2ZZPB

The crystal structure of human atg4b(c74s)- lc3(1-124) complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
119
structure length
119
Chain Sequence
b'EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease ATG4B
molecule tags Hydrolase/structural protein
source organism Homo sapiens
publication title The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
pubmed doi rcsb
total genus 34
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zzpB00
3UIPB 3KH0A 3JVZX 2CR5A 2CU1A 4W9KA 2LZ6A 5L83A 4E71A 2UYZB 1HE8A 1WRDB 4HCPB 5C1ZA 3LJ3A 2LWPA 2NPTB 2LGYA 1ZGUB 3W1SC 3ZIMA 2ZJDA 2ZCBA 3H9DA 2DZIA 3R7RA 4F7ZA 4MEMA 4DDGD 4KSKC 3ONSA 4TKNA 2LI5A 1OGWA 2ZPYA 4BBNC 1QZEA 1L7YA 2KK8A 2KTFA 3V6CB 4AOFA 4MM3A 3PHWB 2FCSA 2O2VA 3WANA 3KVFB 1WY8A 2WX1A 4MSMB 2FIFA 2KANA 2LRWA 3QX1A 3A9KB 2KWUB 3ZTCA 3ALBA 4EZLA 1WMHA 1ZKHA 1E5WA 4FJVB 1IYFA 3RULA 4I6LB 4BKTA 2RPQA 3ZW3A 1EF1A 2KDBA 5EDSA 2KJHB 3N3KB 3CSTA 2MBQA 3NZUA 4AWJA 4B6WA 1RFAA 3VAWA 3ZNGC 4ANWA 1EO6A 1ZW7A 4HVBA 5L95C 4K1RB 4EUTA 4M8NA 2JUOA 3PLUA 4TUUA 5DPSA 5JHAA 5J18A 1AARA 2JXXA 2KDFB 3S2AA 4FULA 2I1JA 3KYCD 3WAPA 2FIDA 4NNJB 3PV1A 3KYDD 2LGXA 3QHTA 1GG3A 4IUMB 3OLMD 2IO2B 4W9GA 3ZDMC 3ZO5B 3DVNU 4ASWC 1UBQA 1WJUA 2KZRA 3H7PB 3PHXB 2MW5A 4HXDA 3T8MA 4B9KA 3ENEA 1UD7A 1E8ZA 3A4SC 2UWQA 2ZZPB 1FXTB 2XEWA 3DVNV 4EKUA 2GMIC 1RLFA 2MQJA 5DPRA 4GMVA 4JGHB 3WALA 4FHJA 1WGHA 2L7RA 2N7DA 2K39A 1WXMA 3I3TB 5CHVC 4MSQB 3EECA 2O6VA 3V6EB 1VD2A 2A4ZA 2GBJA 4AJYB 4IM3A 4XC2A 5DPTA 2N4FA 4GDLA 3QIJA 3ZLZA 4K7SA 5AZGA 1E8WA 3UIOB 5LXHA 1XQQA 4IWOA 4ZRJA 3VTVA 4W9DA 3ZRFA 4GGQA 1OEYA 3ZNHB 3DVGY 1WXAA 4FA6A 2L3ZA 5FR6A 3ZNZB 4ZDVA 2KMAA 3VTWA 1YQBA 5C23A 4FADA 2D2QA 2LGDA 3L13A 4TQ1A 3TCAA 3UQBA 3VUWA 2BKRB 3W1YA 2CKHB 2LXAA 4TQ0A 1OEYJ 4LCDE 2HE7A 2KKCA 1H8CA 3A33B 3VXWA 2DZKA 2AL3A 2KFJA 2ZVOA 3BINA 4NQKE 4WAAA 1OTRB 1GUAB 2BGFA 2CHWA 3MJWA 4DXAB 4MGZE 4MH0E 4HPLB 1IPGA 4WJPA 4FBJB 1D3ZA 2C7NB 1WZ3A 1SGHA 2GBKA 2D11A 2HD5B 2ZCCA 1RRBA 2MX2A 2NBUA 1WX8A 2NCNA 1XD3B 4FJZA 2Y5BB 4ANVA 3HM3A 1WJ6A 1WR6E 2R2QA 1V5OA 1P0RA 3ZKJC 4K81A 1V5TA 3A4RA 2WDTB 2KO3A 4ZRIA 4MGYE 1A5RA 1PQSA 2BYVE 1NDDA 1E8YA 2KDIA 2KHWB 2ZEQA 2DAFA 3PVLA 4GDLB 3VH3B 1YX6B 3HM6X 3IVFA 4IWQA 3PRZA 2JT4B 2JZ3B 4EZKA 3W1SA 1Y8RC 2XBBC 2DZJA 2WWZA 1MG8A 2YLMA 4KDIC 4GN1A 1GJZA 2ZVNA 1V80A 2KJRA 3UGBB 1WGRA 3PT2B 1BT0A 5JZEB 4HPMB 2LJ5A 2FCMA 5E6PA 3X23A 2CHXA 2KX3A 4PS7A 3PGEA 2BF8B 4E74A 4DWFA 3R7QA 3PSEB 3BY4B 3HIZA 2KLCA 4M8MA 4F1SA 4NAWA 3KW5B 3OJ3A 3V61A 2Z0EB 1KM7A 1P98A 2N9EB 1WH3A 3UF8A 3VTUA 3QWZB 4FLHA 5KHQA 3VQIA 2L00B 1F9JA 1WGGA 2KTRB 2KX0A 3KUDB 4FHKA 4BKGA 3KUCB 3VUXA 3NZSA 3QQ8B 2WX0A 4DHZE 3PREA 3TL5A 5IA7A 3CMMB 1C3TA 1R4MI 4BOZB 1E90A 4W9CA 3HHMA 3RZWC 4WWPA 3H7SA 2ZPNA 3KUZA 4NAWB 2LVQA 2MP2A 4K7WA 5D94A 4X57B 4TV3A 4AJWA 3AULA 4BOSC 2V4LA 1V6EA 3ZNID 4HCNB 2EMSA 2GOWA 3DBSA 5IAAC 4G11A 3B08A 3O65B 4BFRA 3APDA 3L08A 3DCGA 1WR1A 1YX5B 3B1LX 2KLGA 1Q0WB 1E7UA 2C5LC 5KHOA 2IYDB 2LRUA 2GBRA 2O6VB 2BYEA 1WMHB 5JH5C 4KZCA 3H6NA 3UQAA 2JY6A 2YVCA 4MELA 1ISNA 1LM8B 1VCBA 4ICVA 1P1AA 3JSVA 4K7UA 3ZUNA 2WYQA 3VH4B 3PS6A 2KFKB 1WE7A 2DENB 1X1MA 2K25A 3DPDA 1V86A 3WIMA 3C0RB 1KOTA 2GBMA 3TBLD 2M8SA 5CX3A 2CHZA 2J0JA 4NQLB 3VHTC 4DK5A 1EUVB 1WF9A 2PE9A 2MBBB 2JRHA 2IBIB 1K8RB 2XK5A 3AXCA 4E3CA 4ZYNA 2JZZA 5AZFA 4CO7A 2FNJB 4MDKE 3QARA 3WAMA 3U30A 4BVUC 3HK0A 3Q3FA 3U7DA 4GDKA 3CSFA 5DCNA 5LXIB 2AEHA 1SE9A 2CS4A 3IBEA 4F8CB 2O6VD 1WIAA 4W9HA 2C7MB 4GU2A 3ZRCA 3P2BA 3Q3JA 4NJ6A 4KV2A 4WJQA 3VUYA 3PTFC 3DBLI 4WJOA 4BBNF 1IP9A 2JWZA 4CYEA 4GB9A 4KIKB 4FN2A 4W9JA 4JQWC 1T0YA 2Z59B 4WWOA 2L8JA 2RSUA 2NVUI 2NPTA 2OJRA 2A5UA 1WGDA 2IZVB 1LXDA 4I6NB 2K8HA 2RGFA 2MWSB 3A9KA 5E6NA 1UZXB 4MJSB 2REXA 3DBHI 4LDTD 2BYFA 3DOWA 2K8BA 1Z5SB 1KJTA 4IW0A 1YJ1A 2J7QB 2K1FA 2OOBB 3D32A 5AEKB 2N9XA 2EKEC 3H7PA 2LASA 4HDQA 5D7GA 4A20A 1YD8U 2G3QB 4BKSD 3IHPC 4DBGA 2V3SA 2IY0B 3L10B 1Q1OA 3VDZA 4MGIE 3L16A 1UBIA 1G6JA 3TIXA 2NS5A 1WJ4A 4W9FA 3R66C 2O2VB 4RM8A 2NR2A 3SU8X 3U8ZA 5CTRC 1JRUA 3QA8A 2FCNA 1WI0A 2JRIB 2K6DB 2LVPA 3EC8A 