC 3WLHA 5SY9A 2B7BB 4INOA 1R4ZA 1XPUA 2CADA 4HH4A 1HBUA 2VNSA 5HE8A 3MCVA 4FC6A 4ZOBA 3WGHA 3W8RA 2XOXA 1FX0B 2QD3A 5HMMA 1RMYA 2YJ3A 1JN0A 4GKJF 2AF4C 3STTA 3S7RA 5E8RA 1MLDA 4GI2A 5IT5A 2AQ8A 1VIDA 4OZ0A 1RFLA 3NBQA 1X4GA 2Q3EA 2R8JA 2E85A 3JRXA 3TG8A 2NCLA 1IHXA 1HR0J 3UPFA 1N0WA 3I55S 1PVOA 4FSDA 4BIIA 3P2MA 1LPOA 1LEOA 5JAZA 3CC2S 1TM1E 2R8GA 3DEKA 3HLKA 1XJWB 2HSEB 1JQ3A 3B82A 4FKZA 3LOUA 2J33A 1VDZA 4JROA 2SXLA 5FV4A 2G2OA 3H98A 3WRVA 4FYXB 1WABA 7REQB 2UKDA 3A3OB 3BN4A 4A0HA 4PY2A 3B1ZA 3MC1A 3H2VE 1HURA 3UXMA 1X31C 5AVYA 1F7UA 4U2GA 4MAMA 1O4WA 4FP9A 3NGTA 3L06A 3CJEA 3FOFC 2XA2A 2GVDA 3ZZ1A 4NYMQ 4KN5A 3ZDEA 4YHBA 3RAPR 4CW7A 1RKVA 3HE3A 3UW1A 3ET4A 2X6TA 2YKNB 3TECE 4CM5A 2WU3A 1K9SA 5EIXA 1QGAA 1CBUA 1Y6QA 3AW8A 2OO5C 3K72B 4BNDA 1IBMC 1QYVA 1Q44A 2ZWOA 2CHGA 5HVFA 1FLAA 1NBEA 3R7NB 4L74A 3HLTA 2NP6A 3RBZA 4YBZA 2P6SA 1IUOA 4R2MA 2R6ZA 5L8VA 3U62A 4BUJA 2DYKA 3CX6A 3MTDA 4G26A 1RJDA 1FJGB 3GPBA 4ED0A 1ZRHA 4E11A 3H97A 2Q1LA 4B80A 3G6VA 2VPWB 1RKIA 2G4LA 2GFHA 3LNTA 4RLFA 1A5ZA 4FW8A 4H6WA 1UWLA 4UUMA 4F1KA 2RIJA 1ADBA 1J4AA 1Q0LA 3LY5A 1OLSA 1GQQA 4EZIA 3PUXA 4AD8A 1XXHB 2WI8A 3QGPA 3OX1A 4DV5C 1RBLA 3GP5A 3CGWA 1QO9A 2O54A 2Q29A 3GA5A 4P4UA 3VGSA 1RCFA 2Q0XA 4RVGA 2GLUA 3GIJA 4HRXA 5CAEA 2J5AA 2ZRLA 4B82A 1RLOA 1OYYA 3IBSA 3NUZA 3OUYA 5IVIA 2ZR9A 1GPDG 5HYVA 3A8EA 1Y3IA 2QQEA 4JI1C 1PJSA 3BH7A 3E9QA 4RZ2A 4DNFA 2YRWA 3M3PA 1WOSA 1E79A 4CLKA 3SEAA 4N4AA 5IFLA 2PCJA 5JD6A 1H8HA 3AF4A 4TU7A 1CC1S 2QAGA 3FYUA 2Z2YB 1R5OA 2V94A 2PUVA 2WYIA 5C7PA 1ZXXA 2ORWA 3EN0A 3L8DA 3GRFA 3VJKA 1FERA 1V45E 3R9XA 5L53A 4L73A 3QE4A 4MUNA 1G8MA 1P7WA 3ZOZA 4ZVTA 1QHXA 2DKNA 2CNWD 3PRDA 3LVRE 4DDKA 2QHXA 4JODA 2JEZA 3M8YA 1OCEA 2ZIZA 2QLBB 4WCVA 1T0IA 2D13A 4L07A 3EIXA 4D9IA 3REFA 2DVMA 4N5MA 2CW5A 2YJTD 2FRVA 2ANCA 4HHHA 1IY0A 4CO1A 1S1TA 4IQ4A 4I9NA 1Z2CA 2OXCA 2ZVSA 3NG8A 4J03A 1Z5WA 4XIGS 3B60A 2EATA 2CJPA 2HT6A 3IEKA 3ES9A 3EVCA 5SZIA 