2ZZMA

The complex structure of atrm5 and trnaleu
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
333
structure length
329
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVSYAPREYILALDFKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 82
structure length 329
sequence length 333
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zzmA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zzmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zzmA03
3MTEA 3LCCA 3HA3A 2ZWVA 3M70A 5JUWA 4CTJA 5CVDA 1KPHA 2ZLBA 3IEIA 3I5UA 3CGGA 4DMGA 5GIPE 4RTSA 4BY9E 5EEHA 3ID6C 2NP7A 3OFKA 4RTPA 3NDJA 3LX6A 5FHRA 3IV6A 1L3CA 2AOUB 2YXLA 2PV0A 2BH2A 4ISCA 1D2CA 1JSZA 2AOWA 2PJDA 5FUBA 1Q0SA 4GOND 1X1AA 2ZTHA 4YUXA 2ORED 3C3PA 2XYRA 4C08A 3I58A 1G6Q1 3LDFA 3JWJA 2P35A 4OQDA 3AXTA 3P2IA 1L9KA 2WA1A 1JQDA 1ZKDA 1L3IA 3G2PA 4MTLA 2PT9A 3R24A 1AQJA 2VDVE 4X1OA 3THRA 1MHTA 3EVAA 3KQMA 3GRYA 4YMGA 5K05A 3FTEA 5LSAA 3G2OA 2OY0A 2YTZA 4PYQA 2FYTA 4PYOA 3FRHA 1G60A 2IGTA 5GIOE 1AQIA 3TMAA 5GM2A 4E70A 2ZBQA 5CCBA 2G72A 2NYUA 5ICFA 3OPNA 2P41A 2JHAA 5FCDA 1Q0TA 3T7TA 4EQZA 1WS6A 5EZQA 3FTFA 1JQ3A 1H1DA 5DM4A 4B17A 1FJXA 1I1NA 5E1MA 4QDKA 4XUDA 2PGXA 4GOMD 3TM4A 3NWBA 3A4TA 3LKDA 4OQEA 4MWZA 5EOVA 4YV1A 4RTNA 4M36A 1KPGA 4PIPA 3SSNA 4P7FA 4V0QA 4GQBA 5HIMA 4DCMA 3OZSA 1O54A 1NBIA 1FBNA 3IYLW 3P71T 4QDJA 3LL7A 4BP3A 3LDGA 3KU1A 4RTKA 4E2XA 4PGGA 5LQAA 1X1CA 1QYRA 2EG5A 1FP2A 2Z6UA 2N47A 4GOOD 3KQVA 3B7PA 4XCXA 2QM3A 3E23A 3C3YA 4YMHA 5K01A 3O31A 3BGVA 1JG2A 5ICEA 5GOZA 2GAFA 2C7QA 3NTVA 4R6WA 2BR5A 2QRVB 2ESRA 4XUCA 1WXWA 4HSGA 4PYKA 3FPJA 1YFLA 2ADMA 2YQZA 5K0JA 4A6DA 3P9CA 5FQNA 1JSXA 2CWWA 2YUIA 1SUSA 4U7PB 5JR3A 3JWGA 3E8SA 4JXJA 5BW5A 3ANXA 5E8RA 1EQAA 2O05A 4DKJA 3FPHA 1BHJA 4QVGA 1JG3A 3LCUA 2O07A 1ZHFA 2OXTA 1BC5A 1ZG3A 3GGDA 1AV6A 4FP9A 3UJBA 4GUAA 2G70A 1RI1A 3EVCA 3C6KA 1KIAA 3E05A 3TQSA 1QAQA 4FT2A 1X19A 3M6WA 3FTDA 3ORHA 3DOUA 3GCZA 5DTQA 5ICGA 2UYQA 5DT2A 2Z6QA 4CXMA 4Y30A 1Y8CA 4PCLA 3TKAA 1VBFA 4P7KA 3SM3A 4HH4A 3ELUA 3VYWA 3BWBA 1X1BA 1N2XA 4LECA 4O29A 3BWMA 4R05A 2I62A 4HTFB 3I53A 4K6MA 3DMGA 5CD1A 2ZIGA 1R8XA 4C4AA 1R8YA 3M33A 2YXDA 3KQOA 1KR5A 2EJTA 4OA5A 3RIEA 2PWYA 1RI5A 3P97A 4HC4A 3HP7A 3EMBA 1VIDA 2B78A 5ICCA 1M6YA 5E9JA 2G71A 5FADA 4EVIA 3DUWA 2C7OA 4CKBA 1NKVA 1ORHA 2PX5A 3DULA 4PONA 1F3LA 1FPQA 2BM9A 2P1DA 3OE5A 4ZTBA 1SQFA 3EEYA 1P39A 1DUSA 3SSMA 1VE3A 3OU7A 4C05A 2K4MA 4LWPA 4LWOA 4YUYA 4X61A 4KDCA 1FP1D 3NW9A 3FYCA 4GBED 2BM8A 3KQYA 3FZGA 2O06A 1N7JA 1XTPA 3AXSA 3M6XA 1QAMA 1R6AA 3BZBA 5E9QA 5KQRA 1XDUA 3L8DA 5CM2Z 2G8NA 3TR6A 4E30A 2Q41A 3B5IA 2B9EA 2I6GA 1KP9A 4HTFA 5FWDA 2QRVA 3ER8A 1SUIA 1SG9A 1ZGJA 4M38A 3GIWA 1D2GA 4AZVA 3DP7A 3DXYA 2AOTB 3NVMB 4E2YA 3PFGA 4C04A 4C06A 4MHTA 1IY9A 3BGIA 5CVUA 3QOXA 3KPWA 3BWCA 2PX8A 3I64A 5DPMA 4V0RA 3SGLA 4E32A 5D1HA 3SR4A 3KHKA 2OPBA 4PWYA 5DSXA 3UJDA 10MHA 3BKXA 4BLVA 2FPOA 3OZTA 2JG3A 1DCTA 1EAMA 4RVFA 2FK8A 5GINE 3HCAA 1RJDA 3CKKA 5T67A 3THSA 3T7RA 2P3LA 3KQWA 5DTRA 4PYJA 3HVJA 3UA4A 1RI2A 2GS9A 3S68A 2NP6A 4NECA 3EVZA 2QE6A 1QAOA 1QANA 2ERCA 2UYOA 3FUWA 1WG8A 3HCDA 3LHDA 3UJ7A 3JWHA 1JQEA 2O0LA 4PIMA 5EVJA 2GPYA 2LD4A 2CMHA 3HVKA 3FYDA 3HTXA 4PYLA 3UJ8A 4HGZA 5F2NA 2UYCA 3LCVB 3PFHA 5EHIA 3G5LA 4AX8A 3SXJA 3HM2A 4R6XA 2ZZNA 3G2MA 1NW3A 4R8RA 1NW7A 2PVCA 3DR5A 4IV0A 1VLMA 5E1BA 3V97A 1JR4A 3F4KA 4FSXA 3EEOA 2I9KA 1YUBA 3E7PA 2BR4A 3HA5A 1ZGAA 3LECA 4G56A 4KVZA 3UJ9A 3DXZA 2BZGA 2I7CA 3NJRA 5LQNA 4M37A 4GC9A 5GM1A 1X1DA 1XXLA 2DULA 3UA3A 2QY6A 1NW8A 5FTWA 3CJTA 3UFBA 3HCEA 4X63A 3LBFA 3JWIA 2PXAA 4QTTB 5KYGA 3FRIA 2PBFA 3LDUA 3KR9A 2OB1A 4OBXA 3FUXA 3OU2A 3T0IA 2OKCA 4P7JA 2PSSA 1IM8A 1NW5A 1T43A 1ZQ9A 2AOUA 2Y1WA 3EGEA 1WZNA 3GRZA 3OFJA 4WVLA 2AN5A 5FQOA 5IH3A 2EX4A 5T64A 2ZIFA 2XVAA 3GU3A 3C6MA 3U81A 2G1PA 2PKWA 2ZCJA 4M7RA 1UWVA 3B3FA 3G89A 1JTEA 3A7DA 4QQKA 5DM0A 2AS0A 2XYQA 3REOA 1G38A 1G55A 4RSRA 1UFKA 2KW5A 3GO4A 3OU6A 5FA8A 3TM5A 4AZWA 5P8WA 2AVNA 4F86A 3M6VA 3CJRA 2GB4A 4DF3A 5K0BA 3HCFA 5CVJA 3H2BA 3ER9A 3P9IA 4CWAA 1RJFA 4C07A 4F84A 1I9GA 3PX2A 3BT7A 2ZULA 4BP1A 3B89A 2HMYB 1D2HA 1I4WA 4FS8A 1ORIA 3ELYA 5CVVA 4AZTA 3PT9A 5CCXA 1UIRA 4KDRA 3EVFA 3SX0A 4ER6A 2XBMA 3EGIA 3GRUA 2FHPA 2NXJA 3MHTA 1B42A 2QYOA 1JG4A 1XDSA 3HEMA 2ZBPA 4P58A 2AR0A 1O9HA 1WY7A 4QQNA 2AVDA 2R3SA 3CJQA 3HCCA 3HVHA 4OA8A 5M5BA 1OR8A 4OBWA 4DCGA 2A14A 5K09A 3ELWA 3SMQA 4RTOA 4GC5A 4WXHA 5FA5A 2CKDA 3O4FA 4PYIA 4DA4A 4MIKA 2B3TA 5H02A 4YUWA 2VDUE 5DXAA 3VC1A 2XYVA 3BXOA 1VP3A 3TKYA 2HWKA 5T6BA 5EQJB 3RODA 4YV2A 1EJ6A 2EJUA 5E8JA 4QPNA 4YV0A 2IH5A 3HVIA 5DM2A 2PX2A 2P40A 4RTQA 5B1SA 4CKEA 3VSEA 4PNEA 1AF7A 1U2ZA 1F38A 3PTAA 8MHTA 5D1NA 3DXXA 1NV9A 3TPZA 3R0QA 5E2BA 5HIJA 3WSTA 3P2KA 1M0EA 4KIFA 2AOTA 1EJ0A 5BP7A 2IH4A 3O7WA 1KYWA 5EMMA 1VP9A 3GWZA 5DX0A 3LGAA 3NWEA 3NMUF 1XCJA 3KR0A 4L7VA 3SVZA 3V8VA 3P9KA 3TFWA 3KPJA 2B25A 2PWPA 1JTFA 2NXEA 5C1IA 1L1EA 2WK1A 5K0NA 4UOEA 5EZSA 3NDIA 4YUZA 3R6TA 1WXXA 5C0OE 3BGDA 5LQRA 1RI3A 5EKXA 1DL5A 3FTCA 4PYMA 5FULA 5HFJA 2UZ4A 3CC8A 3G88A 