4JLCA 3AI5A 1SIFA 2HJ8A 1YIWA 3LDZE 4LJOB 4ANXA 2AWTA 3DBRI 4KZ0A 2PPHA 4IC7B 2JF5A 5BO4B 1Z2MA 4IM2A 1WE6A 4N9F4 4NJ7A 2MSED 4M0WB 3ML8A 4URKA 2KQ7A 2L76A 4PS3A 3AU4A 1KLVA 2K6QA 2JPHA 2KN5A 2ZNVB 4PYZA 3RYTA 3IG3A 4GIVA 4G0NB 4HWIB 1V81A 2DAJA 4IWPA 1OQYA 4W9LA 2BKFA 2W9NA 3MHSD 4IM0A 4GXBA 4YL8A 5J17A 2KTRA 4EOYA 3QCAA 3V60A 2AYOB 2N9PC 4NPNA 4P7IA 3QJZA 4I6PA 5TR5A 2C9WB 3GZNI 3SHQA 4MJSA 1H4RA 3NS8A 3X0WA 3EHVA 3CF6E 3N32A 2D10A 5J2RA 5D6JB 1TBEA 2L0FA 1WJNA 2M17A 3JW0X 3JSVB 3H1UA 1CMXB 4KSLC 5CHWA 5AZHA 2BWES 2MCNB 3PZDA 4WQOB 2ZNVC 2J0MA 1UELA 3RT3B 2BPSA 2DYBA 2V1YA 3QC8B 5LLIA 4CHKA 2DYOA 2DZMA 2K8CA 1WM3A 3MTNB 3RD2A 1L2NA 4OVVA 4A3PA 2D3GA 2NBVB 2N7EA 2XK5B 2PEAA 2FUHB 1WYWB 3IFWB 3NY5A 2C60A 4ANUA 1LQBA 4FJYA 4DHJD 2FAZA 2B3AA 4II2B 2MLBA 4ZRKA 3GOEA 4GOCA 3APFA 3DQVA 4EFOA 2FCQA 1WX7A 3L54A 4OVUA 3M63B 2VRRB 2G45B 4DHJB 2N1VA 3RCZA 3SD5A 1P3QU 4HK2A 2L05A 2MBHA 1GC6A 3WA0A 1TTNA 4B95A 1WGYA 2HTHA 2KWCA 2LVOA 3NHEB 2MBOA 2KJ6A 2JVCA 2KDEB 1Q5WB 3PPAA 3PRPB 2LUEA 4G50A 1WM2A 2KQSA 4KIKA 4W9EA 3VVWB 1V2YA 1TZ1A 1GC7A 3JYUA 4NY0A 2G4DB 1V9JA 2IY1B 2KC2A 4EZJA 3A9JB 3PLVA 4WWNA 2KC1A 3DVGX 4II3B 2N1WA 3WAOA 1U4AA 2D07B 3ZTDA 3UINB 4GDKB 2L0TA 3A1QA 1XT9B 1UH6A 4HDOA 2MBEA 2DX5B 2KXJA 4XX5A 1NI2A 2IO0B 1J8CA 1E7VA 2MA9B 2PE6B 2R2OA 1EF5A 4LJPB 4W9IA 2DYMA 4JL9A 4G3XB 4LDTB 1P9DU 3QK0A 4GSWA 4PYUA 1E8XA 3AU5A 3ECIA 2G4SA 1V49A 3ML9A 2KOXA 4WJNA 1UGMA 4DDID 4JIOU 4XZ4A 2RD0A 3TJPA 4J6IA 2I1KA 3M95A 2IO3B 4HJKA 5DPWA 4IG7B 4AP4C 2KFKA 5HKHA 2BWFA 5G55A 2J0KA 3EFUA 3TMPB 2KD0A 1WXSA 2MP2B 5D2MB 1WXVA 2LD9A 2M1MA 3SDLC 4HLEA 3ZVVA 5E6OA 2NBWB 4A3OA 2KVRA 1WX9A 1TGZB 4EEWA 2C7HA 4AUQC 3B0AA 3PRMB 5G2NA 3RUIB 2AL6A 2KWVB 4RM9A 3ZDTA 1I35A 2EMTA 1S1QB 2KNBA 3K9OB 2PJHA 5GMVA 1WFYA 3L17A 3A1QB 1C1YB 4ICUA 2M0XA 2Z0DB 4MGKE 3V62A 3T9LA 4PS8A 3N30A 2KMCA 4KVGB 2RR9A 1NBFC 1J0GA 3L0WB 1RAXA 3QAQA 5JHBA 3M3JA 3OJ4B 2MRPA 3RZFA 3OAWA 1LFDA 3A9JA 4KDLB 1WZ0A 3M62B 3APCA 4DHZB 4BKSA 3NOBA 2ASQA 1S3SG 3VFKA 3DDCB 2LXCA 1M94A 1I42A 2M4NA 3R3MA 2GBNA 4RMAA 5CHFA 1J19A 3K9PB 2IO1B 1GNUA 1R4NI 2DHZA 2QHOA
chains in the Genus database with same CATH superfamily
3UIPB 4E71A 4S0RA 2I38A 2NPTB 5IO9A 2BB6A 2TSSA 4F7ZA 3Q8CA 4JE3B 2KK8A 1VLBA 1T5XD 2XN9C 1JWUD 3PHWB 1IYFA 3RULA 4BKTA 3ZW3A 3NZUA 1RFAA 3ZNGC 1ZW7A 4HVBA 4M8NA 3FC4A 2GRIA 5DPSA 1XCQL 2INPE 2KDFB 4FULA 2I1JA 3PV1A 3KYDD 3QHTA 3Q3MC 3OLMD 2IO2B 5HI1A 4OZAA 3DVNU 1WJUA 1M4VA 2KZRA 1ET9A 3ENEA 1UD7A 1I4QA 2KN4A 3A4SC 3CWIA 5BYRA 1JQ4A 3AM9A 2N7DA 1SF0A 2K39A 2KQ4X 3V6EB 4ZHPA 3UIOB 4YTPB 3BYTB 3OG5A 4ZRJA 4W9DA 4XWTA 1NYQA 1UNSA 1ZXHA 3DVGY 5FR6A 3ZNZB 3BK1A 1YQBA 3RNFC 4FADA 2K5PA 2QEJC 3W1YA 2CKHB 2LXAA 4TQ0A 1FFVA 1MHXA 2WU2B 2DZKA 2AX5A 3AEAB 2KFJA 1L0YB 3BINA 4L1BA 1GUAB 5C3JB 3NS1A 5IOIA 2C7NB 4YSZB 2D11A 2JQRB 2PLPA 3U2SC 2MX2A 2NBUA 1WXQA 1WX8A 1QKZA 3IXSA 2LGIA 1VRAB 5IKCM 4YWGG 1DGJA 2KO3A 1PQSA 3RI7C 1E8YA 1NVID 2ZEQA 2ZW1A 2N9LA 1YX6B 3IVFA 3PRZA 4YT0B 2EELA 1YN4A 3ZGZA 2XBBC 2DLBA 5EE9A 4D2KA 1ZDVA 4GN1A 4KDIC 2KJRA 1V1PA 3R8BA 2IDYA 1C4PA 2BF8B 4DWFA 1GOZA 3BY4B 3TEXA 3OJ3A 2Z0EB 3ZXVA 1KM7A 1WH3A 3UF8A 3VTUA 4FLHA 1F9JA 1DOIA 1TZOA 4FHKA 3Q3OC 4BKGA 1WYGA 2WDRB 3NZSA 3QQ8B 1EU3A 5IA7A 1C3TA 2WXRA 1SJED 3Q14C 2INDC 2JYEA 4NAWB 4BOSC 4LLGM 1VZ6A 2GOWA 1KH0A 2MHJA 3R2TA 1E7PB 1HQRD 1JWSD 5KHOA 1IBXA 4KGRA 3VRAB 2KDMA 3UQAA 2MH7A 2YVCA 1UGJA 4MELA 1ISNA 1RFKA 4K7UA 3ZUNA 3VH4B 1WE7A 2DENB 2PTLA 5CX3A 4NQLB 4C80A 1WRIA 1K8RB 1PDXA 5HHDG 4MDKE 3QARA 3WAMA 4BVUC 2V3PA 3Q3FA 3U7DA 3CSFA 1QF6A 2Q5WD 4W9HA 2YEPF 4KV2A 4WJQA 3PTFC 3DBLI 4CYEA 1UUPA 1QQRA 4W9JA 2FBWB 2RGFA 2MWSB 3DBHI 2BYFA 3DOWA 3RNCC 4GLSC 3DBLB 2WQYB 3H7PA 2LASA 3BIID 2IY0B 5E6JA 3NZ3A 1UBIA 3RFZB 4KGTA 4J3OD 4RM8A 3J9CA 2BS3B 3U8ZA 1C79A 4JLCA 3EC8A 1D4BA 1SIFA 2HJ8A 3LB8C 1YIWA 4LJOB 1KFYB 3Q8AA 5H8YE 3DBRI 4IC7B 5T8IA 4IM2A 1WE6A 4M0WB 5G5GA 4URKA 1TY0A 2L76A 1ESFA 2ZNVB 3RYTA 4HWIB 2DAJA 4IWPA 2V4IB 2LGSA 4WIPA 3AEFB 3QCAA 2N9PC 1CJEA 2MJ3A 1H4RA 2K9XA 1P7EA 3MP9A 1ZUD2 2L0FA 3H1UA 1CMXB 5CHWA 3AE2B 5AZHA 