3N9IA 4JVNA 5JVGQ 2BTOA 1MVLA 4F4HA 4Q7EA 5JVDB 2GEVA 5LQJA 3JARA 1S9EB 3UDLA 5DX8A 2AD1A 4JUCA 2ZULA 2HF2A 2FR1A 3IXQA 1QP8A 1LLUA 3DS8A 2PV7A 4DQIA 3QELA 4W5TA 1MV5A 2IPMA 5LDHA 4EG1A 4KLRA 2J5XA 1CNEA 2GN1A 3ZNPA 1WCV1 2BDPA 1W4BA 3GHYA 1UBOS 4WZMA 2YBEA 1T8UA 3N76A 3Q7TA 4AU1A 4RORA 1L7BA 2JEJA 4YRIA 3PNIA 3ZTOA 1TZBA 1MOPA 1YMUA 4DL7A 3B6EA 1UR5A 4EIWA 4XDDA 4J1TC 3GLUA 4Q0MA 2FNAA 1MMNA 3RSFA 3FFTA 2CMKA 3CZMA 1XP5A 5KFBA 4QRIA 3EQ6A 2NXUA 1MBZA 4FF1A 4RW4A 1II8A 1GQ2A 2CPJA 3N05A 1M34A 5HA5A 1SG6A 1E5DA 3L09A 3IUMA 1KF0A 2OXIA 3AEKA 4B40A 2HZ7A 4LXUA 1SCKA 2Q2WA 2DNNA 1GR0A 4LRDA 5BR7A 1HIYA 1MX3A 1IPHA 2FWIA 2GM5A 2GKSA 3TRGA 2GKOA 3WB2A 5CLGA 2HGSA 3T4EA 2O2GA 5DZ7A 3MJDA 2PMHA 1ZO8A 4CCYB 3TSOA 2DUUA 1MXAA 3DLEA 4MVJP 5HMXA 5IANA 5HANA 3EGVA 4A2WA 3A04A 2XBMA 3NNHA 2XA1A 1ODLA 4NASA 4HHEA 3OVMA 1YFJA 1U5CA 1SUFA 4MMXB 2PC6A 1GX6A 3TSYA 3DU6A 1MW9X 2GILA 1R0SA 2HXYA 1QZZA 3F41A 1MQAA 3H8VA 5A8KB 1KGDA 4ARCA 2GFQA 1YL7A 1U7HA 3LW7A 3G0IA 3PEWA 4KEAA 2JFFA 4M5LA 1HE1C 4PM4A 1V0JA 1XVIA 1SC1B 4BKMA 2L9DA 4PN3A 2FV8A 3W9BA 4MK7A 5FIIA 3JD2A 2W01A 4I7EA 5HK8A 1UKCA 3ESBA 3GLGB 4QG7A 1L4UA 4P3YA 4HSEA 1X7XB 1FDAA 1OH6A 2OA0A 3H17A 3AF5A 2PYIA 2WF6A 4A10A 3OIUA 3O7WA 1FVFA 2HSZA 1J5EC 3RUBL 1UJ6A 4DR7B 2N4DA 1PR9A 5KTKA 3D54D 4BBAA 1IHOA 2WIGA 3QWIA 4HDMB 2PBLA 4Y6SA 1VJWA 2HCJB 3I28A 4YJFB 3J7A1 4ZU3A 4X4QA 1USKA 1Z3CA 2O2HA 5A3JA 3LCUA 2VJAA 3LVFO 1RVV1 1Y1PA 2CAJA 1G6OA 4HADA 3ZV4A 4KGXB 4E51A 2MIIA 4BWMA 4AN4A 4ER8A 1Q50A 4F5EA 3HCPA 1PI3A 1PT6A 2FH5B 2XH8A 1JI0A 2F1HA 1IY1A 3OIFA 4B1FA 4TWBA 2DD8S 4HBGA 2VZLA 2QSUA 4X64J 4FLMA 3IDAA 2QYCA 1ZVQA 2NWQA 2MZSA 1T3SA 1C8VB 5FL7D 3TLBA 5ETJA 3KJGA 4JYAF 4BDTA 4NBWA 3WB9A 3Q7QA 3NGDA 2BE7D 3WO0A 3MWFA 3NHLA 3PI7A 1D4OA 3PXUA 4JB0A 5SZTA 5GMDA 4ZLJA 4EA8A 2VAVA 3MXTA 3J81j 4MFBA 2D5IA 2AG0A 1RE1A 2WK4A 3AVQA 3NHUA 4ND8A 1YMQA 5T3UA 2HHAA 4TYYA 1QHFA 1Z18A 4WNIA 1ZK3A 3FN4A 4OXRA 1CB0A 