3MERA 2B2CA 7MHTA 4HG2A 1XCLA 1HMYA 3CVOA 3MGGA 3EGVA 5LQJA 1SKMA 4U7TB 2AOXA 5FWAA 3A25A 3ERCA 3K0BA 3M4XA 3GRRA 2BR3A 2PT6A 3OCJA 3P9NA 5C9ZA 3EVBA 1XVAA 4EKGA 5GP1A 2HR1A 3FUTA 3LPMA 1NE2A 2ZZKA 4R8SA 2IP2A 4RVDA 5EIFA 4POOA 5KVAA 3UJAA 4RX1A 2IPXA 3HA7A 2AN3A 1TPYA 5EMLA 5HIIA 1QZZA 2PX4A 2ZFUA 3GJYA 2GLUA 2YXEA 2R6ZA 3OE4A 3KR1A 3BUSA 3FUVA 4KW7A 5E9WA 3A7EA 2H11A 1IXKA 3G8BA 1M6EX 4PINA 2NXNA 4RYLA 3KQTA 5CUQA 2IH2A 3EPPA 3G8AA 3TLJA 3G7UA 3TRKA 4RVHA 3GRVA 2NNWB 1YB2A 5ERGB 2JH9A 2ZIEA 2F8LA 3CBGA 3LKZA 3K6RA 2DPMA 4IKPA 4RV9A 5EC8A 4AUKA 1EG2A 3BWYA 4HGYA 4BLWA 4EMSA 4GEKA 3T7SA 4F85A 3EVDA 2E5WA 5HIKA 3DMHA 2H00A 2P3QA 1EIZA 5F2OA 4E33A 3RW9A 2OBFA 2IIPA 3EMDA 4RTLA 3MCTA 4QTUB 2IBSA 4HRAA 3UWPA 4EK9A 5GWXA 3DLCA 2VZ9A 1PJZA 1O9GA 1YZ3A 2H1RA 1TW3A 2ZWAA 4X60A 3FPGA 1P91A 1XDZA 2PLWA 3Q7EA 3G2QA 3QOWA 1XJ5A 3R3HA 4IV8A 2GH1A 3D2LA 5CIYA 3PS9A 4OX9Y 3B3JA 3A27A 3KQPA 3MAGA 5DX1A 3PB3A 4KRGA 1KYZA 4AZSA 5BXYA 5EG5A 3DMFA 3MCZA 2FRXA 4Y2HA 3FPEA 3FPFA 5FHQA 1R18A 3P2EA 4RTJA 4E2ZA 1KHHA 1NBHA 2OO3A 2JJQA 4FT4A 4ER7A 3CCFA 1YZHA 2O57A 3ELDA 2NXCA 3MB5A 2PY6A 5DM1A 3P8ZA 5K0LA 4RWZA 5LQKA 3HCBA 1N7IA 1Z3CA 5DWQA 5K8VA 4RVGA 4DZRA 1RJGA 4ER3A 1R00A 3UBTA 1YFJA 4CKCA 3QV2A 1VL5A 3IHTA 2IFTA 3B3GA 1RI4A 2CMGA 3KQSA 3I9FA 1HNNA 1MJFA 1YF3A 5BW4A 2Z6AA 4ER5A 5K0CA 2ZVJA 2V7EA 4CTKA 1BOOA 2JHPA 2IDKA 2EFJA 2Y1XA 2ZBRA 4EKIA 5LQCA 2JH8A 1NW6A 2OYRA 2UYHA 3PLAE 5MHTA 2WA2A 1VQ1A 3KPVA 3PX3A 3Q87B 4ATNA 2AZTA 2P8JA 5EMKA 5HEKA 3G5TA 5K0GA 2C7PA 3LSTA 3DLIA 2V74B 3KPUA 1P1CA 3DTNA 4DM3A 3KKZA 1NV8A 3VC2A 4H0NA 3X0DA 1R74A 3MQ2A 1INLA 2IDJA 3TOSA 5E1DA 4RTRA 5E2AA 2GA9A 5EIWA 1L3BA 2C7RA 5EKUA 4FGZA 3PVCA 4KIGA 2YX1A 3SSOA 4QPPA 4P7GA 4PCAA 5DRYA 3AJDA 5DXJA 2AOVA 4XUEA 5HOQA 4PYNA 1KXZA 1G8AA 2VP3A 3GXOA 3EVGA 2P3OA 3HNRA 3EVEA 4IWNA 4E2WA 4ER0A 5HZMA 4GOLD 5EPEA 2ONYA 1VPTA 5EEGA 1G8SA 5EHGA 5IKMA 3NVKI 1SQGA 4FZVA 1TW2A 3UJCA 2HV9A 5DTMA 2HTEA 1P1BA 2CL5A 4C03A 1SVUA 4Z2YA 2ZSUA 2YR0A 3UJ6A 9MHTA 2XVMA 2IBTA 3KR2A 3KPYA 4YUVA 5G02A 5F2KA 5HILA 5E1OA 2OB2A 3FUUA 5LQUA 3C0KA 3M6UA 3KQQA 2ONZA 1NT2A 2YVLA 3GNLA 3OZRA 4MQ4A 4X41A 4DQ0A 4BLUA 1KPIA 5EGSA 3R9XB 2FK7A 2AN4A 2ZW9A 2FCAA 5KQSA 5LR6A 2JHCA 3BKWA 3A26A 3UZUA 2PXXA 4RTMA 5K0FA 3DH0A 2PXCA 3MTIA 5DSTA 3AY0A 1BKYA 5K0EA 2VDWA 3LBYA 4LG1A 3AWIA 1RJEA 5DLYA 1PRYA 5KS2A 4PGHA 5DRTA 2P7IA 2ZZMA 4KWCA 3GDHA 4A6EA 2VS1A 4FSDA 4QVKA 5DX8A 1JG1A 5K03A 3ME5A 5CVEA 5EMJA 2HNKA 5U4XA 4E31A 4GF5A 2OZVA 2P7HA 1V39A 4FR0A
chains in the Genus database with same CATH superfamily
1MRZA 4ALMA 4Q7AA 1Z4KA 5IQ6A 3GJXC 2ERYA 1DUIA 3AAWB 2IS6A 4B81A 3R40A 2AXPA 1XXHB 5K4HA 4ARSA 3D2CA 4KQFA 4ZK7M 4MYDA 3SICE 4FHEA 3ODGA 1VKZA 2ZHAA 3VUFA 4ZFNA 1J0DA 1FDUA 2V50A 4B3SJ 4UBKA 1UEKA 3CX8A 2M32A 3DLLQ 2A4KA 3FTFA 2X14A 1D09A 2Y4OA 4JB8A 2RGUA 1RY2A 3LZCA 2GTHA 4BLRA 2JC1A 3VGSA 1HRDA 4R3NA 4B76A 3RG6A 4RGYA 5JSHA 2FQQB 1P3DA 3CNNA 1G5PA 3WK8A 2OHJA 3E1SA 3Q8KA 1J39A 3INGA 4HQLA 2IM0A 2P4EA 3S27A 1UTAA 2BHNA 2PL3A 5FEUA 4PFJA 2IDMA 3HSGA 1NJZA 1S1XA 1RR6A 2DO4A 2QDKA 2Z9BA 3RJTA 2D3OR 1J5OA 1NG1A 4A2QA 4HB2A 1OAOA 2HS3A 1M6XC 1Y7TA 2LEBA 1I2AA 1KWKA 4WVFA 4YJHA 2GBFA 4KE7A 1ODIA 2RGYA 1O0SA 4NENA 1IM2A 3E03A 1HT3A 3MT0A 4B0OA 2XNSA 3T8YA 4XPZA 2IYAA 1PG4A 1AS3A 3MR5A 3FPKA 4YRSA 2HREA 3FKSD 3DGPB 3IQXA 1RZVA 1ZGJA 2VL1A 4C4RA 2XRMA 2O0JA 3ZNJ1 3CLSD 4XIYA 3EGDB 3ITHA 1ZTTA 5LL6d 4X93A 2OGWA 1QK4A 3TOZA 1HKAA 2RGRA 1HNXJ 1VKRA 1YZ6A 4HZGA 1LPBB 4TQ9A 1EJ2A 2QE7A 1QOPB 4PYLA 4LRXA 3WC2A 2Y99A 2H4ZA 2GVDC 4O4HF 3F5SA 3A6GA 1OWNA 1WX1A 2ILTA 2BZGA 2V4MA 2FZKB 1IWPB 1IHUA 3FSEA 1HGXA 3G6VA 4CIYA 1RWUA 3LXMA 4TVKA 4NOLA 2AS0A 1U1RA 3OU6A 5D4LA 2PK3A 4I1PA 1KGSA 3S7RA 1J5EJ 1YI8A 4EPRA 3I6BA 4PLHA 2HNAA 2X7HA 3DDUA 5E7JA 2FVRA 3ZQ4A 3KG2A 3OCXA 2L82A 5F5LA 1SJ9A 3N2IA 3TLGB 1HWLA 4O3MA 3KNAA 2AQIA 4A1FA 2XB2A 2GN9A 1EWTA 1ZESA 3D02A 1FJ2A 2RJOA 2LXFA 2QS9A 2YZGA 4H1VA 5KSOA 2DFKB 3RH0A 5C8DA 4PXYA 3SQGA 1KI6A 2VG6A 4F96A 3G0GA 2BN4A 3RFTA 2PPLA 1Z63A 2CNBA 2IRUA 1Q7BA 1G9SA 3MUVP 3E48A 1ZC4A 3FTCA 3UHAA 3U3MA 3HN2A 4NZZA 3PPVA 4RPLA 4NYOA 3M2PA 2QRZA 3A9TA 4K8RB 2QVXX 5AHKA 2FPXA 1XAHA 1RCOB 2FPKA 3ON5A 2QD3A 3E70C 1U94A 5KPJA 1EX7A 2KMLA 4PUHA 1WSVA 2IPMA 4UVHA 4RMGA 2CVHA 1MOZA 1NR5A 4UEJA 2QN7A 1GZ7A 2OQIA 5CLLA 3L79A 3ZEAA 3SWWA 4K88A 4QLOA 1S7IA 1NJSA 3CPWR 2ZS7A 1KARA 1SOWA 3KQPA 2H54B 4G5XA 2JVOA 1O6BA 3QLEA 3SEQA 5BMVB 1J49A 3CT4A 3V8EA 3QPVA 4EJSC 2J7PA 3K1AA 4EBDA 1AA9A 2A9FA 3DAPA 4EQ6B 4C1BA 3KNGA 5MN5A 1KEUA 2FWIA 4AJNA 1JKXA 1IBMB 1C0EA 1NPPA 4Z37A 1DPFA 4X7MA 1SK8A 4URFA 3HCRA 3W5SA 5GAEI 2NVWA 2ROQA 3CD5A 2C4HA 5C8YB 2AOVA 3W2FA 1XD2B 1KQPA 5AD1A 4CYUA 3HACA 3DRRA 2HIMA 1SQ0A 1KRHA 3PGKA 2FUG6 6YASA 2QV7A 1AA1B 4LEIA 1WHVA 1SKQA 1SVSA 3I32A 3GX1A 3P8BB 4ZI3A 4TMFA 4BB6A 4EEXA 1ADCA 3H9JA 2V03A 1FRQA 4MWTA 2AJ2A 1X7DA 4Q8EA 3DEZA 1E1NA 3EGDA 4ZVQA 3DJYA 4R8MA 1NLUA 1Z17A 5HQ3A 3FCSB 2NN3C 2AWZA 4Q3EA 3K70B 4TROA 3HUDA 4DR3J 2YXLA 2A6PA 3SC6A 4K8OA 4F4HA 2EWVA 4ZPWR 1Q0SA 2VSQA 3IQFA 