3BZDB 4M00A 3PZDA 4WQOB 1TS4A 4C4VA 2BPSA 2DYBA 1JMLA 3GE3C 2DYOA 2K8CA 3FAHA 4FXCA 2V3NA 3TUOA 1HEZE 2N7EA 3IFWB 2JZPA 3AE8B 2B3AA 3DQVA 1OFFA 3L54A 2WXPA 2G45B 4HK2A 1QOFA 4K3BA 1T0RC 1P7FA 1WGYA 2KWCA 3PRPB 2MBOA 2IGDA 3PPAA 2KQSA 4W9EA 1V2YA 1TZ1A 1JRPA 3IT4B 2IY1B 4EZJA 4P16A 2KC1A 3SR6A 3B2GA 3ZTDA 1UF0A 1XT9B 2KXJA 2LJIA 2JXTA 1XLQA 2R2OA 1ET6A 1P9DU 1EWCA 1V49A 2RD0A 2WXKA 4AP4C 4WQMA 2KFKA 1N5XA 4A8XC 3ZVVA 4A3OA 4JPSA 1WX9A 4EEWA 4AUQC 1JROA 1SB3C 2KNBA 3K9OB 5GMVA 1NENB 3A1QB 3P4SB 4ICUA 1YOVB 3V62A 3N30A 2RR9A 1L0VB 1QILA 3L0WB 1RAXA 4EE2A 5HFYA 1PYWD 3M3JA 3U4EG 1K51A 3BVMA 2WDQB 4JWUC 3NOBA 3VFKA 1I4HA 1M94A 4IDIA 2X8XX 4ZYSA 2RMMA 4RFBA 2KYWA 2IPKD 1J19A 4KGSA 2IO1B 1E9MA 2QHOA 3P4RB 4W9KA 2LZ6A 2AQ2B 1FPYA 1HE8A 1WRDB 3LJ3A 2LWPA 2JSVX 2HTME 3W1SC 3H9DA 1RYJA 2ZCBA 4RGNA 4A90A 4MEMA 4DDGD 1N62A 2GI9A 4KSKC 3ONSA 4TKNA 2LI5A 1OGWA 2ZPYA 1N61A 1PGAA 3KVFB 1WY8A 2FIFA 2KANA 3QX1A 3ZTCA 2BW2A 3AE6B 1WMHA 1ZKHA 4FJVB 2Y5CA 1B9RA 3VAWA 1ZXIA 2DBYA 4EUTA 1AN8A 3PLUA 1F52A 4HKZE 4NNJB 4FA6A 2LGXA 1GG3A 3ZDMC 3H7PB 3T8MA 1FXTB 2XEWA 4EKUA 1RLFA 3I57A 2MQJA 4S17A 3WALA 1WGHA 3DHGC 1WXMA 5CHVC 3ZNID 3EECA 4AJYB 3W2DA 2GBJA 4K3CA 4IM3A 2N4FA 4K7SA 4US9A 1RWSA 1AWDA 1WSPA 1XQQA 3ZRFA 3ZNHB 1OEYA 3VTWA 2AQ3B 2D2QA 4TQ1A 1CK1A 1R4NB 2RPVA 1OEYJ 3ZQ4A 2KKCA 5BYSA 3VXWA 2AL3A 4R3DA 3LYYA 4DXAB 3GZNB 3NVZA 4MGZE 3TSSA 1IPGA 4WJPA 4M01A 2WXNA 1WZ3A 3P4PB 1VR9A 1SGHA 3Q6BA 1RRBA 2NCNA 1XD3B 4ANVA 1WJ6A 1WR6E 2J53A 1NYRA 2R2QA 2G1EA 1V5OA 1P0RA 4OHJA 2L83A 3AE3B 2Z8LA 2RDBC 1A5RA 4MGYE 4Q2JA 4C00A 2QC8A 3HM6X 5TSSA 4LTUA 2DZJA 1MG8A 1VJKA 1GJZA 1KF6B 1V80A 4LNNA 3MC0B 3UGBB 2LJ5A 1QOBA 3HIZA 2E6XA 3KW5B 3V61A 1IBXB 2KMMA 1QOGA 3PO0A 1D5ZC 5KHQA 3VQIA 2L00B 1WGGA 2KTRB 2PVOD 1JWBD 3NJTA 3DBHB 2ONQA 3Q8EA 4L23A 4DHZE 3CMMB 1R4MI 1JWMD 3HHMA 3RZWC 2ZPNA 2M19A 3ZIMA 2MP2A 4X57B 3AMZA 3IAS1 4HCNB 5I4DA 3DBSA 3O65B 3L08A 4P1BC 1WR1A 1YX5B 3AEGB 1K53A 2KLGA 1Q0WB 1EM7A 1XO3A 2GBRA 1KTKA 2O6VB 1MPEA 5JH5C 2WLBA 3H6NA 1B1ZA 2LHEA 1CZPA 1E6EB 1VCBA 1LM8B 3DHHC 4ICVA 2QCZA 3DPDA 3WIMA 3E9SA 3C0RB 2M8SA 3P1MA 2CHZA 3VHTC 1WF9A 2CU3A 2JRHA 2IBIB 2XK5A 2WXOA 4IOIE 4ZYNA 4KX6B 5AZFA 1I4PA 5JXVA 1SE4A 4GDKA 5DCNA 1KLGD 1HZ5A 3ZXRA 5LXIB 3FILA 2CS4A 4F8CB 2O6VD 1WIAA 2CJNA 3VUYA 1IP9A 4WJOA 4BBNF 2JWZA 4KIKB 4FN2A 1L0XB 4JQWC 1T0YA 2Z59B 2NVUI 1ZP0B 1PUTA 2A5UA 4AQ7A 1WGDA 3B9JA 5E6NA 4MJSB 4LDTD 3MJ5A 2K8BA 1Z5SB 1KJTA 2J7QB 2PKOA 4ITKA 4LNOA 5AEKB 4ZOHC 2EKEC 4BKSD 1YD8U 2G3QB 1SSNA 2OHFA 3L10B 1Q1OA 4MGIE 1KRHA 4HPPA 1G6JA 4W9FA 5D3DA 3SU8X 5CTRC 4YXDB 2LVPA 1F1HA 3LDZE 4TSSA 3EA6A 3HVDA 3ABVB 3P42A 5BO4B 3BYYB 4DQOC 1KLVA 5HG2A 4PYZA 1PGXA 1FD6A 3IG3A 4GIVA 4N59A 1V81A 1L5PA 2V0GA 1ROEA 3MHSD 4RGMA 4IM0A 4A9AA 1YNTE 3Q8BA 5J17A 4EOYA 1TS5A 2LEKA 2LFIA 2WXMA 1WJNA 2BVCA 2BWES 1A70A 3N1ZC 2K22A 1UELA 2WXQA 4NAMA 1QT9A 1QLBB 2DZMA 1WM3A 4OZBA 4OVVA 3MHZA 2NBVB 2PEAA 2D3BA 2C60A 3AH7A 4ANUA 1L6VA 2W82A 4FJYA 5IN7A 1LO5D 3V3XA 4GOCA 3APFA 4EFOA 1WX7A 1FRRA 1T0SC 2G9HD 3M63B 3AV8A 3SD5A 3VR8B 4ACFA 3WA0A 4B95A 2HTHA 2WP9B 3NHEB 2KJ6A 2OJWA 1V1PB 4MACA 3VVWB 3WCQA 5IP4D 3JYUA 2KVZA 4NY0A 4II3B 3DVGX 1GPXA 3UINB 4GDKB 3MC8A 3A1QA 4HDOA 2MBEA 3W5VB 2BYTA 1SE2A 2IO0B 3KLSX 1E7VA 1FIQA 1EF5A 2DYMA 4JL9A 4LDTB 4PYUA 1E8XA 3AU5A 2KOXA 1UGMA 4JIOU 4AS1A 2I1KA 1HTQA 5DPWA 1R7SA 3C8YA 1MG4A 3P4QB 3Q2AC 4O1NA 1YJJA 2J0KA 3EFUA 2KD0A 2MP2B 2M1MA 2NBWB 2C7HA 3B0AA 5G2NA 2JX5A 2UU7A 2AL6A 3ZDTA 1I35A 2EMTA 4L2YA 3TEWA 3URYA 3N9YC 1C1YB 2B76B 4MGKE 1GB4A 1YQ4B 4KVGB 1J0GA 3IAM1 2WXIA 2MRPA 4OVZA 1GAQB 3A9JA 2IJ0A 3E56A 4DHZB 4BKSA 1ZPSA 3NVWA 1GNUA 1R4NI 3KH0A 3JVZX 2CR5A 5L83A 2UYZB 3N1YC 5C1ZA 4WAFA 2ZJDA 4ZHOA 4PT5A 3KQ4A 3AE5B 4C4VB 3AE1B 4BBNC 1QZEA 1RM6C 3V6CB 4AOFA 4MM3A 2FCSA 2PVGC 2O2VA 1F77A 5FK9C 3WANA 2WX1A 4MSMB 2LRWA 1DOXA 3AEBB 1E5WA 2RPQA 1EF1A 2H89B 2WXGA 3N3KB 3CSTA 2MBQA 3RNAC 4AWJA 4B6WA 5L95C 1DOYA 2MJEA 1SE3A 1SEBD 1AARA 2PW9A 3KYCD 2FIDA 4W9GA 4N58A 4ASWC 4B9KA 3PHXB 4HXDA 1E8ZA 2UWQA 3DVNV 2JWUA 1T6BX 4GMVA 4JGHB 2ZW0A 4FHJA 2L7RA 2O6VA 1VD2A 