4BX3A 2CXNA 3O4HA 3G49A 3X3UA 2DCMA 5K6RA 3NORA 5C5DA 2HHLA 3TZ6A 2FUNB 3HUTA 2RHOA 4CL3A 2IH4A 3VH2A 4Q3EA 4DR7F 1N6NA 2QLLA 3KO8A 3CZ4A 1VI6A 5CD4H 1N9GA 2VH1A 1IB0A 2IZ0A 4X71A 4LK3A 1G19A 3H0EA 4ZOQI 3JAWB 1E6VB 2ZB7A 2F1FA 3A8KA 4C4ZA 6CHYA 4KOAA 1E20A 2QN9A 4X66B 2QIPA 2YHSA 2NZWA 5JCOC 1CJUC 3ZWMA 2AG5A 1E4YA 2NUTB 4KN6A 5ALWA 2AFIA 4EMBA 1NASA 5F3TA 1ZNZA 5B1IA 1RPZA 4DC9A 4WPGA 3V8BA 3BWEA 3ROTA 4MKGA 1U6ZA 8RUCA 3BZBA 3KFLA 2LWIA 2VXYA 1SQGA 1KHWA 3O95A 2FU5C 1ISPA 2QA4G 2J6HA 3FDFA 3L0DA 5ETNA 3NTLA 4LJAA 2H1WA 5BSMA 1R0BA 5DNVA 2D8AA 3KDSE 3KJVB 3NALA 1Z8FA 3U3DA 3ETJA 4F2WA 2B4RO 3RYCB 3EDRA 3OO1A 3SICE 3L49A 3ROMA 4ARZA 4NCGA 5C35A 3ONQA 1Z4QA 2NQ2C 4JB2A 1WU7A 2YY7A 3B12A 3SDZA 4HL6A 1W0KD 5F2NA 3VM6A 5BSKA 4KYVA 3NBAA 3OOWA 2O67A 4F3CA 3DCAA 1TKXA 1RXUA 1HH2P 2Q9UA 4KFSA 1M6VB 4ECRA 3ZGZA 3ABQB 2GBIA 5K0NA 2RILA 3VHQA 3QTTA 4YHHF 4XSVA 3OC6A 3RUDA 3CBQA 4K26A 1M66A 2VC2B 5I5EA 2E4UA 1LVUA 2E48A 4JI4B 1ZX1A 1SIZA 2H2GA 4NATA 1UMCB 5L4LA 2BCEA 1KYTA 4Y00A 1EFVA 1WWKA 3OZDA 2GMHA 2HRBA 2O2CA 3L7JA 2LXNA 1QDUA 2XMKA 1A2OA 2ONYA 4AYBD 3IG1A 1LDBA 1OXBB 2H7CA 1NY5A 3LCRA 1TEHA 2IE0A 4ZAGA 1MEEA 3I2FA 1YJBA 3MINA 3IR6A 3DMJA 2QJTA 5KJEA 1IRIA 1RT9A 2HJSA 3DMTC 4G0QA 1KPIA 4ANFA 5JMNA 2OSBA 3QLHB 1EP1B 1R0XA 2YCBA 2IQ5A 3QJPA 4RR5A 3LHDA 3TAUA 2H2AA 2R96A 4ERNA 2ZD1A 1HYHA 4GKKB 3VALA 1K0RA 1T3LA 5AW5A 4NH0A 4NE9C 3FPBA 4JLSA 2G9NA 2FPKA 3GXOA 2L3MA 4BBPA 3RUEA 1N5QA 4XE5A 1T2CA 3NWPA 3Q11A 4WH0A 3CLSC 1ELOA 4LNAA 4PXYA 3ZWVA 4FDFA 1T8RA 4XQ0A 3EFOB 1Q12A 4M5DB 1FRMA 3BCSA 4S24A 1VIXA 2PKRA 1BX3A 1LDGA 1SCJA 3CPJB 3S2ZA 4AC9A 5F8JA 1RTIB 1MC8A 1REQB 1X0XA 2NAPA 2GYUA 1VIYA 3FBBA 3KKOA 2ZH2A 3IUNA 2B6AB 3E8XA 3CCTA 1HBMA 3GV8B 4RPJA 4UOGA 3MWEB 5IC4B 1RWOA 3EUWA 4F7WA 3Q83A 1JDBB 4JBYA 2I8EA 3MGCA 5C18A 2NQ8A 3NDJA 5FKJA 3DHYA 2F67A 3JSMA 4HQ6A 5DLGA 1I1OA 3A4LA 3OG9A 2C7OA 2AYXA 1DRJA 1OI2A 3H5UA 5EE5B 4CCHA 3HDHA 4G07A 3ROQA 