4F9EA 1WHSB 3JWJA 1RE1B 3NUGA 1BMDA 4EW1A 1Y3IA 1AQJA 3PTLA 2D6FA 1IBCA 3UQYS 4RW6B 5IXYA 4EFNA 5BXIA 2AV5A 1SKWA 4LBYA 4GYYA 4R8VA 2FSFA 3T9CA 3REFA 4WOKA 4B17A 5C37A 5EN1A 5K9FA 5CDFA 1K97A 2UXBJ 2ZHBA 2XOKA 2GZMA 1JLSA 5BV2P 2VJVA 3E7FA 1RQGA 3KTDA 4L3WA 2F59A 3O6QA 1NSKL 1TU0B 5CDTA 2OPLB 1OMSA 2UXBF 4A6XA 3UPUA 2WFLB 2WTXA 2VZEA 3RFUA 4JBLA 3KOUA 2CVPA 1Y1LA 2RHDA 4MCJA 5D2CA 1M7HA 4WFKA 2NYRA 3UCEA 3B6KA 1VJDA 5L45A 1PU2A 1XMVA 2P62A 3ZE9A 3LOQA 2I8EA 3E7DA 2QRQA 5GADU 5JC8A 3GMIA 4DR3F 5L3QA 1G4HA 1ONOA 3P97A 2EXXA 3LT2A 2B78A 4AKSA 2HHCA 4KWIA 1MLDA 2JAWA 1BS1A 3TAPA 8GPBA 1ZIYA 3AI3A 1NO8A 3RBAA 2JCBA 1HFJA 1K8ZB 1YIJS 2AKAB 2DGSA 3DEHA 5KQRA 3EZYA 5AM5A 3MR6A 3JV7A 2YQ0A 2WMDA 1OLUB 5ECDA 4DEYA 1WU8A 3BGIA 1FYVA 5E38A 3K70D 3GG1A 1ZTWA 1SCDA 3DWGA 4X1IB 3OZTA 2XKAA 4NLOA 4H6XA 1UZHA 3NQ41 4NXMB 3Q8MA 3FGOA 4BFYA 2Q5JA 3JYTB 1C8LA 3W78A 5TT0A 3H5YA 2GAOA 4L0QA 2QVCA 4BNLA 2HIQA 1S8AA 3TNVA 1LDNA 2W2TA 3LDHA 2MHCA 3S2YA 1LWXA 4D6YA 1UEXC 3K0AA 3GK3A 2CNLB 1D1SA 1U0OC 3B5EA 4GM1A 1T43A 2OHXA 4DJAA 2JFUA 5DNUA 2XVAA 2OCIA 4PXAA 1VYTA 5A9SB 2KYXA 3H2BA 3MDFA 4HFRA 1GGNA 4F3OA 5A2QD 4MVJH 3SP1A 2HEGA 1MR3F 2OP1A 1CEQA 3GRUA 1MWQA 3HDQA 4PR3A 4NXNJ 5ETVA 3IJEB 4FTWA 4OBWA 2BTEA 5MF6A 5J2NA 3VO1A 1LXNA 1YJVA 2YWEA 1N0WA 3TQQA 1YR8A 3KUCA 5KTOA 4LFBB 1FX1A 1Q86T 4TXHA 3MPVA 4B2LA 1KAQA 1TKAA 5FBKA 2A6MA 3HI6A 3E2MA 3ADOA 1SKBA 4H0CA 2Z2LA 3BKUA 1KYWA 1PJSA 1VP9A 1P2DA 5K8NA 1X1TA 2ZJ4A 2XGMA 2OD6A 4DDWA 3MT7A 4EVQA 2JFDA 4BKRA 1DAOA 2J3EA 4JUCA 4IKAA 3W4IA 1MENA 3TYTA 4TOIA 4ND8B 3PEHA 3CVOA 2E2WA 3OQNA 2Z3WA 4B9TA 1RTJB 3AG6A 1G20A 3VHXB 1SEPA 1I5RA 4HNQA 1QZZA 1L5GB 5KHOC 3A31A 3GQBB 3QFFA 1AXEA 1DO8A 5EJ6A 1PVOA 3TLYA 2XUAA 4MROA 3ZDBA 1PCAA 2YKNB 4J43A 4DV5C 1EG2A 3ZWMA 3FSYA 3GUZA 4OUDA 2I76A 1FYFA 4R2HA 1L4LA 2HRDA 4WLOA 2ODWA 3GLHB 4MJLA 4CFZA 3PNMA 4Q2LA 5FUXA 3L1JA 1RT1B 1FRVA 1TVEA 3KOAA 3H9BA 5EIHA 3JQJA 5CEEA 1J5EF 1KI3A 2AZ1A 1E9SA 5C24A 3OCYA 2DCUA 1KO8A 4KWHA 1SXJC 1X39A 2PZMA 3SIXA 4JEHA 4XYLA 4IZHA 2JJ2A 3ZTRA 1N2IA 1GN8A 4ZHRA 2VPXA 3AUFA 3ORYA 1VIAA 4IAOA 2OV3A 4OKIA 1QIJA 4ZDWA 5B55A 3Q24A 1RTIA 4RW4B 1C3OA 1FFSA 1GRCA 3DRPB 4GYWA 1B0PA 2Q5FA 5H9VA 3C3EA 1GG8A 3FNHA 4G09A 1XNJA 1GK8A 1DHTA 3AXKA 1R0KA 3B7WA 1HNXF 2KT5A 1YBMA 1JFTA 3GLHA 3WK6A 1NXOA 2GBIA 2BFEA 2ZWMA 3IKVA 2HV9A 2AV6A 2B92A 4AC9A 2WZQA 4HYQA 1MA3A 1C0IA 2B69A 3BMXA 2Y1KA 2XYGA 3DF7A 5CX1B 3KQQA 3RRNA 2P1ZA 3AEQB 3IO3A 5CCMA 1GT6A 3NM6B 5K8CA 4F3YA 3DBLB 5K0FA 3CJ8A 3GLUA 5HF5A 3LT0A 1ITPA 4ZZIA 5IFLA 2B7BB 4DPLA 1WZ2A 1T03A 2J5BA 3D7LA 3BR8A 2B4VA 3GTYX 2P78A 1DG9A 1C7QA 3PR3A 2A3RA 2I3AA 1XR7A 1N2GA 7AT1A 3Q8QB 3TGPA 1CJCA 4YI5A 1RRVA 5ERYA 1QZUA 1ICEA 2VJMB 2X2EA 2WYUA 3HYCA 3I5XA 3JQ8A 1CJTA 3VH3A 5JTTA 3IBYA 3AL0C 1OFGA 1RWOA 2OA0A 2YJ6A 5EZQA 4PKDB 4IDCA 5FPHA 4LXYA 2C5FA 1HD1A 3DZKA 3I1FA 4BQSA 3NAHA 4ZVNA 3BTSA 1KWMA 4DRXA 3R1IA 2BDTA 5I47A 4OJGA 2H1IA 1CJVC 5FO0A 4GXRA 3TLMA 2F1OA 1UMDB 2YXBA 3CUUA 3PC2A 3SI7A 3NKVA 4BX8A 1VEHA 4PRFA 1JG3A 2PO4A 2ZVPX 6CHYA 3QWBA 1QCCA 4KLNA 1S7CA 3IB3A 4TYWA 1KIAA 4MS4A 1UDCA 5IT4A 2PC6A 4CT8A 2RONA 1FP7A 3F2IA 4HTAA 4CG2A 5B58C 3MURP 4CHTA 4ZXPA 3R7BB 3P9QA 2HDOA 1MW7A 5I7WA 4NXNB 2NZXA 3HPOA 5L9NA 2M2BA 4NG4A 2Z43A 5C18A 4B9EA 4P4GA 2CHQA 4JL6A 3V2HA 4O4IB 2ZSAA 1W9MA 2WP8J 1NUTA 4ZT6A 2ZB3A 4TYBA 2FEPA 1YH3A 3RJ9A 2YJ4A 2W8KA 3CE9A 1QF6A 4A0RA 3Q98A 2CV0A 4D2IA 3C16B 1NVUQ 1OH7A 1XVVA 3H6KA 1WDLA 1OYOA 1DQPA 2UUAJ 4PANA 2O3UA 5IVPA 1RQRA 1XU9A 3GFRA 2QM0A 4ZS6A 3HTXA 4QUEA 4WBNA 4BNFA 3FGNA 1EM8A 4JOSA 3T1HF 4Y2TA 2BGRA 3FBCA 3F7MA 4DC0A 3DXZA 3NAGA 1FRHA 4G97A 2PXAA 1E3QA 1TQHA 5C7LO 1R7RA 2BFFB 2RHWA 2MQLA 4TMVA 3TM5A 2AD5A 3P9IA 1A5BB 3AH6A 3TBKA 3V4SA 3THVA 1NJXA 1SU6A 3K92A 5FFNA 3EQZA 4N3BA 1CSJA 4RS3A 3O38A 4UVEA 3GAZA 4M0MA 1P3JA 1JLKA 3HCCA 3L1KA 2QLWA 5C25A 1MO3A 5JEDA 1WKBA 2Z56B 4GC5A 3IPLA 3ETEA 3LY5A 2HHHC 1P9YA 3VC1A 1Q7TA 4H7PA 4QJVA 1S1UA 2ZUSA 1VJTA 4JZKA 4NYZA 1VQMS 1P2BA 2WY2D 3TPZA 3OPMA 3IR7A 3M9WA 1IJFA 1CUWA 1KEZA 1DWQA 1SL0A 3KZMA 2AGOA 3BGRB 4MFBA 2UVWA 2OSRA 1CP3A 1E2HA 2YS6A 3HLYA 4B6SA 4ZQEA 2PGCA 4QHSA 4UQPA 1T9GR 1J2JA 2BR3A 3ZU6A 1DINA 5T57A 5D3GA 4EATA 5GVQA 1JYSA 1R15A 4P80A 2PS1A 1PKEA 5F4BA 2H9AA 3TZQA 3OT1A 1AKWA 5D3ZA 2QUZA 5ILQA 4R5HA 1O97D 1W4ZA 3URMA 4TY9A 1O8BA 5F2OA 3A9VA 4M9RA 3Q0IA 3FPGA 3T5HA 2GMHA 1QE3A 3NBXX 1WVIA 1RZRA 1OXXK 3FAKA 2C8JA 1BE0A 2FDCA 3LK7A 4RH0A 4XWKA 1Z8DA 3DXSX 1RD4A 4KMSA 3HUTA 2VUIB 1WO8A 4EKIA 2B1RA 2HVZA 4GI2A 4ELTA 5BYRA 3GY0A 4N7BA 3JARB 2H2HA 5AUQA 5L1IA 4KO3S 1C0UB 2DP4E 4DM3A 2CQIA 4BE9A 2J41A 2B1JA 2DGTA 5ALDA 4DC9A 5HN0A 1RBOB 1UW4A 4JAVC 5J2UB 2BFDA 5L3SB 2JLGA 1LDGA 1XC9A 3QT5A 3IR5A 2ZRGA 2QL9A 1JLMA 3U7GA 4QBFA 3FHOA 3W0LB 4OHFA 4ZZ0A 3AYZB 3UZUA 3M1LA 4JFRA 3K8WA 1RWWA 4H1HA 4ALIA 1OFHA 1W94A 1RWWB 2OPQB 1CRWG 5GONB 4AQYF 2NZWA 2C77A 3NMAA 4Q7QA 1GNVA 5A0VA 4PXCA 2DPGA 5REQA 2X9NA 4UAUA 1Z2ZA 4JI7J 2FWPA 2VRNA 1S8OA 3QPAA 2EYUA 4DG1B 3I1JA 1AB6A 2YWJA 4LOIA 4NMWA 4PYOA 3KJIA 3JYHA 1V1JA 4KBIA 4QPTA 