1IGCA 4XC2A 4GDLA 2Y3AA 5AZGA 2RDHA 2BT6A 5LXHA 3VTVA 4GGQA 4ZDVA 1WXAA 2L3ZA 2KMAA 1MFWA 5C23A 3L13A 2BKRB 1TY2A 3TEYA 3PZ8A 4LCDE 1D5XC 3RNEC 3A33B 1VZ7A 1K52A 5FKAC 4NQKE 4LNFA 2BGFA 2CHWA 3MJWA 4MH0E 3AECB 4FBJB 1C78A 1HTOA 2GBKA 2WXJA 2ZCCA 4PK1A 4FJZA 5AUIA 1BXTA 1V5TA 3A4RA 4XDCA 4OW0A 4ZRIA 2I2YA 1NDDA 2KDIA 2KHWB 3AN1A 4GDLB 3VH3B 4IWQA 2JZ3B 4EZKA 3W1SA 1EWYC 2WWZA 2YLMA 4YSYB 1WGRA 2INCC 3PT2B 3NUHB 1BT0A 3HVZA 2BQQA 4HPMB 5EE1A 3X23A 2CHXA 4PS7A 3PGEA 1HA5A 1J7BA 1R4MB 1STEA 4M8MA 4NAWA 5GXGB 1P98A 4HEA1 2Y5PA 3DWGC 3AB5A 2N9EB 1TKEA 1DYQA 1I4GA 2KX0A 2W3RA 3KUCB 1C77A 3BVZA 3U52E 3PREA 1EU4A 3TL5A 4OZCA 2INNE 4C56C 2M0AA 4WWPA 3KUZA 4IKGA 5D94A 4AJWA 4K7WA 3BWUD 4TV3A 4ARCA 2EMSA 4G11A 3B08A 4BFRA 3SEBA 3DCGA 4N6EB 2W54A 4WURA 4B0MA 1E7UA 2C5LC 2IYDB 1MI0A 1N63A 2BYEA 1WMHB 1LGRA 3RMKC 1FEHA 1L4DB 4US8A 2JY6A 1FCLA 1P1AA 3JSVA 2KFKB 1KOTA 1X1MA 2K25A 2GBMA 3TBLD 4DK5A 1EUVB 1MHHE 1C9FA 3O13A 2JZZA 4HJGE 4CO7A 1V97A 4WH4A 4M0WA 1CQVA 3T3NA 1V1OA 2AEHA 1SE9A 4HROA 1J7AA 1TKGA 4GU2A 3U7ZA 2L32A 4GB9A 1ENFA 1YN3A 4USAA 4ZRPA 4WWOA 2L8JA 2QILA 2NPTA 1VZ8A 2OJRA 2V9HA 2WNMA 2K8HA 4NZLB 1WWTA 3HUIA 1HZ6A 5BMIA 2VH1A 3NRZA 1KLUD 4IW0A 1YJ1A 1AYFA 3I5JC 4LNKA 2N9XA 4M02A 1F0ZA 1I7HA 4HDQA 1JW9D 4A20A 2V3SA 3AE4B 3VDZA 3EUB2 2NS5A 1WJ4A 1L6UA 2FCNA 2JRIB 2JYTA 2K6DB 1IGDA 3AI5A 4YTMB 1XEEA 4ANXA 2DWQA 4KZ0A 1Z2MA 1N60A 4NJ7A 2MSED 2N7JA 3ML8A 4PS3A 5EE3A 3AU4A 4MM3B 2JPHA 2KN5A 2XNAC 2QIEB 4W9LA 3GB1A 2W9NA 3LXFA 2OEDA 2ACZB 4XE0A 3V60A 2K0PA 2VZKB 5BMHA 4I6PA 2C9WB 3GZNI 3L4PA 1FMAD 1I4XA 2D10A 4RF1A 2M17A 3JW0X 4KSLC 4A55A 3GS2A 1YMHE 3BK2A 2J0MA 3RT3B 2W3SA 2HDEA 1E10A 1TT5B 3NVVA 5LLIA 3MTNB 3RD2A 1L2NA 4YTNB 4A3PA 3TEZA 2EKIA 2XK5B 2FUHB 1WYWB 3NY5A 1LQBA 2FAZA 4II2B 2MLBA 5EE0A 2FCQA 3RPFC 3FILB 4OVUA 4RCOA 2VZKD 2VRRB 4DHJB 2LVOA 2BS2B 2JVCA 1TS2A 2YEPB 4KIKA 2X38A 1GC7A 1MVKA 2G4DB 2KC2A 2D3AA 1JWAD 3PLVA 3WAOA 2N1WA 4DXFA 2D07B 1UH6A 2LHDA 1OQQA 2KWDA 2DX5B 1NI2A 2FUG1 1J8CA 3AE9B 2MA9B 2PE6B 2WS3B 2GLSA 1N5WA 4GSWA 2HJ1A 3ML9A 4WJNA 1Q10A 4DDID 4XZ4A 4XYCA 4JX1C 3M95A 4IG7B 1TYGB 1ACCA 5G55A 2FE8A 1WXSA 5D2MB 3SDLC 5E6OA 1OQRA 2RDGA 3FKYA 2VH2A 2KVRA 4KKIA 1FO4A 2QJLA 4RM9A 2PJHA 3KWLA 3L17A 1PFDA 2M0XA 2Z0DB 2ICIA 3T9LA 2KMCA 5JHBA 5BYQA 1WGKA 1LFDA 4KDLB 3M62B 3APCA 1QOAA 2QSDA 2ASQA 2NTTA 3SFEB 1TIFA 1I42A 2M4NA 3R3MA 4RMAA 2DHZA 5AUKA 4DXGA 2CU1A 4HCPB 2LGYA 1ZGUB 3BVGA 2DZIA 3R7RA 1FXIA 2KTFA 1L7YA 2J42A 3A9KB 2KWUB 3ALBA 4EZLA 1VDVA 4I6LB 2KDBA 5EDSA 1D5MC 2KJHB 2D5GA 2E3TA 2M56B 2JU6X 4ANWA 1EO6A 4K1RB 1I4RA 2WU5B 2JUOA 2R61A 3H8HA 1XLNA 2IGGA 4TUUA 1Y56A 3NG0A 5JHAA 5J18A 2JXXA 2NTSA 2D3CA 3S2AA 3WAPA 1UWXA 4IUMB 3ZO5B 2WXHA 1UBQA 2MW5A 2WHIA 2W55A 2ZZPB 2GMIC 3RNBC 5DPRA 3GP7A 3DBRB 2PMVA 1YQ3B 1HXYD 1K50A 3I3TB 4MSQB 2A4ZA 5DPTA 3HRDD 3QIJA 3ZLZA 4YSXB 2QDFA 1E8WA 2AQ1B 4BZAA 4IWOA 1GB1A 1XLPA 2K3UA 2LGDA 3Q69A 3TCAA 3UQBA 1PGBA 3VUWA 1FM0D 1V8CA 3ZJUA 3I9V1 2HE7A 1H8CA 3W5UB 2ZVOA 4WAAA 1OTRB 2MJDA 2SAKA 4HPLB 1D3ZA 2N0SB 3ZJVA 1N6ZA 5H92C 4MT5A 2HD5B 4RGOS 2Y5BB 3HM3A 3ZKJC 4K81A 2WDTB 3CIRB 2MEKA 2BYVE 4LK0M 1SXTA 2DAFA 3PVLA 1SBBB 4XGAB 2KACA 2JT4B 3ZYYX 3MFGA 1Y8RC 1IUEA 1YJIA 4KKJA 3EGRA 2ZVNA 1ZOYB 2BTEA 4A6QA 5JZEB 2FCMA 5E6PA 2KX3A 4E74A 4WWMA 3R7QA 3PSEB 4F1SA 2KLCA 1TKYA 4JWSC 4LNIA 2J52A 3QWZB 3T3OA 3KUDB 1NI3A 1D6EC 3VUXA 1F2RI 2WX0A 4RH6A 1SJHD 4BOZB 1E90A 4W9CA 4B0EA 3H7SA 2LVQA 3W9CB 5LNK1 3AULA 2V4LA 1V6EA 3AEDB 5IAAC 1L4ZB 3APDA 3B1LX 4XWWA 2LRUA 3N1XC 4KZCA 1FNVA 2WYQA 3PS6A 4REZA 1V86A 2H88B 1BUIC 2J0JA 2KT7A 2PE9A 2MBBB 2N9KA 2DNFA 3AXCA 1XF5L 4E3CA 4P1CC 2FNJB 1T3QA 3U30A 3HK0A 1TJEA 4BAXA 3IBEA 1XXGA 2C7MB 3ZRCA 3P2BA 3Q3JA 4NJ6A 2BS4B 5D3IB 2WXLA 3MC9A 2PIAA 1AW7A 2RSUA 1ZDXA 1XLOA 2IZVB 1LXDA 4I6NB 1TS3A 3A9KA 1J7CA 1JALA 1UZXB 2REXA 1FFUA 4QAYA 2K1FA 2OOBB 3D32A 4H2AA 2QMTA 5D7GA 4DBGA 3IHPC 4C7ZA 3L16A 2CJOA 1ZE3D 1FNUA 3TIXA 3VR9B 4HKQA 5MPOA 3R66C 2O2VB 4C7YA 2NR2A 2GB1A 1JRUA 3QA8A 4P6VF 1WI0A 2IGHA 1FXAA 3RN9C 2AWTA 3ETRA 2PPHA 2JF5A 4N9F4 3Q3NC 1SIJA 4XDDA 2KQ7A 1MJDA 3I63C 