3GH3A 3SYKA 2XVXA 3ISVA 1JFVA 1XNRC 1B4DA 4LSZB 4HH3C 1QP4A 4BTVA 4IICA 2V74B 3KRTA 1Y0HA 2OYCA 2P4HX 3NJ8A 3GV5B 4AY2A 3JAKA 5CLHA 1FW6A 3Q3VA 1YULA 4EPTA 4CM3A 1JMTA 1N5RA 1LI7A 1DOAA 1YXMA 4LNUA 4XASA 3G5AA 5DPMA 3M89A 5T7BA 5FTWA 3KP1A 1JLAA 3QV1A 5FBLB 2X58A 4NJEA 2WFMA 2W9CB 1SFRA 2ET6A 4WNYA 1QKKA 5ITWA 2W71A 2J9GA 1HQUB 4MK9A 1I4OA 5DDOC 2VTBB 1JR4A 3W2IA 1TA4A 1GXUA 5D7NA 5EWEA 1P0FA 1OIWA 4DCVA 1W1WA 1DT5A 1TQ4A 3HKCB 1J5PA 4CM4B 3JALA 5DGXA 1BHJA 2VDUE 3TW6A 3GCWP 1AZWA 2MOKA 2HY7A 1MLAA 1QIKA 3O8DA 4AL4A 5DG9A 4RM3A 5KQGA 1QYDA 4EY3A 1NF3A 3G9XA 2ZSJA 2A0YA 2A58A 2PGXA 3W3ZB 3ZK9A 4BB6A 2GWHA 2VG8A 3KC2A 1FI4A 5LCIA 1YRWA 4ZVHA 3K9BA 2CY0A 3N79A 5CEJA 5IKEA 1FW8A 1JV2B 1GPWB 2XY7A 4WXOA 1TPYA 2EZUA 3ON5A 3IV7A 2VD3A 3K73O 5LYJF 3MURP 1XBTA 3ZDAA 1FCAA 1WDKA 5JQGF 1IUKA 1YB1A 3BAFA 3ILOA 4F4XA 5DOZA 1V1RA 1IWPB 4N54A 4OQLA 1WUUA 5IN5A 5JXJA 4RTLA 1TKBA 1ZTWA 1U0FA 3VDXA 3K2IA 1YIAA 3CWJA 4F5ZA 2VQEJ 4P72A 3N2KB 4DCJA 2ZOMA 3NV9A 2HPUA 3SQLA 5KZMB 3WB1A 4HF7A 4HI1A 4DUZF 5AYVA 4M86A 1LW0A 1ZSNA 3QY0A 1LQ9A 1AN0A 1C9EA 1JXMA 2O2IA 1NM5A 1WJGA 3CMES 1C3EA 3S6EA 2Q0SA 5ALEA 4Q7LA 3PQ3A 5AVOA 1NTRA 1WWHA 1XDDA 2PRIA 2XECA 4JOSA 1JIIA 2IPXA 5IDXA 3BQMB 3DZIA 5CW2A 1D4ZA 2VF8A 1YJTA 3CD7A 3JQAB 2QMWA 2AHOB 3NFYA 1V25A 2WRZA 1QBKC 4NE2A 2FJXA 3I82A 3K3PA 1JG3A 2XE4A 4FYWA 3PLAE 1Z7BA 4F4ZA 3G0OA 3IUSA 3TVZA 5HIAA 3RV4A 4WK6A 1CJKC 3MM8B 4YT8A 1JVBA 2AOTB 1Z6XA 4Z2XA 4D0SA 5JYBA 3F71A 2H3EA 3PJFA 2OZLB 4FGKA 5CQGA 4RNFA 2H07A 4LW8A 5AVVA 4J9OA 2VHXA 4EKGA 2RKBA 4TTQA 1E3QA 2HUNA 4X1IA 5DYTA 4RTRA 1W59A 1WCXA 2VDQB 4A2QA 2EPIA 5IVHA 4BWVA 4TV9A 3RAMA 4KAAA 3RAXA 3L7CA 4C3VA 4G5OA 4D3YA 3AT1A 4LC1A 3CUTA 3R97A 4DR3C 2YFYA 5DTQA 3HBJA 3J80A 1Y89A 2F9FA 1DBRA 2P7HA 4ZCSA 1WDDA 1DARA 2J9EA 1F5SA 1RDFA 4MI9A 2DYAA 1T24A 2VPXB 5A6PA 4XD2A 2OZVA 4P34A 2GBPA 3Q7SA 2ZSFA 2J0QD 3OT9A 2DH6A 1Y80A 2O2EA 3L4KA 1M76A 2PEYA 2WM2A 4C3MA 2JLRA 1XCOA