2RI6A 3WR5A 1P18A 4YCLA 3IOYA 1GQYA 2V6FA 4DR5J 1L5LA 3VU9A 4CBVA 5JNUA 4EJ2A 3R7DA 4BB0A 2JEIA 1EZZA 1ETHA 2E1RA 3JASB 4PSKA 1LEOA 4TYYA 2HF8A 4PQAA 1BROA 4LVNA 2ID9A 2YWGA 3CLRD 1EDBA 2VCHA 4YXWA 3HBJA 3ENQA 3WB9A 3AKEA 2C31A 3QZ7A 4PBRA 2GWHA 2B5WA 1HDOA 1LWFB 4QVGA 3QFRA 1PYSB 1NC3A 3N5KA 3S7ZA 1T3LA 4JP5A 2FEAA 3TD6A 1B3TA 3TQSA 4MGZR 1A2QA 1WHTA 3MLBA 4FCVA 4Q01A 4CQ1A 2C9DA 4I55A 4TKVA 2VPIA 4OKSA 3DWFA 1DFHA 1W87A 2XMRA 3MMCA 4FYMA 4K81B 3KKFA 1KBZA 1OY8A 3UK0A 2NMVA 3DZGA 5LNK6 3TXXA 1DUSA 4IV5A 4X64C 4B7ZA 2BQ3A 3CLUD 2NVUB 1PHRA 3HR8A 3LWDA 5D0EA 5CM2Z 2G8NA 3JAMU 1H8EA 1TZKA 4HQ0A 4RD3A 4BMXA 1A82A 2WIDA 1TL3B 1WP9A 1VJWA 5K3AA 2HHHB 1SCJA 2R0QC 3E7XA 3ENZA 3IQHX 2CUZA 3W2VA 5K6AC 3I45A 3D1OA 5HHTA 3CZ5A 2XXBA 2IOFA 3K2EA 4GWLA 2ZXUA 3M49A 1SB6A 4LF5F 5KNCH 4QUGA 4P1ZA 4W7SA 1FC0A 2QRPA 3VUEA 2OV1A 1PFQA 2P69A 1GMVA 1T0UA 5EESA 2YKGA 3TXYA 4F5YA 4ECZA 1Z6QA 5TJ9A 4M0LA 2UZ3A 2C7BA 4URHA 2V68A 2YQ5A 1Q5PA 2Y0SD 3ORFA 3LALA 1GUBA 2QA4S 2VHUA 2AEMA 1X7XB 3EPHA 1W8IA 1UFKA 3FI0A 4RDIA 1NBEA 5G4DA 4R9RA 4LF7J 3KD2A 3PXGA 4RHUA 3HJVA 3FCAA 5HUQA 3BD6A 5AHOA 2WZCA 5THXA 5CA1A 1UZDA 3HEMA 4TM7A 1Q1AA 3VNQA 2Q43A 2PVPA 5ALSA 4D92A 2JLCA 4I36A 3SEFA 1UM8A 2CFOA 1I10A 1C5KA 2EKPA 2ISCA 5E3RA 1FNDA 4F2HA 2DNMA 2RHQB 3P0JA 2HEKA 4GSYA 4IIYA 2PRIA 2IYRA 4HDOB 1ZK1A 2E44A 1QRTA 2DR9A 2LE0A 3W5IA 4MW4A 5B3JA 5IXJA 5EKXA 4DQVA 3BJMA 5CBPA 1DAFA 1Z56C 5LKRA 1G6BA 3ABZA 4IH6A 2XMBA 2XZOA 4DBVO 1H8HD 3MAAC 2XRFA 3NHWA 2HMIA 4AYWA 3BH6A 1IOLA 1JU9A 3EZ6A 2C5GA 2Z8XA 2QTMA 5KX5A 3V2UC 5EGNA 4UARA 2VPYA 2BACA 3F6RA 4NBSA 3BULA 2P0YA 3C3JA 2VDMB 4HZUB 4DS4A 3S6EA 1XU7A 4C6SA 3J81Y 1KVKA 3WZ2A 1DKQA 4OM8A 3UZ0A 2JA1A 1AS2A 3LY9A 1QTMA 4B3MF 2E3JA 3K9BA 3EXHB 4DZRA 1RC1A 1RTJA 2CYCA 4OEHA 3PFKA 1J1UA 4D8UA 3IA7A 3FHTA 4DXAA 4RW6A 3SG0A 4RORA 1J0EA 1X7ZB 2PEHA 1U9CA 4DQLA 4WCVA 4IHQA 1RJWA 1CJTB 4BWYA 1NLYA 1Y63A 3BTOA 4CF7A 4DV0F 2P6SA 1JOSA 1LQTA 3DLEB 2O48X 4LQCA 5BYSA 1MB3A 3N59A 2E5JA 2PSFA 4OXIA 5G02A 3TW8A 2CLCX 5LA6F 3S2IA 1NPTO 8ABPA 2B9WA 4QNNA 4Y2IA 5ALZA 1MV5A 3GEGA 1P2GA 4FEGA 2ONZA 4XD2A 4RZHA 4NEHB 1KWGA 1QVVA 3KTAA 2YNFA 1UDBA 1K0UA 4J9KA 2YMMA 4P82A 1QTNA 1JBKA 3IUPA 2SKCA 3RBEA 1IBLF 1EFHA 1RKIA 1K66A 5FV4A 3L6CA 4HQKA 5ALYA 3UV3A 3HD2A 5BNTA 2XLCA 2GARA 2Q6CA 3WJ7A 2WABA 5IYZA 1YB1A 3DPUA 1YWXA 4UNQA 1Y1QA 3FRHA 2F48A 1IBRA 4JM1A 1CULB 1MU0A 1N32B 3A8TA 4EGJA 1FJXA 1BWRA 3F1KA 1PQUA 3BORA 4MVJG 5G41A 5HK9A 3AETB 1NK4A 2YHSA 3D5EA 1UETA 1ABEA 1ISJA 1ENYA 3IAXA 3IYLW 4JLVA 3GFFA 1CG6A 4DG5A 2O7RA 3N7AA 1YVPA 4IO9Q 1I0LA 1G1XA 3KQVA 1NHVA 1EK2A 4F3MA 4LFAF 4KGVB 3H3XA 2QP9X 2CFXA 1L4HA 2UUCJ 5C7YA 1WXDA 3K71B 1JLCA 2HXGA 4HWPA 4A6DA 2FVQA 4OQNA 4GI5A 1WELA 2C1ZA 4P4SA 4ZQIA 5LZ9A 2E5LB 3BRQA 2OO7A 5A8KA 1KK0A 3EEBA 3Q89A 3UJBA 3WRWA 3IEVA 3DOUA 5GMOA 1ML4A 3U5ZB 3PFCA 1KF0A 3PXAA 1GUDA 1RXIA 3DMGA 3NZEA 4IXTA 3IDZA 2VFSA 4OAPA 1GAOA 1DAIA 3BSCA 1H4TA 1YL7A 3WYGA 1SFRA 4QYIB 4XOUA 5GTDA 1P7CA 4Y0FA 1WG4A 3KUHA 3DO8A 4NYIR 4Z7NB 3AA9A 1KGDA 1XZFA 4M5IA 3QXGA 4EO9A 3E9YA 1SG9A 2D54A 4QM7A 1PWXA 3VNRA 4DMLA 1QWOA 4K7QA 1NYEA 5HCIA 2CG8A 3AX6A 3LOPA 1OA0A 1VQ6S 3S8MA 3RRHA 1J2YA 1CBUA 2P3LA 4MGEA 3ILYA 3ACDA 4N48A 1RRPA 5I42A 1IN0A 3QU2A 1OKKA 1XBTA 2I4NA 4DILA 3WSWA 1SIWA 5KTKA 4AN4A 1F20A 4CV0A 1X2BA 1S1TB 1H6KX 3VRHA 2B4RO 5C1DA 3DO6A 5L4NA 2WU4A 5DOVA 1TE2A 3N39C 2H48B 1FI4A 3K5NA 2HUPA 2IBMA 4BQFA 1JEJA 2XDQB 2HK3A 3PNQA 2YS7A 3LWZA 4N0EA 2GMJA 2RAQA 4HZUA 4DLEA 2V9PA 2YVQA 2OAQ1 2VLIA 4E11A 4OJTA 1Z2PX 3DFIA 4PSVA 3KAPA 5E4FA 2HHJA 2IP4A 1DARA 5FA5A 4QASA 1JIJA 4MIKA 4Q9AA 1MNAA 4P54A 2X8WA 3BDPA 4IF4A 3KTOA 4D41A 3OZVA 5CBPB 3SHWA 2R7XA 1F2TB 4R8LA 4KSYA 4O4HA 3JQFC 3EB9A 2M1XA 4NAHA 4N5IX 5G4LA 5T4FA 2C5LA 5LQJA 1XHJA 1W4LA 3QSYB 4AN0A 3LUPA 1M7BA 3Q12A 1XNQC 1N3LA 1HQEA 3KR1A 1VCMA 4C2UA 3ZQUA 1GGHA 1T2CA 3JSYA 2AFHA 1M5OC 1R3DA 1S48A 2N46A 1QRSA 4L2IB 5IX8A 1QO0D 4RC9A 2OBFA 2BBOA 1XE3A 3OXGA 4AM8A 6FD1A 4CQMB 1WTFA 2HMSA 1D8TA 1JHMA 5JBIA 3SOZA 2G9UA 2HWTA 3KJFA 2BZSA 5JROA 1Z4IA 1ZICA 4HPWA 1U28C 4ZHQB 1QGED 5FNVB 3QWAA 3DRSA 5LOVB 3OT5A 3AJ9A 1VBMA 2P5YA 1WW3A 4BTEA 1D5CA 2RI1A 5F8LA 1ODSA 3IAS1 4RZQA 4WBSA 1WHXA 3DMNA 1J1ZA 1YV9A 1USUA 2VQEB 1B1AA 2PMWA 4KSEB 2F3UA 4QFMA 5CDFE 4ZT2A 2XYPA 3JQAA 1P77A 4UXJA 2D5AA 4DOZA 3ZUGA 2P2BA 1XLUA 4PC2A 4DIEA 1JKMA 4LFCC 3RUBL 1U6KA 4A46A 5JJBA 5BSVA 3HZEA 2X1HA 3PFWO 1ZPVA 5IC6B 4WZ6A 1LC0A 4CH1A 1Z18A 4O4RA 4PWDA 4DSUA 2W01A 1R64A 4DIOA 3E22A 3S0JA 1CR1A 1GR0A 4U4AA 4GKBA 3QO9A 3ZTOA 4C08A 1VRUA 3OZXA 1U49A 1Q57A 3OJOA 1ZOIA 3GZNA 2OXIA 4CLOA 2WVEA 1ODCA 1Q0UA 1I13A 3IOBA 1YFKA 4DS3A 3DSRA 4NCGA 4BWVA 3D5TA 2DXFA 4IFVB 3ZHQA 4P0QB 4FINA 4O2BB 2ACMA 1WOPA 3CIMA 5IBRA 1C4AA 5CD9A 2ZG6A 2OFFA 4ERNA 1XTRA 2B6NA 3R77A 1UBMS 2JZCA 4RD0A 2VK4A 3PACA 4D9BA 2VP0A 3F4LA 1WC1A 4LDRA 2EYQA 3E9CA 1SXJE 1F9EA 3EHEA 3GCWA 2ECFA 3IERA 5JVDB 2YMPA 4QR0A 3R8XA 3B8HA 4BVHA 1UEVA 4R54A 2O1EA 4XLTA 4P5DA 3DBLA 4JK3A 4MUFA 2FSHA 1G3MA 4EO7A 1C1CA 3HBNA 4KQ9A 1RK8A 1P6TA 1ORHA 3N8DA 3PFEA 