2K6QA 3C19A 1YN5A 2WGSA 4G0NB 3EFCA 1T0QC 4TMAB 3DHIC 1OQYA 2BKFA 3Q8FA 5BMGA 3NVYA 4GXBA 4RGTA 2BBCA 4YL8A 2BB5A 2KTRA 3V05A 2AYOB 1JCKB 2LMCA 1UWMA 4NPNA 4P7IA 3QJZA 4RF0A 5TR5A 3SHQA 4MJSA 3NS8A 3X0WA 3EHVA 3CF6E 3N20C 3N32A 5J2RA 5G5HA 5D6JB 1TBEA 5FR3A 3JSVB 1C76A 2MCNB 2ZNVC 1C4AA 3SFDB 4ZRQA 3QC8B 2V1YA 1BMLC 4CHKA 4MH8A 2D3GA 3KWVA 3UI3A 2NMQA 4DHJD 4CQNA 2KAJA 4ZRKA 3GOEA 2N1VA 3RCZA 1P3QU 2L05A 2MBHA 1GC6A 1TTNA 2KDEB 1Q5WB 4G50A 2LUEA 1WM2A 4ARIA 2WDVB 1FCCC 2WXFA 4UDUC 3R2IA 1V9JA 1FRDA 3A9JB 4WWNA 3RNGC 1U4AA 2L0TA 2L1AA 4XX5A 3VRBB 4RNAA 4LJPB 4W9IA 1C4CA 4G3XB 4NJCA 2J4XA 3QK0A 3ECIA 2G4SA 3GE8C 3TJPA 4J6IA 1NEKB 2IO3B 4HJKA 3AEEB 5HKHA 2BWFA 3TMPB 1WXVA 2LD9A 3ZJTA 4HRSA 4HLEA 3B2FA 2ON8A 1TGZB 3PRMB 3RUIB 2KWVB 1S1QB 2SEBD 1WFYA 1F2RC 3AE7B 4PS8A 3OWEB 1NBFC 3QAQA 3OJ4B 3RZFA 3OAWA 3P63A 1WZ0A 3DWMA 5C2TB 1S3SG 3DDCB 2LXCA 2L52A 3PZ7A 2GBNA 2LUMA 5CHFA 3K9PB 3IT6B 1FNWA 1E0ZA 1XCTL
chains in the Genus database with same CATH topology
3UIPB 3KH0A 3JVZX 2CR5A 2CU1A 4W9KA 2LZ6A 5L83A 4E71A 2UYZB 1HE8A 1WRDB 4HCPB 5C1ZA 3LJ3A 2LWPA 2NPTB 2LGYA 1ZGUB 3W1SC 3ZIMA 2ZJDA 2ZCBA 3H9DA 2DZIA 3R7RA 4F7ZA 4MEMA 4DDGD 4KSKC 3ONSA 4TKNA 2LI5A 1OGWA 2ZPYA 4BBNC 1QZEA 1L7YA 2KK8A 2KTFA 3V6CB 4AOFA 4MM3A 3PHWB 2FCSA 2O2VA 3WANA 3KVFB 1WY8A 2WX1A 4MSMB 2FIFA 2KANA 2LRWA 3QX1A 3A9KB 2KWUB 3ZTCA 3ALBA 4EZLA 1WMHA 1ZKHA 1E5WA 4FJVB 1IYFA 3RULA 4I6LB 4BKTA 2RPQA 3ZW3A 1EF1A 2KDBA 5EDSA 2KJHB 3N3KB 3CSTA 2MBQA 3NZUA 4AWJA 4B6WA 1RFAA 3VAWA 3ZNGC 4ANWA 1EO6A 1ZW7A 4HVBA 5L95C 4K1RB 4EUTA 4M8NA 2JUOA 3PLUA 4TUUA 5DPSA 5JHAA 5J18A 1AARA 2JXXA 2KDFB 3S2AA 4FULA 2I1JA 3KYCD 3WAPA 2FIDA 4NNJB 3PV1A 3KYDD 2LGXA 3QHTA 1GG3A 4IUMB 3OLMD 2IO2B 4W9GA 3ZDMC 3ZO5B 3DVNU 4ASWC 1UBQA 1WJUA 2KZRA 3H7PB 3PHXB 2MW5A 4HXDA 3T8MA 4B9KA 3ENEA 1UD7A 1E8ZA 3A4SC 2UWQA 2ZZPB 1FXTB 2XEWA 3DVNV 4EKUA 2GMIC 1RLFA 2MQJA 5DPRA 4GMVA 4JGHB 3WALA 4FHJA 1WGHA 2L7RA 2N7DA 2K39A 1WXMA 3I3TB 5CHVC 4MSQB 3EECA 2O6VA 3V6EB 1VD2A 2A4ZA 2GBJA 4AJYB 4IM3A 4XC2A 5DPTA 2N4FA 4GDLA 3QIJA 3ZLZA 4K7SA 5AZGA 1E8WA 3UIOB 5LXHA 1XQQA 4IWOA 4ZRJA 3VTVA 4W9DA 3ZRFA 4GGQA 1OEYA 3ZNHB 3DVGY 1WXAA 4FA6A 2L3ZA 5FR6A 3ZNZB 4ZDVA 2KMAA 3VTWA 1YQBA 5C23A 4FADA 2D2QA 2LGDA 3L13A 4TQ1A 3TCAA 3UQBA 3VUWA 2BKRB 3W1YA 2CKHB 2LXAA 4TQ0A 1OEYJ 4LCDE 2HE7A 2KKCA 1H8CA 3A33B 3VXWA 2DZKA 2AL3A 2KFJA 2ZVOA 3BINA 4NQKE 4WAAA 1OTRB 1GUAB 2BGFA 2CHWA 3MJWA 4DXAB 4MGZE 4MH0E 4HPLB 1IPGA 4WJPA 4FBJB 1D3ZA 2C7NB 1WZ3A 1SGHA 2GBKA 2D11A 2HD5B 2ZCCA 1RRBA 2MX2A 2NBUA 1WX8A 2NCNA 1XD3B 4FJZA 2Y5BB 4ANVA 3HM3A 1WJ6A 1WR6E 2R2QA 1V5OA 1P0RA 3ZKJC 4K81A 1V5TA 3A4RA 2WDTB 2KO3A 4ZRIA 4MGYE 1A5RA 1PQSA 2BYVE 1NDDA 1E8YA 2KDIA 2KHWB 2ZEQA 2DAFA 3PVLA 4GDLB 3VH3B 1YX6B 3HM6X 3IVFA 4IWQA 3PRZA 2JT4B 2JZ3B 4EZKA 3W1SA 1Y8RC 2XBBC 2DZJA 2WWZA 1MG8A 2YLMA 4KDIC 4GN1A 1GJZA 2ZVNA 1V80A 2KJRA 3UGBB 1WGRA 3PT2B 1BT0A 5JZEB 4HPMB 2LJ5A 2FCMA 5E6PA 3X23A 2CHXA 2KX3A 4PS7A 3PGEA 2BF8B 4E74A 4DWFA 3R7QA 3PSEB 3BY4B 3HIZA 2KLCA 4M8MA 4F1SA 4NAWA 3KW5B 3OJ3A 3V61A 2Z0EB 1KM7A 1P98A 2N9EB 1WH3A 3UF8A 3VTUA 3QWZB 4FLHA 5KHQA 3VQIA 2L00B 1F9JA 1WGGA 2KTRB 2KX0A 3KUDB 4FHKA 4BKGA 3KUCB 3VUXA 3NZSA 3QQ8B 2WX0A 4DHZE 3PREA 3TL5A 5IA7A 3CMMB 1C3TA 1R4MI 4BOZB 1E90A 4W9CA 3HHMA 3RZWC 4WWPA 3H7SA 2ZPNA 3KUZA 4NAWB 2LVQA 2MP2A 4K7WA 5D94A 4X57B 4TV3A 4AJWA 3AULA 4BOSC 2V4LA 1V6EA 3ZNID 4HCNB 2EMSA 2GOWA 3DBSA 5IAAC 4G11A 3B08A 3O65B 4BFRA 3APDA 3L08A 3DCGA 1WR1A 1YX5B 3B1LX 2KLGA 1Q0WB 1E7UA 2C5LC 5KHOA 2IYDB 2LRUA 2GBRA 2O6VB 2BYEA 1WMHB 5JH5C 4KZCA 3H6NA 3UQAA 2JY6A 2YVCA 4MELA 1ISNA 1LM8B 1VCBA 4ICVA 1P1AA 3JSVA 4K7UA 3ZUNA 2WYQA 3VH4B 3PS6A 2KFKB 1WE7A 2DENB 1X1MA 2K25A 3DPDA 1V86A 3WIMA 3C0RB 1KOTA 2GBMA 3TBLD 2M8SA 5CX3A 2CHZA 2J0JA 4NQLB 3VHTC 4DK5A 1EUVB 1WF9A 2PE9A 2MBBB 2JRHA 2IBIB 1K8RB 2XK5A 3AXCA 4E3CA 4ZYNA 2JZZA 5AZFA 4CO7A 2FNJB 4MDKE 3QARA 3WAMA 3U30A 4BVUC 3HK0A 3Q3FA 3U7DA 4GDKA 3CSFA 5DCNA 5LXIB 2AEHA 1SE9A 2CS4A 3IBEA 4F8CB 2O6VD 1WIAA 4W9HA 2C7MB 4GU2A 3ZRCA 3P2BA 3Q3JA 4NJ6A 4KV2A 4WJQA 3VUYA 3PTFC 3DBLI 4WJOA 4BBNF 