1VSVA 1N5TA 1RHRB 3CMES 4CMJA 2IOQA 4WIQA 1T2FA 2JIRA 1R3UA 1K5GA 2IOFK 3UHPA 2WWGA 3MM7A 3MMNA 1EZ4A 2L48A 1IQUA 1QS0B 5CVUA 4ZO9A 1R27A 3AZOA 3LWLA 4E32A 2O3TA 4XJSA 1CUAA 1QLJA 1G8PA 3EXG2 1NC1A 2OLJA 3FWZA 5HJXA 3EXIA 4MNTA 3WYNA 5KFNA 1EFPB 3H8SA 4CHGA 4HKQA 4R4JA 4Q45A 2CDRB 2VYQA 4Q66C 1WRBA 2EJCA 4ECTA 4AX8A 4XCVA 2FVXA 1A71A 3CW2C 2EP5A 3WGOA 4I2NA 3C14C 1OVMA 1MRSA 2CXTA 4R01A 4J1QA 3K5OA 1U1DA 4PPYA 1ZI8A 1SJQA 3V00A 4UZCA 2QXTA 1C8BA 3BB5A 3FK4A 2CUNA 3AUTA 4IJUA 5JNRA 3PV0A 2J9RA 2C92A 5T64A 1KLNA 3LSYA 2CIMA 3AK4A 4C7MA 5C51B 3TJ9A 3CJRA 2OBBA 4PPDA 3M1VA 3UDCA 4I1SA 1ZOLA 3FYUB 2XMQA 1UPFA 4UQGA 3Q3IA 1WABA 3T1OA 4MWGA 3D6MA 1PIWA 4FGSA 2IY7A 2AR0A 3AR8A 1DPGA 4U0KA 2D5BA 1AK2A 3E9QA 4HDSA 2XXJA 4IDOA 4WXRA 2BKLA 2GVNA 2HRYA 3DF9A 4EAQA 1YRUA 3IVXA 4J1TA 3SD7A 3QJ5A 1SJFA 4K40A 3EMTA 5E6RB 1XELA 5JD3A 4WFZA 5IZHA 5UKDA 1E1CB 3FYUC 3NWEA 1GL3A 4O0NA 2FEOA 3V9AA 3KYBA 4YUZA 5AM4A 3BEGB 1X7GA 4ZQGA 3TLEA 5DGHA 5JJLA 4I2QA 1EI9A 5AI8A 1XZMA 4TV8B 4Q44A 1JHRA 2AEEA 3I01M 1LPOA 5B1EA 2RS2A 3AJ2A 4FI3C 4ESEA 1IXKA 4ZIRA 2XE6A 1YQXA 3WE7A 3L92A 2VBWA 5DE3A 4PSUA 5LMCA 2OMEA 2DCLA 2BEVB 4DE5A 4QTUB 4O8CA 4OX9B 2D2EA 4G5GA 5ETNA 1M2JA 1U0GA 3AQPA 2XJ4A 4DLVA 2GH1A 2DE0X 1FWPA 1KA9H 5KI6A 3VR6H 1GV0A 4OFWA 5GADI 2O2CA 4H08A 2C9CA 2GSDA 2MKKA 4IQGA 1DDOA 4D5GA 5LL6P 4MB6A 1PGPA 2HDWA 3FYSA 1G4CA 3M2RB 1O2DA 2GIFA 3Q87B 4IMIB 4W5QA 4PRKA 3H5RA 1D09B 4LJ4A 1C14A 1GPKA 1KI8A 3MR3A 1ORRA 5LQMA 1CRZA 3K0SA 2KH9A 3BXZA 4CCYA 1GG5A 4F1JA 4ZJQA 4L28A 1TECE 3E3NA 2Z30B 4LPKA 5JAMA 2Z9CA 4UOGA 4WJKB 2CPZA 4V39A 4H4KC 3FROA 3KLEB 5LQUA 3R5CA 7MDHA 2R11A 3H5WA 5TARA 1VQYA 1TJNA 5EWEA 2R65A 3VZIA 3GGCA 1RYYA 2P65A 1PK7A 2KL8A 1TUBB 4ECYA 5ESXA 2KRRA 3C4QA 1ISFA 3I0NA 1GZ3A 1CY2A 3L0IB 1SD1A 3IV6A 3FTNA 3PHTA 1D2NA 3RD5A 2CXHA 1TMGE 3TSWA 4ROTA 3TJRA 1RAAB 3QVTA 5LMUJ 4BU0A 3R5JA 3THRA 4LNUB 1WCIB 721PA 5CJ2A 4E70A 1T05B 1NASA 4PIVA 1Z0FA 2XDQA 5AM3A 4U3JA 1GFZA 2WNHA 3NBYC 1RBYA 5JZ9A 3UUWA 1KKHA 5IV4A 3TSOA 1EKRA 1NUQA 3W8EA 1EE1A 3O03A 2MMAB 4P2XA 4OYOA 1RNLA 2J3JA 2QLXA 5JXIA 3GJRA 2WSYB 1NPDA 4FKZA 2R2GA 4IDAA 1CLUA 3NR2A 3A2KA 1Y8ZA 1T1EA 3VZBA 2XSJA 5H3HA 1N6RA 2DXDA 1YZYA 1JI3A 1YBUA 2XWPA 3TCXB 4Q4AA 1VZ3A 1M10A 2CF6A 4EELA 2P2YA 1UZUA 2QB5A 3PUJA 2P02A 1BCRA 3U17A 4DR6F 2GDZA 1FFWB 4P7KA 3ZWAA 2WONA 3C4VA 5L95A 3HHLD 2GK7A 4C4AA 1QLHA 4WERA 4J3FA 3SQXA 2CFRA 3H9UA 2ZH9A 2QLBB 3KE8A 3HYSA 1MVLA 1FHTA 2GZ2A 3KJVA 3I1YA 5KTPA 3EUNA 1KSFX 2IBKA 4M5JA 5KTQA 1Y4AE 4D4IA 4ZI7B 2HWHA 4L16A 2XYGB 3FAZA 4JA0A 4EGSA 2HHXA 2KU7A 1SKSA 4UTVA 4V0RA 2DQZA 5D1HA 4KV8A 2B1IA 3CEMA 2YV1A 1RAAA 3S1TA 2CNKB 1T1GA 1KYXA 5FBLB 4RX6A 3CCCA 1FJGF 4EHJA 1RJDA 3AHGA 1T25A 3D3WA 3SFGA 1SVOA 2B2XA 4DR5B 2FZCA 3EFOA 4M9ZA 4Y6GB 3DZHA 3KJEA 5BMVA 1U7WA 4AMVA 1HE4A 4NPOA 3ET5A 2EBGA 1W1UA 3W5ZA 2Y1FA 1DHRA 1WEYA 4EB6A 3CSSA 3ZHSA 3GRZA 2MTLA 1ZEJA 1GQSA 5HI7A 3NANA 3R5GA 3T6KA 2ACVA 3PRYA 1QVFR 1W4AA 4GZMA 4HGPA 4IVRA 2H4HA 5DISB 1N36F 4D9JA 1HBMA 2XODA 2IM2A 4JV5J 3BS9A 2FPLA 4YR7A 3PF9A 2CWDA 3L0CA 1XVUA 2HRTA 3W60A 1CTQA 4CODB 2VDKB 1ORTA 4EYGA 2ZZTA 2VJOA 4DV6B 2XUGA 5ULLA 5D1NA 4BWGA 4DJBA 1GLGA 2AOTA 1PBNA 3QGGA 2KKHA 4PRLA 1XMOC 1JTFA 2XZDB 1QTQA 4MUBA 4RETA 3ABRB 2QQ0A 4HXEB 3CWQA 5CBKA 3USCS 1NI4B 1KK1A 3ZH9B 5K7SA 2J0VA 1CQJB 3CJKB 4RX1A 1RDFA 2V5UA 1I2DA 1HDZA 1MXCA 3MOSA 3AOCA 1E6YB 4W1QA 3VSBA 4X1KB 4WW0A 2VPTA 4MVWA 1TUVA 1SO8A 1JLFB 2Z1NA 4EG0A 3ABIA 1IBKF 2QD4A 2P3QA 3Q7TA 4HRAA 2IEDA 1GPMA 2HPHA 2IYSA 3IBTA 3LIIA 2GOYA 2EGHA 3FFAA 1P80A 5C4MA 1PDWA 1Q3KA 3V1MA 3RAFC 1TEHA 1Z12A 4QW9A 1NF3A 1XL1A 3ISND 4NFSA 3QBEA 1WUIS 2CQHA 3R5JB 3L0OA 4TTJA 1VRCA 2Q0HA 4Q82A 4QWBA 5D7NA 1W73A 3AM4A 3RIYA 3T7JA 2VG5B 4AK9A 4D9KA 2YV2A 1UVNA 4DV3J 4ZYUA 5B4UA 4DQIA 5KHLB 2ODQA 1NV8A 2F4VJ 3GPCA 1JYFA 5E1DA 1KBQA 2C7RA 1VHTA 4XUEA 1P0PA 4E13A 1NRIA 1HBUA 1TQ2A 2I5JB 1ADBA 1W2WB 2FUG9 1KYYA 4Y2YA 1RLOA 1D0VA 4Z8YA 1M6WA 2VDQB 5B0EA 2Z56A 2D1TA 4F3RA 1W0JD 3DE2X 4KWCA 1KZGB 1PGQA 4FSDA 1HNWF 4ARIA 3AEUB 1REVA 1A5SB 4IO0A 4E4RA 5JUWA 1J09A 2JW5A 3WTBA 2Y1LB 3QIDA 4UUMA 3O7MA 2HSDA 4UCWA 1RZ3A 3F7OA 2ORED 1MWYA 4UCXA 3GPIA 1FXRA 3V2UA 2IDLA 3A1YG 2WWIA 4P71A 4KQ1A 1QRRA 2UKDA 1XMQF 4Y9DA 2RSQA 5GJCA 4ZP7A 4ND3A 1Z5PA 1JLAB 2A78A 3C3MA 3JX9A 2O1SA 1NPKA 1ZOOA 1Z83A 2AX3A 1XERA 4XQ9A 3DEIA 4Q7EA 2HLTA 3L0SA 2PYZA 4YPOA 4LMAA 1HQEB 1VLQA 1TU0A 3OZSA 1HQ2A 1T9GS 1I8TA 3HEAA 2BEVA 1RBZA 1XR5A 1KEEB 5DH9A 4XCXA 4XR9A 5K01A 4XA8A 2E1MC 3NTVA 3N2KA 3GFZA 1Y4UA 3G9XA 2E5LC 4WECA 5L3RA 1A77A 4WQMA 3JAKA 4HHHA 2Z58A 1F2TA 3KSBC 5IJ9A 3EAGA 4XXHA 1RE1A 4AJ1A 2ZYAA 3VOTA 1C80A 2AZDA 2LA6A 3QGMA 4B3OB 2C82A 3ZKWA 4MR7B 2BFPA 5KFHA 2PEYA 3PUXA 4YHHF 4EENA 4OA5A 1BQMA 5KWJA 2LMIA 4LRAA 4V0LA 2ZHOA 3HKWA 3WS7A 5J2UF 4ED4A 4F5WA 2MXYA 2BW7A 2WDPA 2OCLA 3I4PA 1VIVA 1BE8A 4QOSA 1D2GA 3FOAA 1PL8A 1I5OB 4IYRA 5A7FA 5ALUA 4EYQA 4ZWNA 3M5PA 2Q0QA 5C1PA 4JSRA 2WHYA 4J9MA 5D78A 3EIQA 3HKBA 4A1OA 4RF2A 3I0RB 3MQ4A 3ZWOA 2P2DA 2YVKA 2J8SA 1DWUA 3CWZA 3MFQA 5F2NA 3DLGA 4F26A 3OQOA 5BYKA 4AJ4A 3OFFA 1DZ3A 1Q79A 3LGSA 1PJRA 1JPNA 2FC9A 2JIPA 5HG0A 3KHHA 2VQFF 4CIVA 4WY8A 4DR6B 3AINA 1KZHA 3R2DJ 1QH1B 2D4AA 2AE1A 2HGSA 4DV0B 1U1NA 3OSZA 5DLGA 3QE2A 2RE8A 3WKBA 2ZKLA 4IMJB 2RHTA 5HO4A 4RGQA 3LNTA 1HLPA 4NJEA 4GRSA 3RE1A 4Q21A 3KUEA 3OL6A 3RB6A 1UXGA 2YHAA 2G9QA 4P58A 1LLDA 3UICA 4LHXA 3LVRE 4G8CA 5BN5A 2FRDA 3SF8B 3QKUA 2EBEA 3QJYA 4ZZ2A 3CQ2A 3WGQA 4LYGA 3IUYA 2MSDB 1FTRA 1B74A 5IM0B 4CL2A 2B43A 1EVYA 1JJ7A 1N0IA 5GPBA 3EH2A 3KLHB 1K6EA 3DW3X 2FQWA 4HFMA 4GKJC 3A8KA 2IYQA 2B25A 2D74B 3QLUA 2JJ4D 1P31A 1RU1A 2X0EA 1V5WA 1Q11A 3W3ZB 2QR2A 1SAYA 3UUGA 1YITS 1YT5A 3PGMA 4CO1A 2BGJA 2OHHA 2OE2A 3VR5H 3TMKA 1BDMA 2WG0A 3AHEA 4FM9A 1OBOA 2FZ5A 2V96A 2PNJA 1Q82T 2CNWA 1WF0A 5FTJA 2COUA 1T8WA 2GS8A 1LPAB 3BMNB 4LJ9A 1ZHOA 3QBCA 1SBHA 3N6NA 4F4UA 1OE0A 3DZ8A 4DCTA 5D15A 4RA6B 2WRZA 1JI0A 3H5IA 4DHEA 5K0LA 4MI9A 2JD0A 4YFVA 4ZI7A 1NI3A 2P6MA 1MJ5A 4RWEA 3BCSA 4D26A 2II6A 3NEAA 5EJ7A 3DV0B 2FVYA 1V5IB 3MZIA 5BWLA 4WX2B 3TZXA 3V4MA 1QE1A 2WMNB 4L73A 4UTZA 3WGHA 4XDCA 5A62A 1UJ2A 4FOPA 2GJSA 4PCAA 2CVOA 4KTVE 2D3WA 3C41J 3C7DB 4H7DA 4D1YA 1RC0A 2P4QA 5B0DA 5IJZA 4GT1A 2ZD1A 4RQBA 4M89A 5JS6A 3N54B 4M5HA 3TB6A 3C3DA 4I46A 3OOYA 3O9ZA 1YDHA 1GY8A 5EGSA 4PUIA 1QVRA 5BORA 3E8OA 3DH0A 1N8KA 4B3TB 3D31A 4MH4A 1Z4MA 4LG1A 2W8BA 4BNNA 3OC6A 1TFWA 2ZVSA 3A8EA 4C0LA 3N9UC 2OZVA 1KEWA 1CR4A 3WV4A 2H65B 1P72A 4J9UE 2YHUA 4G86A 3UF0A 3FBWA 5EE9A 2AA3A 1W0KA 4D82A 1ZBTA 1OXKB 4LF4F 5B7PA 2LBPA 1DJLA 2OO4A 2QRNA 5T4HA 3F3SA 2NVBA 3MPWA 2JARA 1Z8HA 2CNLA 4IOKA 4BNWA 3QNWA 3ZLJA 5LLSA 3W8FA 3GB0A 1H69A 1UFOA 2BCGY 3HLTA 1NN1A 5HMZA 3FMBA 3TP2A 4N0MA 2VPYB 5KIAA 2B7LA 3SYRA 2HA4A 2O59A 3LW7A 4UHEA 3PGXA 1V4NA 2QENA 4AT1B 4FF1A 4C3ZA 4Z8XA 3W3AH 4NXMF 5AYVA 1G2OA 4MGHA 4Z54A 3DV9A 4M5MA 5EERA 4UULA 5KREA 3ZU5A 5CFMA 2IK8A 3WB0A 3C14A 3KLEA 2O07A 4MUNA 1UKVY 3TSAA 3QUCA 3MXTA 4KDFA 3PU6A 3GGPA 3VPSA 2I6QA 3ICQB 4JI6C 4R5PB 5A2QA 3FTDA 3P45A 2QBYA 1IBMF 1OF1A 5BSKA 3HKCA 1U0NA 4DCOB 2GWRA 5KJ1A 3PDNA 1WKKA 4AI6A 5GZ3A 1PTJA 5BSGA 5FADA 2V0CA 1TA0A 4HDMB 1VLJA 1QDUA 3U7EB 4FYWB 3EXAA 5FJ4A 1KU0A 2HHVA 1I51B 1RS0A 5ETRA 3ZV6A 4CG0A 3SKXA 1E0SA 4REQA 3GIWA 2E4AA 3DXYA 5JNLA 3PTZA 2ICAA 1GKKA 5EHHA 4Q3AA 1EEXB 3VNUA 4TRJA 3HCAA 3EF3A 5J5VA 1JT9A 2OEKA 1A27A 2PMKA 3MWEA 2YXNA 1SBZA 2D4HA 4ZC8A 4M95A 4Q1BA 5NLLA 5EHIA 1URNA 1P4SA 4GDFA 2B9XA 4GKKJ 5G1NA 5J2TF 4TV8A 1Z1ZA 3QPIA 2KFNA 3DDNA 3MMPA 4EL5A 2GGPA 4GX1A 4P08A 5KYGA 2XF8A 1TD1A 4NOZA 4Y6RA 1FVFA 1DHMA 2XGPA 4TMXA 3HDSA 3L7JA 3M30B 1NQOA 1QX4A 2G1PA 1L5ZA 1ZJZA 2GZ3A 3PJWA 3Q88A 5DF1A 2DBYA 1LCIA 3VAFA 1JHYA 5JWHA 1CQJA 2R25B 4C07A 3ZH2A 2FJPA 2VQ3A 1GZVA 4EUSA 3A1NA 2QTWA 1PT5A 4ZVOB 4HAOA 3NGUA 1OX4A 2I7TA 5DXAA 2NV0A 1KJIA 4I67A 4JLMA 1POXA 4FWTA 4RLSA 5KYVA 3GJ4A 3E4CA 2UU9J 2NM0A 4HS9A 4JNKA 4HDMA 1YRXA 3E0XA 3GWZA 5EMMA 3U1LA 4DX8H 3LGHA 2VF8A 1F48A 4KHZA 1IEWA 2G40A 3IH5A 3KPJA 1GFSA 1L7VC 2D27A 2XUHA 2IC5A 3I42A 3CC8A 3C7TA 3U09A 2VJCA 3R8YA 4M21A 2C3YA 4GPAA 1EARA 3QX9A 2OCKA 1S77D 4RZUA 2VNIA 3RDPA 5KFYA 1C7FA 3O90A 1RZMA 3OJSA 2NNWB 1YB2A 4G0OA 2DQSA 3RHZA 4FF4A 3IO1A 4BAZA 2X6TA 4LSGA 3HRKA 4A27A 3R5FA 4GRIA 4PY2A 3M9LA 2QUAA 4MQFA 3H9EO 4MI1A 3VR6A 4XIGS 2KZ0A 1VOTA 3RRGA 4LPSA 4XTTA 4BDSA 2IXTA 3KLHA 2MKHA 1HNNA 2EU8A 2AHOB 4QXRA 4UXHA 4LYYA 1P44A 5AW1A 3WISA 2NS1B 3WLFA 3WL7A 5F3ZA 4KODA 4XQGA 1INLA 1RCUA 4LOHA 4BMPB 2PLRA 3IUEA 1HNIB 2CF5A 5TEVA 3B7GA 1FDOA 4WTYA 3K7RA 5EEGA 1O6GA 1C41A 3OQPA 3JD1A 4AG3A 2Z8QA 5A1TA 5K5EA 3REQA 3LF0A 1IK6A 1BN7A 5L6MB 3KK2A 1NNSA 1PV4A 1FX2A 3ILLA 1YJTA 5EXXA 1RTZA 4LF6F 4PAMA 1HPLA 2DR6A 2J7PD 3STUA 2NO7A 4RBNA 1EKSA 1P1RA 1R43A 3DNMA 1KR5A 4B9AA 3N5CA 3HSSA 1YJCA 1JFFB 2AMJA 2C58A 3P2YA 3H5TA 4CTNA 2BH2A 2QN3A 3PRVA 1YR9A 2D1CA 3MGAA 1FX0B 2ZVQX 2ZDHA 2XYRA 1YUNA 4B4WA 2WKRA 2JEOA 4DSEA 2ZE2B 3LS2A 3L6OO 2JH3A 3OCWA 4KAIA 5CCBA 4MLCA 1KD1T 2AQHA 1VRUB 2ZUFA 5DVZA 3ZNOA 2A5LA 3ESYA 3E1KA 4RW8B 2R7TA 2WE7A 4M0EA 1OFTA 4FLMA 4ZVQB 5EZYB 1YRLA 5DV9A 2P2MA 2G28A 3BMNA 3ZWVA 3UB2A 4ECXA 1OQAA 4N9QA 4N65A 1K3TA 5HOEA 1JWLA 5DDRC 1MMLA 3TZEA 4FW8A 1OXSC 3CO0P 3I4FA 4WADA 4QOJA 5BV0A 4J0JA 2QL5A 4JZYA 2C97A 3AGPA 3DV2A 3C1TA 2XB2D 1HC7A 1RKJA 1DFGA 3LVBA 4BFUA 4KZPA 2KHZA 4DV4C 3THPA 1DNPA 4EF5A 1K4YA 4FGKA 1ZSYA 4M88A 2R7RA 1X19A 3ORHA 4OLPA 2VBGA 5K8MA 2IUTA 1IM5A 2VHTA 4DIBA 1I3KA 2IWHA 3DCAA 1EA7A 1R8CA 4BGEA 4ZEVA 1T6BY 2VQEF 3M2VB 4I8XA 4JUAA 5EJAA 4UD6A 1N5QA 3MLAA 3UN2A 4P2MA 4WH0A 4ENQA 3TQTA 1ACJA 3R5HA 4AZ3B 2PIIA 3NTXA 3RR7A 4IH4A 4BBZA 4OQZA 1ZM9A 2QRVA 4UUPA 3JALA 3WGVA 5JBQA 3F5DA 4NG5A 1VK8A 3CLKA 4QJIA 3L0PA 4OYZA 3RVJA 3LX4A 2VT2A 1UWKA 3DU5A 1E3WB 1E6KA 3RJMA 4DV1F 2XTNA 4NLWA 1VMAA 3RSCA 3LT1A 2JASA 3ZG6A 3CO9A 4C3MA 4QFDA 1GU7A 1VSTA 3FKSA 2NSBA 3U9SA 2Q1UA 1QWIA 4TUYF 1JQBA 4TWBA 4ZGGA 4JVNA 4KGDA 2Q6VA 3NOCA 1HLWA 2HR1A 4DR1J 5TSDA 1V41E 2YV4A 1U0TA 3QP9A 2OV6A 3FZEA 2ZH6A 4TL9A 1HBJA 2CXEA 4DV7F 4JU8A 4CWAA 3PX2A 3R3YA 3FQKA 1QLWA 4JUIA 3LL4A 3PSHA 2DCMA 3MFIA 2HY7A 1FNMA 3DRXA 2FN3A 4NRTA 1KMHA 4URQU 