1IP9A 2JWZA 4CYEA 4GB9A 4KIKB 4FN2A 4W9JA 4JQWC 1T0YA 2Z59B 4WWOA 2L8JA 2RSUA 2NVUI 2NPTA 2OJRA 2A5UA 1WGDA 2IZVB 1LXDA 4I6NB 2K8HA 2RGFA 2MWSB 3A9KA 5E6NA 1UZXB 4MJSB 2REXA 3DBHI 4LDTD 2BYFA 3DOWA 2K8BA 1Z5SB 1KJTA 4IW0A 1YJ1A 2J7QB 2K1FA 2OOBB 3D32A 5AEKB 2N9XA 2EKEC 3H7PA 2LASA 4HDQA 5D7GA 4A20A 1YD8U 2G3QB 4BKSD 3IHPC 4DBGA 2V3SA 2IY0B 3L10B 1Q1OA 3VDZA 4MGIE 3L16A 1UBIA 1G6JA 3TIXA 2NS5A 1WJ4A 4W9FA 3R66C 2O2VB 4RM8A 2NR2A 3SU8X 3U8ZA 5CTRC 1JRUA 3QA8A 2FCNA 1WI0A 2JRIB 2K6DB 2LVPA 3EC8A 4JLCA 3AI5A 1SIFA 2HJ8A 1YIWA 3LDZE 4LJOB 4ANXA 2AWTA 3DBRI 4KZ0A 2PPHA 4IC7B 2JF5A 5BO4B 1Z2MA 4IM2A 1WE6A 4N9F4 4NJ7A 2MSED 4M0WB 3ML8A 4URKA 2KQ7A 2L76A 4PS3A 3AU4A 1KLVA 2K6QA 2JPHA 2KN5A 2ZNVB 4PYZA 3RYTA 3IG3A 4GIVA 4G0NB 4HWIB 1V81A 2DAJA 4IWPA 1OQYA 4W9LA 2BKFA 2W9NA 3MHSD 4IM0A 4GXBA 4YL8A 5J17A 2KTRA 4EOYA 3QCAA 3V60A 2AYOB 2N9PC 4NPNA 4P7IA 3QJZA 4I6PA 5TR5A 2C9WB 3GZNI 3SHQA 4MJSA 1H4RA 3NS8A 3X0WA 3EHVA 3CF6E 3N32A 2D10A 5J2RA 5D6JB 1TBEA 2L0FA 1WJNA 2M17A 3JW0X 3JSVB 3H1UA 1CMXB 4KSLC 5CHWA 5AZHA 2BWES 2MCNB 3PZDA 4WQOB 2ZNVC 2J0MA 1UELA 3RT3B 2BPSA 2DYBA 2V1YA 3QC8B 5LLIA 4CHKA 2DYOA 2DZMA 2K8CA 1WM3A 3MTNB 3RD2A 1L2NA 4OVVA 4A3PA 2D3GA 2NBVB 2N7EA 2XK5B 2PEAA 2FUHB 1WYWB 3IFWB 3NY5A 2C60A 4ANUA 1LQBA 4FJYA 4DHJD 2FAZA 2B3AA 4II2B 2MLBA 4ZRKA 3GOEA 4GOCA 3APFA 3DQVA 4EFOA 2FCQA 1WX7A 3L54A 4OVUA 3M63B 2VRRB 2G45B 4DHJB 2N1VA 3RCZA 3SD5A 1P3QU 4HK2A 2L05A 2MBHA 1GC6A 3WA0A 1TTNA 4B95A 1WGYA 2HTHA 2KWCA 2LVOA 3NHEB 2MBOA 2KJ6A 2JVCA 2KDEB 1Q5WB 3PPAA 3PRPB 2LUEA 4G50A 1WM2A 2KQSA 4KIKA 4W9EA 3VVWB 1V2YA 1TZ1A 1GC7A 3JYUA 4NY0A 2G4DB 1V9JA 2IY1B 2KC2A 4EZJA 3A9JB 3PLVA 4WWNA 2KC1A 3DVGX 4II3B 2N1WA 3WAOA 1U4AA 2D07B 3ZTDA 3UINB 4GDKB 2L0TA 3A1QA 1XT9B 1UH6A 4HDOA 2MBEA 2DX5B 2KXJA 4XX5A 1NI2A 2IO0B 1J8CA 1E7VA 2MA9B 2PE6B 2R2OA 1EF5A 4LJPB 4W9IA 2DYMA 4JL9A 4G3XB 4LDTB 1P9DU 3QK0A 4GSWA 4PYUA 1E8XA 3AU5A 3ECIA 2G4SA 1V49A 3ML9A 2KOXA 4WJNA 1UGMA 4DDID 4JIOU 4XZ4A 2RD0A 3TJPA 4J6IA 2I1KA 3M95A 2IO3B 4HJKA 5DPWA 4IG7B 4AP4C 2KFKA 5HKHA 2BWFA 5G55A 2J0KA 3EFUA 3TMPB 2KD0A 1WXSA 2MP2B 5D2MB 1WXVA 2LD9A 2M1MA 3SDLC 4HLEA 3ZVVA 5E6OA 2NBWB 4A3OA 2KVRA 1WX9A 1TGZB 4EEWA 2C7HA 4AUQC 3B0AA 3PRMB 5G2NA 3RUIB 2AL6A 2KWVB 4RM9A 3ZDTA 1I35A 2EMTA 1S1QB 2KNBA 3K9OB 2PJHA 5GMVA 1WFYA 3L17A 3A1QB 1C1YB 4ICUA 2M0XA 2Z0DB 4MGKE 3V62A 3T9LA 4PS8A 3N30A 2KMCA 4KVGB 2RR9A 1NBFC 1J0GA 3L0WB 1RAXA 3QAQA 5JHBA 3M3JA 3OJ4B 2MRPA 3RZFA 3OAWA 1LFDA 3A9JA 4KDLB 1WZ0A 3M62B 3APCA 4DHZB 4BKSA 3NOBA 2ASQA 1S3SG 3VFKA 3DDCB 2LXCA 1M94A 1I42A 2M4NA 3R3MA 2GBNA 4RMAA 5CHFA 1J19A 3K9PB 2IO1B 1GNUA 1R4NI 2DHZA 2QHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP B;  3KH0 A;  3JVZ X;  2CR5 A;  2CU1 A;  4W9K A;  2LZ6 A;  5L83 A;  4E71 A;  2UYZ B;  1HE8 A;  1WRD B;  4HCP B;  5C1Z A;  3LJ3 A;  2LWP A;  2NPT B;  2LGY A;  1ZGU B;  3W1S C;  3ZIM A;  2ZJD A;  2ZCB A;  3H9D A;  2DZI A;  3R7R A;  4F7Z A;  4MEM A;  4DDG D;  4KSK C;  3ONS A;  4TKN A;  2LI5 A;  1OGW A;  2ZPY A;  4BBN C;  1QZE A;  1L7Y A;  2KK8 A;  2KTF A;  3V6C B;  4AOF A;  4MM3 A;  3PHW B;  2FCS A;  2O2V A;  3WAN A;  3KVF B;  1WY8 A;  2WX1 A;  4MSM B;  2FIF A;  2KAN A;  2LRW A;  3QX1 A;  3A9K B;  2KWU B;  3ZTC A;  3ALB A;  4EZL A;  1WMH A;  1ZKH A;  1E5W A;  4FJV B;  1IYF A;  3RUL A;  4I6L B;  4BKT A;  2RPQ A;  3ZW3 A;  1EF1 A;  2KDB A;  5EDS A;  2KJH B;  3N3K B;  3CST A;  2MBQ A;  3NZU A;  4AWJ A;  4B6W A;  1RFA A;  3VAW A;  3ZNG C;  4ANW A;  1EO6 A;  1ZW7 A;  4HVB A;  5L95 C;  4K1R B;  4EUT A;  4M8N A;  2JUO A;  3PLU A;  4TUU A;  5DPS A;  5JHA A;  5J18 A;  1AAR A;  2JXX A;  2KDF B;  3S2A A;  4FUL A;  2I1J A;  3KYC D;  3WAP A;  2FID A;  4NNJ B;  3PV1 A;  3KYD D;  2LGX A;  3QHT A;  1GG3 A;  4IUM B;  3OLM D;  2IO2 B;  4W9G A;  3ZDM C;  3ZO5 B;  3DVN U;  4ASW C;  1UBQ A;  1WJU A;  2KZR A;  3H7P B;  3PHX B;  2MW5 A;  4HXD A;  3T8M A;  4B9K A;  3ENE A;  1UD7 A;  1E8Z A;  3A4S C;  2UWQ A;  2ZZP B;  1FXT B;  2XEW A;  3DVN V;  4EKU A;  2GMI C;  1RLF A;  2MQJ A;  5DPR A;  4GMV A;  4JGH B;  3WAL A;  4FHJ A;  