5GVSA 2PKEA 4D98A 2CG4A 4XPCA 1F38A 4GU5A 2R8BA 3EWIA 4KWEA 5G1PA 4CMAA 5ALOA 3GOQA 1UIMA 3DMTA 4BNXA 4RPIA 4ZT3A 4QJBA 3QYFA 3BD7A 3PUYA 1VS3A 5H4GA 1SHTX 3R7NB 3HB4X 5FULA 2BMFA 1GAEO 4B82A 4RYDA 4Y3CA 4YTEA 3ESCA 2XE7A 1OXUA 2JEZA 2ZQ5A 3MM4A 2JAUA 4B3IA 1M2NA 2G5CA 2EC0A 4A3SA 6Q21A 4EZBA 3LFTA 2CUYA 2ZQZA 1GU0A 2MHNA 1FXLA 3ULHA 2W90A 1DQAA 1MHPA 4AIRA 4OOFA 4MR9B 3L8EA 4F6CA 2GM5A 4NBUA 4UHHA 1NLMA 4RS4A 2QZZA 3T7SA 2ZPAA 4R1MA 2VB6A 3RW9A 1XX6A 2X2FA 1EZZB 1X9GA 1NTOA 1EXNA 2EL7A 5IWCA 1JXEA 3MA0A 1RQ0A 1H4VB 2G4VA 2DMRA 1U7DA 3VFDA 4XEHA 5JCOC 3RPEA 3SEAA 2WFMA 1X0PA 3BSWA 2O57A 3IJPA 2CXSA 5JI3E 4EY3A 1EX9A 3AR2A 1X9WA 4PQFA 5ECWA 3IRXA 4BNIA 2VP4A 1TT5B 1S2OA 4J5OA 4S04A 4ENUA 1N2FA 3BK1A 4XJVA 4MCHA 2D2XA 3A1CA 4JLOA 5DI9A 4OJKA 3SCLE 3H9GA 2DTDA 2OYCA 5JJCA 1RM5A 9ATCA 1M1YA 2V55B 1VPTA 2IKQA 5E2QA 3PWSA 2DC1A 1PFKA 2FFHA 3W1VA 4HVTA 3PX7A 1J24A 4RPKA 3W63A 4XUGB 2AN4A 4WFQA 4DANA 2X0NA 3FDXA 1ZPDA 1BQ4A 5KAMA 1GZUA 4OFXA 3PXGa 2R8GA 2GLXA 3ZWCA 1U3VA 1G18A 1GPDG 1KC8T 1SXGA 2BUNA 4KXXA 4A36A 3MTEA 1OPRA 2J3MA 5BR1A 3E58A 3JQDA 4IXMA 2M70A 4BQNA 2BWJA 4HAZA 3QZUA 1R0CB 1C0LA 1RT4A 2ASLA 2FJEB 4RE6A 3ET4A 4J0CA 4E5UA 3NTOA 4HX9A 3A3NB 4UUXA 2RDIA 3GGGA 5LB2A 1GGKA 3KSZO 1RTDB 4NU6A 2ZBQA 1EU1A 1YVUA 3T1YC 5DNAA 5CB4B 4D46A 1W36C 4DBZA 2R1VA 5HIAA 1S97A 3ZU4A 3CH6A 3KX2A 4QDKA 2BJ9A 2VQSA 1JTVA 2E0GA 4PQUB 1O54A 1O94A 1ZMBA 1RQ7A 5EINA 1EHIA 4HVZA 3IOMA 5JU6A 2RJNA 3GEBA 5FTMA 4R1LA 1D9XA 3SJUA 1IHPA 1JIXA 1FIUA 4NYMQ 3KCNA 5U1PA 3KKQA 3FPJA 2GFIA 2MU1A 2MQQA 3P9CA 4A2WA 4L76A 5JZBA 3D6TB 1NFQA 2H51A 3UMSA 2QW1A 4PW0A 3CU5A 1P3Y1 5DM60 4GKKC 4IGFA 4Q03A 1PT8A 4N1AA 2A5GA 3OE7A 4R0JA 2BANB 1IL0A 2P5UA 3PEJA 1F0XA 5FTLA 1UAAA 4KHPF 3U44B 1M6VA 4OTZA 2PI5A 3CX3A 5FLXD 1SUFA 1LS6A 3PRDA 2COKA 1RMTA 3H5XA 2LQ5A 5LT5A 1XYVA 4X8LA 4HB3A 3MOGA 2LXUA 2CNNB 2H5EA 4YY3B 1RWNB 5JZSA 4J0GA 2G4LA 2DTEA 4JYAJ 1RADB 3OTHA 4BVLA 1AZTA 3QJGA 1MO6A 3JTNA 2Q7XA 1Q78A 2RVJA 3KOMA 1KVQA 1MROB 3LT5A 3JYQA 4N03A 3UX2A 4F7WA 2W6OA 1JLAA 1WSAA 4PHFA 4IJ5A 2PVCA 2FLKA 5CG2A 2CJQA 3VI4B 5TE9A 1IUOA 4K87A 2HTFA 3V1UA 4ZOCA 3TTYA 5IABA 1VQSA 3QVXA 4P7JA 2AOUA 3I8XA 2Y0EA 1LDMA 3TARA 3VO8A 2FMUA 1ZQ1A 1B7FA 3GG2A 2VHZA 2FDXA 4X92A 2JFYA 3EYAA 1Q21A 5FNZA 1BW9A 3MMBB 4N7JA 4KY3A 3I5YA 1MG7A 1TYAE 1KI4A 4AY3A 2QAIA 4MQEB 3A10A 2BEFA 3O6VA 1XPRA 1QIMA 2GVZB 3RVKA 1KJQA 3V4RA 1FQWA 5CA1B 2CQDA 4PNEA 4AT1A 3R6LB 4KAXA 5AKXA 1X1RA 1I7QB 3TH5A 2VQDA 5JVDF 1WV1A 3HYNA 1FZQA 4L0MA 4G01B 3AQIA 4MS4B 2QTZA 4OBBA 1ZYUA 1XJ0A 3WGMA 1A9XB 1Y6RA 4C4SA 2VC1A 4LDJA 1R7IA 3NYRA 3EK2A 1MJGA 5AESA 1G5IA 1BJKA 2FJDB 2H11A 4LE2A 2QG4A 4HEA9 3CVKA 1KEKA 3R3SA 1B93A 4QJ3A 3CTPA 1Y37A 1TP7A 3LKZA 4FF3A 3M30A 2PA8D 4WZMA 3AWDA 1DC4A 3BRSA 2ZITA 2AKWB 5EWJB 3HR4A 1XDZA 1YVDA 3VJRA 1Q91A 4X45A 3I09A 1GQFA 3CCLS 3IKLA 1NBHA 3ELDA 4ZVUA 2KBEA 2DHAA 3DLKB 1AUQA 1SB8A 4JI2F 3W06A 1MJFA 5IK2D 1K1QA 2NT3A 5E6UA 5AO9A 4CLHA 3H2IA 1KMMA 3PJ9A 3EIUA 1EM6A 3HO6A 4FZJA 1AQYA 1EVIA 1CNMA 2C61A 4QYZJ 3OZWA 2QI9F 2Q66A 5IP5A 2OHDA 3DL2A 4JI5F 3LHSA 4A16A 1U3FA 4UZEA 3C5EA 3OPYA 4RCYA 1VG0B 2QTHA 4YAGA 5A5FA 1RACA 2YVLA 2JGNA 4J90A 1CR6A 4WTOA 3VSAA 3ZXUB 3CH5A 1KU6A 1M72A 1FDBA 1JJFA 1FLDA 3AB4B 2HBQA 3EDRA 4PGHA 3WGUA 3HU3A 2JGDA 1HLGA 1Z5NA 4R31A 3RIXA 1PAEX 4V0MA 2Z30A 2X8BA 1WAMA 2RIJA 3S55A 4C6AA 1TC2A 2J6IA 2FMIA 4ISCA 5DIZA 1YRTA 1OV4A 4QEDA 5KVQA 1T11A 1ULAA 3EVOA 1HTTA 2WQZA 4XLLA 2H54A 2P35A 3GJTB 2R5NA 3SC2B 2E8FA 3PNLA 4ZCRA 4NKRA 1YE5A 1LRJA 1LBEA 5ED0A 2COLA 4RL4A 3RLFA 4ZKEA 2VICA 4O2LA 4F11A 4JYAB 5AK6A 3JQ6A 1JBQA 3PI7A 5CD4H 3FSIA 3RU3A 4MP6A 2RQKA 4EVSA 1PBTA 4GX2A 3TM4A 2Q29A 4YV1A 3RR2A 3QT6A 1DFDA 2BFOA 5K9ZA 3DM2A 2I5PO 4EHAA 4K59A 1P4HA 2F7SA 3K20A 5CDYA 4ZTZB 4YQFA 1G1MA 1ZOTA 2BVNA 1Q3HA 4C9DA 1M1YB 2IYLD 5BPFA 4IMRA 2O3SA 3NEKA 2MZRA 3H9CA 1F60A 2WWYA 3JD2A 1NURA 2VFAA 1NVEA 4PQYA 1VKJA 1JZSA 3CLUC 4KO1S 4YR9A 1DBPA 3CTMA 3DNPA 3RBDA 2ZR0A 2M9KA 2IU4A 1J2TA 3HXOA 1JDNA 1A8PA 1ESNA 1ADFA 3F6BX 3IBWA 4HPXB 1NJ6A 2XZPA 3GJSB 3MPUB 4HRVA 1ZDMA 5FR2A 2GN1A 5E6UB 3VPHA 3HL0A 1NB2A 2PWYA 3NOGA 2PM8A 2CQ3A 4JQZA 2ZAYA 2AP6A 3W62A 2EKQA 3IWNC 3K8QA 2ZETA 3BIWA 2WWVD 4UBLA 3M3PA 2C28A 1G41A 1A3CA 2JHGA 3O95A 2VDJA 4D9HA 3IUJA 4M22A 4DFMA 4HAYA 2C07A 2HN9A 4FXPA 2EFVA 5DN6D 5F3WB 2WVAA 1KLMA 1K7FB 2RB5A 5DSXA 5EE5B 3OTWA 4CLOB 1E3EA 5GADl 1JDBC 2HRCA 3UDLA 1OWMA 4GL4A 1GCGA 1FKAF 1CQZA 1YMVA 3A0RB 2BVZA 4XWOA 3E22B 1WZCA 1SU7A 1FRJA 1FP6A 3SK0A 4BLTA 1RTDA 4WLUA 3R9KA 2WHPA 5JI2E 3EXEB 2OP0A 3PJRA 1T9CA 2ZNZA 1L3VA 3JS9A 3UMGA 3EUAA 3KR9A 1G66A 4O3NA 4MEJA 3T3FA 2HGZA 3ZW8A 2NLOA 3EYWA 1DQZA 2QQGA 4MFBB 1R89A 3CNOA 3DGPA 2XMTA 3CXUA 2EFYA 4WDRA 1DBVO 7GPBA 2R7QA 3F5FA 1G6OA 1QHYA 1RHMB 5I9MA 4AG5A 2R7UA 4LVNP 1CVIA 2JFPA 2AZ3A 3K0EA 3GLJA 3A4MA 3AP2A 3NM4A 3ENVA 1X38A 2DR8A 3TI7A 3IMCA 1X80B 2MKSA 4ANCA 4DUPA 4YUWA 3WWYA 3OD5A 2FSVC 3WICA 3H4IA 5BQPA 3MCMA 5CYMB 3AW8A 3S8SA 1EJ0A 3E5NA 2XS7A 4X3OA 3TTSA 1RHUA 4CMGA 3A3YA 4XX1A 5IC5A 4LY6A 3RTAA 5BSHA 3EBPA 1TMKA 