1WGH A;  2L7R A;  2N7D A;  2K39 A;  1WXM A;  3I3T B;  5CHV C;  4MSQ B;  3EEC A;  2O6V A;  3V6E B;  1VD2 A;  2A4Z A;  2GBJ A;  4AJY B;  4IM3 A;  4XC2 A;  5DPT A;  2N4F A;  4GDL A;  3QIJ A;  3ZLZ A;  4K7S A;  5AZG A;  1E8W A;  3UIO B;  5LXH A;  1XQQ A;  4IWO A;  4ZRJ A;  3VTV A;  4W9D A;  3ZRF A;  4GGQ A;  1OEY A;  3ZNH B;  3DVG Y;  1WXA A;  4FA6 A;  2L3Z A;  5FR6 A;  3ZNZ B;  4ZDV A;  2KMA A;  3VTW A;  1YQB A;  5C23 A;  4FAD A;  2D2Q A;  2LGD A;  3L13 A;  4TQ1 A;  3TCA A;  3UQB A;  3VUW A;  2BKR B;  3W1Y A;  2CKH B;  2LXA A;  4TQ0 A;  1OEY J;  4LCD E;  2HE7 A;  2KKC A;  1H8C A;  3A33 B;  3VXW A;  2DZK A;  2AL3 A;  2KFJ A;  2ZVO A;  3BIN A;  4NQK E;  4WAA A;  1OTR B;  1GUA B;  2BGF A;  2CHW A;  3MJW A;  4DXA B;  4MGZ E;  4MH0 E;  4HPL B;  1IPG A;  4WJP A;  4FBJ B;  1D3Z A;  2C7N B;  1WZ3 A;  1SGH A;  2GBK A;  2D11 A;  2HD5 B;  2ZCC A;  1RRB A;  2MX2 A;  2NBU A;  1WX8 A;  2NCN A;  1XD3 B;  4FJZ A;  2Y5B B;  4ANV A;  3HM3 A;  1WJ6 A;  1WR6 E;  2R2Q A;  1V5O A;  1P0R A;  3ZKJ C;  4K81 A;  1V5T A;  3A4R A;  2WDT B;  2KO3 A;  4ZRI A;  4MGY E;  1A5R A;  1PQS A;  2BYV E;  1NDD A;  1E8Y A;  2KDI A;  2KHW B;  2ZEQ A;  2DAF A;  3PVL A;  4GDL B;  3VH3 B;  1YX6 B;  3HM6 X;  3IVF A;  4IWQ A;  3PRZ A;  2JT4 B;  2JZ3 B;  4EZK A;  3W1S A;  1Y8R C;  2XBB C;  2DZJ A;  2WWZ A;  1MG8 A;  2YLM A;  4KDI C;  4GN1 A;  1GJZ A;  2ZVN A;  1V80 A;  2KJR A;  3UGB B;  1WGR A;  3PT2 B;  1BT0 A;  5JZE B;  4HPM B;  2LJ5 A;  2FCM A;  5E6P A;  3X23 A;  2CHX A;  2KX3 A;  4PS7 A;  3PGE A;  2BF8 B;  4E74 A;  4DWF A;  3R7Q A;  3PSE B;  3BY4 B;  3HIZ A;  2KLC A;  4M8M A;  4F1S A;  4NAW A;  3KW5 B;  3OJ3 A;  3V61 A;  2Z0E B;  1KM7 A;  1P98 A;  2N9E B;  1WH3 A;  3UF8 A;  3VTU A;  3QWZ B;  4FLH A;  5KHQ A;  3VQI A;  2L00 B;  1F9J A;  1WGG A;  2KTR B;  2KX0 A;  3KUD B;  4FHK A;  4BKG A;  3KUC B;  3VUX A;  3NZS A;  3QQ8 B;  2WX0 A;  4DHZ E;  3PRE A;  3TL5 A;  5IA7 A;  3CMM B;  1C3T A;  1R4M I;  4BOZ B;  1E90 A;  4W9C A;  3HHM A;  3RZW C;  4WWP A;  3H7S A;  2ZPN A;  3KUZ A;  4NAW B;  2LVQ A;  2MP2 A;  4K7W A;  5D94 A;  4X57 B;  4TV3 A;  4AJW A;  3AUL A;  4BOS C;  2V4L A;  1V6E A;  3ZNI D;  4HCN B;  2EMS A;  2GOW A;  3DBS A;  5IAA C;  4G11 A;  3B08 A;  3O65 B;  4BFR A;  3APD A;  3L08 A;  3DCG A;  1WR1 A;  1YX5 B;  3B1L X;  2KLG A;  1Q0W B;  1E7U A;  2C5L C;  5KHO A;  2IYD B;  2LRU A;  2GBR A;  2O6V B;  2BYE A;  1WMH B;  5JH5 C;  4KZC A;  3H6N A;  3UQA A;  2JY6 A;  2YVC A;  4MEL A;  1ISN A;  1LM8 B;  1VCB A;  4ICV A;  1P1A A;  3JSV A;  4K7U A;  3ZUN A;  2WYQ A;  3VH4 B;  3PS6 A;  2KFK B;  1WE7 A;  2DEN B;  1X1M A;  2K25 A;  3DPD A;  1V86 A;  3WIM A;  3C0R B;  1KOT A;  2GBM A;  3TBL D;  2M8S A;  5CX3 A;  2CHZ A;  2J0J A;  4NQL B;  3VHT C;  4DK5 A;  1EUV B;  1WF9 A;  2PE9 A;  2MBB B;  2JRH A;  2IBI B;  1K8R B;  2XK5 A;  3AXC A;  4E3C A;  4ZYN A;  2JZZ A;  5AZF A;  4CO7 A;  2FNJ B;  4MDK E;  3QAR A;  3WAM A;  3U30 A;  4BVU C;  3HK0 A;  3Q3F A;  3U7D A;  4GDK A;  3CSF A;  5DCN A;  5LXI B;  2AEH A;  1SE9 A;  2CS4 A;  3IBE A;  4F8C B;  2O6V D;  1WIA A;  4W9H A;  2C7M B;  4GU2 A;  3ZRC A;  3P2B A;  3Q3J A;  4NJ6 A;  4KV2 A;  4WJQ A;  3VUY A;  3PTF C;  3DBL I;  4WJO A;  4BBN F;  1IP9 A;  2JWZ A;  4CYE A;  4GB9 A;  4KIK B;  4FN2 A;  4W9J A;  4JQW C;  1T0Y A;  2Z59 B;  4WWO A;  2L8J A;  2RSU A;  2NVU I;  2NPT A;  2OJR A;  2A5U A;  1WGD A;  2IZV B;  1LXD A;  4I6N B;  2K8H A;  2RGF A;  2MWS B;  3A9K A;  5E6N A;  1UZX B;  4MJS B;  2REX A;  3DBH I;  4LDT D;  2BYF A;  3DOW A;  2K8B A;  1Z5S B;  1KJT A;  4IW0 A;  1YJ1 A;  2J7Q B;  2K1F A;  2OOB B;  3D32 A;  5AEK B;  2N9X A;  2EKE C;  3H7P A;  2LAS A;  4HDQ A;  5D7G A;  4A20 A;  1YD8 U;  2G3Q B;  4BKS D;  3IHP C;  4DBG A;  2V3S A;  2IY0 B;  3L10 B;  1Q1O A;  3VDZ A;  4MGI E;  3L16 A;  1UBI A;  1G6J A;  3TIX A;  2NS5 A;  1WJ4 A;  4W9F A;  3R66 C;  2O2V B;  4RM8 A;  2NR2 A;  3SU8 X;  3U8Z A;  5CTR C;  1JRU A;  3QA8 A;  2FCN A;  1WI0 A;  2JRI B;  2K6D B;  2LVP A;  3EC8 A;  4JLC A;  3AI5 A;  1SIF A;  2HJ8 A;  1YIW A;  3LDZ E;  4LJO B;  4ANX A;  