1Y8RB 1B8VA 2XF2A 1AFIA 4K4ZA 3LC1O 1B2RA 2PHZA 2H5JB 3BGOS 1DURA 4TNOA 1EGHA 4OOEA 4IJMA 4LE0A 5E9WA 3ZIUA 2DKOB 3ZZ0A 2Z09A 2NTYC 1F8YA 2VKZG 3FFWA 5LNK1 1LF0A 4MB0A 3ENWA 4H4EA 1E5DA 3BA6A 4LFBC 3A70A 3HDJA 3GV8B 4PF1A 5LP6F 3KSUA 5J40A 3PHEA 5AKZA 2UXDC 1SHKA 3B2QA 5LIPA 1XXHE 4NYJR 1Q74A 9ABPA 1Z29A 3L1HA 4EFLA 2RK3A 1KORA 1S4EA 2PD3A 5MHTA 1A98A 3HR7A 5L1LA 4L4YA 3VU3A 2QEXS 4U8GA 3AM1A 3WJ1A 4MV4A 2Z5VA 1OYDA 4ER0A 2PRZA 3MYRA 3K09C 2TMDA 4MIEA 2Z57A 2WDZA 4GO5X 1W52X 3AA8A 4JP1A 1ILWA 4RMJA 1GMWA 1EGAA 4LYDA 5IC6A 1BQMB 2BRKA 3T38A 3QELA 1M2FA 1GEHA 2UAGA 3K2YA 4UBOA 3THXB 4IQ4A 1W75A 2CHFA 1CNEA 2QP4A 1U7OA 2HNKA 1K2VN 3SFZA 1DEHA 3K59A 4BBJA 4E08A 4LYEA 3FC9A 3KLGB 4WZBE 1CUXA 4YJ2A 1D2CA 4XDHA 1EETB 4JKIA 2KXFA 5F0UA 3AD9C 1FNXH 1WXIA 4ERXA 3CDBA 3G96A 1RXCA 5B57C 1O57A 2J09A 1U09A 4CMBA 4IH5A 3WB1A 5LOVA 3C43A 2SBTA 4ZP9A 1WF1A 4MAFA 3KT6A 3CJ0A 5EWFA 2OWDA 3ITKA 4U0JA 4WINA 3SSQA 3GQVA 3RYTC 1NOKA 4UHFA 1ZIDA 4BZZA 4BV8A 2QTCA 3F4BA 5AKYA 4GPIB 2G6TA 4GOOD 2PFKA 3WMGA 1EB8A 5LKAA 1FX4A 4DARA 1O6CA 3GUUA 3UOWA 3FPHA 4ECQA 3HX9A 4PSDA 4E5SA 1QIFA 3U2QA 3OF2A 4ON9A 3TAUA 4QYZK 1ORVA 2TYSB 1WHYA 1D6SA 2A67A 2GBCA 5ICCA 4C4ZA 4ECAA 3T95A 4ES3A 3T1AA 1PQWA 1NCLA 1F3VA 3UVJB 2UVQA 3MEKA 3OQHA 1E99A 3V6JA 5EUCA 4BQRA 2IXEA 5L9XA 4HH1A 1SBYA 2WAAA 1XKQA 2ZBVA 5E4TA 1RQNA 1USPB 1KH2A 3G85A 1J5EB 2B51A 1A72A 4I8DA 2NIPA 2IQ5A 2RKBA 1ODJA 3TGLA 2A86A 7ABPA 2DGUA 2WHXA 3N8HA 4BRUA 3MNFA 4V2UA 3CO5A 4IVNA 3GFTA 3TOQA 4BNZA 4DSZA 4JNCA 5EKSA 2IW1A 4Z3DA 5P21A 1B7YB 5A2QU 2WSCC 4JKOA 2I2BA 4BECA 2FUKA 2G04A 3B1ZA 5EHZA 3BSFA 1M66A 1FS5A 2EG1A 2JIOA 4R83A 1LOUA 3EG9A 3KTAB 1AN0A 4KR0B 1BHNA 4JR0A 2WAOA 1UAWA 1Z4QA 5FA8A 4ENOA 2O2SA 2P9TA 3W8DA 5AI9A 4DLPA 4BFSA 2HVDA 2A2ZA 4EYKA 1FVHA 1FUGA 3NCHA 1N1GA 1GSOA 3R9WA 3V6KA 5JSKA 4W5NA 2P9QA 4RK1A 4TWJA 4UREA 5GV7A 3T35A 3OCZA 4P2BA 4D4KA 4Z3KA 1GUZA 2M52A 3B82A 1ZOSA 1K8RA 1Q6YA 2I2AA 1XZKA 2W22A 3L0YA 4BJ6A 1E9CA 3WMXA 1UPCA 1SHJA 4X4QA 5KT5A 4P3YA 2AYXA 4KPGA 4XFDA 4UKDA 3GFYA 1HL7A 3LTOA 4LSZA 3BICA 1KE1A 4LF9J 2DT8A 3T5CA 4Y9UA 1H6BA 1RMQA 3ETNA 2AGQA 2DRAA 2BDUA 5H70A 4QUKA 2REXB 1MXHA 1J7KA 1I4DD 4YDSA 1J23A 2F1FA 3FE2A 3MPYA 4DR7C 1RVV1 2PWBA 1XRPA 4I1TA 4G5OA 4OYWA 4XVUA 1NZAA 2RMLA 5E7QA 3P0HA 3DT9A 1ZH2A 1NHKL 3KTFA 4OZ2A 3J80Y 4WP9A 4LF8B 2CLFB 1RLJA 3ESQA 4CDGA 1DCMA 2OEPA 1NEEA 4KFTA 1TKZA 5DBHX 3BZWA 1BX1A 2VYCA 4NOJA 3A36A 3CEHA 5LBTA 4MS3B 1Z6AA 3IE2A 1EJ7L 3BEOA 3FW1A 4IJWA 3IVRA 2DPIA 4LR7A 2P79A 4OAQA 1NM2A 2VAMA 3QTTA 4KV8B 3QBTA 2B3DA 2ZRBA 4P7TA 4DSFA 1TAHA 2PJUA 2L9WA 4IJVA 2ZJ3A 1BS2A 1HY3A 1TRHA 4RJLA 3VTIA 2Y05A 2C2ZB 1T9AA 1WHWA 3ELBA 1Z34A 3RV3A 3P96A 3JQ7B 5BJRA 1JMYA 1KKMA 3EQ2A 3WLAA 2AU0A 2WF5A 3JSMA 3KYCA 4IWXA 2Z04A 3DYAB 2WTUA 4RK0A 1NNLA 1Z6PA 7REQA 3LA8A 3KR2A 3RV2A 3PDHA 1HT2E 3QX3A 5AI6A 3MJEA 4JLNA 1K9VF 3CF2A 3QI7A 2EQAA 4BJ5A 3H2SA 4J4HA 3EXEA 4OHMA 1BKYA 2UV8G 1DCKA 3WIVA 4F56A 2MYFA 4UDYX 5HJEA 3N75A 3GDFA 2FXVA 3UYKA 1LWCB 3DYBA 3ICWA 2E49A 1SXJD 5I7UA 1WJ9A 1JAYA 2OO5A 4DJDC 4OHPA 4Y7CA 4L3KA 2PR2A 4GLFA 5L3ZA 2IYXA 1RYZA 2DECA 2MMCA 3UB4A 3SBEA 2O8BB 3SZUA 3IAAA 5LDDC 2FHJA 3IN5A 5A71A 1WHSA 2E85A 4DUTA 2PBRA 4EKEA 1ZZGA 2ENWA 3L8HA 1R6UA 4A8MP 5EXSA 2V7WA 4AUNA 2GN2A 1HFKA 2O20A 4EI2A 3BTUA 1WM1A 3C3YA 2M5OA 3MM8A 3L8FA 2N4DA 4P72A 3ORQA 2GZSA 1SV5A 3U1VA 2DG2A 4DV6C 2QAGA 2YQ3A 4CDIA 2E4XA 2FHKA 3ABOB 3I73A 1PW5A 4C0WA 4MRMB 1TUBA 3ZN2A 2C03A 3L7OA 5LPNA 3LC0A 4PQUA 4KCGA 4ZRMA 1W25A 3MSCA 3PYXA 2Q1XA 3FA2A 1FYEA 2YZMA 4QQRA 2FUG1 1XSEA 1FDTA 3EXHC 5A8KB 3ABSB 1XWLA 2F00A 3CCBA 4PONA 5C46F 4HLQB 4CUJA 5LSRA 5KYTA 2BONA 5DWVA 1RWMA 3ZZRA 1YGYA 4GR5A 3HHLA 5LYJB 1N3YA 3MC1A 1QSYA 4Y2KA 4KTQA 4MS3A 1VE9A 1PSZA 5JMTA 1GCAA 1B16A 1FS4A 3U4MA 3C85A 5JD4A 1HOTA 3T4UA 1N6QA 1IOZA 2YFQA 2OQRA 4N8OA 3EZ2A 1GO2A 3U02A 4JIMA 3U0VA 1VXOA 3HDVA 3W6NA 5GAEU 1EWKA 2O8CA 3ZGVA 5K2MA 1XNRJ 3PFHA 1JB0C 1R8QA 4M9UA 2J0UB 1BMTA 1RCFA 4BZQA 1R12A 4DMKA 3FLEA 4WZBB 1NM5A 4YIKA 4WLVA 1X1DA 2KDNA 1HQDA 3OSNA 3C3LA 5IUJC 1IM8A 1V3TA 2VJYA 1VIYA 1C1CB 2B4UA 4UT4A 4MWDA 1EDOA 5K3EA 4ZVHA 2C2DA 2OZEA 4Q05A 3LAWA 4ANDA 1VHDA 4EIWA 1M73E 1OC4A 4JC4A 4BP1A 1XO1A 1JAIA 3S1LA 2NXJA 1YX2A 1R0YA 3H11B 4OHBA 1SG6A 3VJLA 3ASUA 4FMDF 1EK0A 4UDOA 1UVLA 4PG7A 1W8DA 3F71A 2W2XA 4L78A 3U4HA 4D3DA 5G1OA 2DB3A 5H02A 1L8LA 2QG9B 3RQSA 4LGCA 2EFNA 2H2FA 1WC3A 2IYYA 4TV9B 4FVTA 1XPJA 2RGDA 4YJ3F 4AMUA 5J4HA 2OLWA 3Q7QA 3LH5A 3NIDB 1SUWA 4GUDA 1MQ9A 3W5BA 2KZZA 4XKJA 1W2IA 4KR0A 4R2LA 3QX7A 4P6QA 3B3QA 3T1TA 1JFVA 2FEMA 4WCDA 3D6MB 2R7SA 3NBQA 1S76D 3KUKA 3R3TA 1X4GA 4BPRA 4PN3A 2IQIA 1HDIA 1YBAA 1GAJA 4E5KA 3GZ4A 4JMLA 3RZAA 1TQDA 3NIWA 3EA5A 1M2OA 3Q4GA 5T8TA 4B6QA 2V7QD 1E2BA 4RA9A 2HMWA 4OYLA 3PYFA 2FW8A 1TM4E 3MEDB 4EOGA 3RNLA 4GBMA 5JY6A 1E1RA 3DLCA 3QXXA 3BJZA 5IT9A 2Y0CA 3EJ6A 3T5PA 2IA0A 1NVDA 3OJLA 5K3DA 1N92A 4C87A 4FMBB 3RSQA 1KR2A 2NXCA 3D1JA 3VAGA 3X1JA 2VC2B 3BGRA 3TL2A 1G2QA 1IDOA 2DH9A 4N7TA 1UKUA 3OX2A 2JHPA 4HXGA 1QOZA 3RC9A 3W7BA 5J2TB 1V9OA 1P5FA