2AWT A;  3DBR I;  4KZ0 A;  2PPH A;  4IC7 B;  2JF5 A;  5BO4 B;  1Z2M A;  4IM2 A;  1WE6 A;  4N9F 4;  4NJ7 A;  2MSE D;  4M0W B;  3ML8 A;  4URK A;  2KQ7 A;  2L76 A;  4PS3 A;  3AU4 A;  1KLV A;  2K6Q A;  2JPH A;  2KN5 A;  2ZNV B;  4PYZ A;  3RYT A;  3IG3 A;  4GIV A;  4G0N B;  4HWI B;  1V81 A;  2DAJ A;  4IWP A;  1OQY A;  4W9L A;  2BKF A;  2W9N A;  3MHS D;  4IM0 A;  4GXB A;  4YL8 A;  5J17 A;  2KTR A;  4EOY A;  3QCA A;  3V60 A;  2AYO B;  2N9P C;  4NPN A;  4P7I A;  3QJZ A;  4I6P A;  5TR5 A;  2C9W B;  3GZN I;  3SHQ A;  4MJS A;  1H4R A;  3NS8 A;  3X0W A;  3EHV A;  3CF6 E;  3N32 A;  2D10 A;  5J2R A;  5D6J B;  1TBE A;  2L0F A;  1WJN A;  2M17 A;  3JW0 X;  3JSV B;  3H1U A;  1CMX B;  4KSL C;  5CHW A;  5AZH A;  2BWE S;  2MCN B;  3PZD A;  4WQO B;  2ZNV C;  2J0M A;  1UEL A;  3RT3 B;  2BPS A;  2DYB A;  2V1Y A;  3QC8 B;  5LLI A;  4CHK A;  2DYO A;  2DZM A;  2K8C A;  1WM3 A;  3MTN B;  3RD2 A;  1L2N A;  4OVV A;  4A3P A;  2D3G A;  2NBV B;  2N7E A;  2XK5 B;  2PEA A;  2FUH B;  1WYW B;  3IFW B;  3NY5 A;  2C60 A;  4ANU A;  1LQB A;  4FJY A;  4DHJ D;  2FAZ A;  2B3A A;  4II2 B;  2MLB A;  4ZRK A;  3GOE A;  4GOC A;  3APF A;  3DQV A;  4EFO A;  2FCQ A;  1WX7 A;  3L54 A;  4OVU A;  3M63 B;  2VRR B;  2G45 B;  4DHJ B;  2N1V A;  3RCZ A;  3SD5 A;  1P3Q U;  4HK2 A;  2L05 A;  2MBH A;  1GC6 A;  3WA0 A;  1TTN A;  4B95 A;  1WGY A;  2HTH A;  2KWC A;  2LVO A;  3NHE B;  2MBO A;  2KJ6 A;  2JVC A;  2KDE B;  1Q5W B;  3PPA A;  3PRP B;  2LUE A;  4G50 A;  1WM2 A;  2KQS A;  4KIK A;  4W9E A;  3VVW B;  1V2Y A;  1TZ1 A;  1GC7 A;  3JYU A;  4NY0 A;  2G4D B;  1V9J A;  2IY1 B;  2KC2 A;  4EZJ A;  3A9J B;  3PLV A;  4WWN A;  2KC1 A;  3DVG X;  4II3 B;  2N1W A;  3WAO A;  1U4A A;  2D07 B;  3ZTD A;  3UIN B;  4GDK B;  2L0T A;  3A1Q A;  1XT9 B;  1UH6 A;  4HDO A;  2MBE A;  2DX5 B;  2KXJ A;  4XX5 A;  1NI2 A;  2IO0 B;  1J8C A;  1E7V A;  2MA9 B;  2PE6 B;  2R2O A;  1EF5 A;  4LJP B;  4W9I A;  2DYM A;  4JL9 A;  4G3X B;  4LDT B;  1P9D U;  3QK0 A;  4GSW A;  4PYU A;  1E8X A;  3AU5 A;  3ECI A;  2G4S A;  1V49 A;  3ML9 A;  2KOX A;  4WJN A;  1UGM A;  4DDI D;  4JIO U;  4XZ4 A;  2RD0 A;  3TJP A;  4J6I A;  2I1K A;  3M95 A;  2IO3 B;  4HJK A;  5DPW A;  4IG7 B;  4AP4 C;  2KFK A;  5HKH A;  2BWF A;  5G55 A;  2J0K A;  3EFU A;  3TMP B;  2KD0 A;  1WXS A;  2MP2 B;  5D2M B;  1WXV A;  2LD9 A;  2M1M A;  3SDL C;  4HLE A;  3ZVV A;  5E6O A;  2NBW B;  4A3O A;  2KVR A;  1WX9 A;  1TGZ B;  4EEW A;  2C7H A;  4AUQ C;  3B0A A;  3PRM B;  5G2N A;  3RUI B;  2AL6 A;  2KWV B;  4RM9 A;  3ZDT A;  1I35 A;  2EMT A;  1S1Q B;  2KNB A;  3K9O B;  2PJH A;  5GMV A;  1WFY A;  3L17 A;  3A1Q B;  1C1Y B;  4ICU A;  2M0X A;  2Z0D B;  4MGK E;  3V62 A;  3T9L A;  4PS8 A;  3N30 A;  2KMC A;  4KVG B;  2RR9 A;  1NBF C;  1J0G A;  3L0W B;  1RAX A;  3QAQ A;  5JHB A;  3M3J A;  3OJ4 B;  2MRP A;  3RZF A;  3OAW A;  1LFD A;  3A9J A;  4KDL B;  1WZ0 A;  3M62 B;  3APC A;  4DHZ B;  4BKS A;  3NOB A;  2ASQ A;  1S3S G;  3VFK A;  3DDC B;  2LXC A;  1M94 A;  1I42 A;  2M4N A;  3R3M A;  2GBN A;  4RMA A;  5CHF A;  1J19 A;  3K9P B;  2IO1 B;  1GNU A;  1R4N I;  2DHZ A;  2QHO A; 
#chains in the Genus database with same CATH topology
 3UIP B;  4E71 A;  4S0R A;  2I38 A;  2NPT B;  5IO9 A;  2BB6 A;  2TSS A;  4F7Z A;  3Q8C A;  4JE3 B;  2KK8 A;  1VLB A;  1T5X D;  2XN9 C;  1JWU D;  3PHW B;  1IYF A;  3RUL A;  4BKT A;  3ZW3 A;  3NZU A;  1RFA A;  3ZNG C;  1ZW7 A;  4HVB A;  4M8N A;  3FC4 A;  2GRI A;  5DPS A;  1XCQ L;  2INP E;  2KDF B;  4FUL A;  2I1J A;  3PV1 A;  3KYD D;  3QHT A;  3Q3M C;  3OLM D;  2IO2 B;  5HI1 A;  4OZA A;  3DVN U;  1WJU A;  1M4V A;  2KZR A;  1ET9 A;  3ENE A;  1UD7 A;  1I4Q A;  2KN4 A;  3A4S C;  3CWI A;  5BYR A;  1JQ4 A;  3AM9 A;  2N7D A;  1SF0 A;  2K39 A;  2KQ4 X;  3V6E B;  4ZHP A;  3UIO B;  4YTP B;  3BYT B;  3OG5 A;  4ZRJ A;  4W9D A;  4XWT A;  1NYQ A;  1UNS A;  1ZXH A;  3DVG Y;  5FR6 A;  3ZNZ B;  3BK1 A;  1YQB A;  3RNF C;  4FAD A;  2K5P A;  2QEJ C;  3W1Y A;  2CKH B;  2LXA A;  4TQ0 A;  1FFV A;  1MHX A;  2WU2 B;  2DZK A;  2AX5 A;  3AEA B;  2KFJ A;  1L0Y B;  3BIN A;  4L1B A;  1GUA B;  5C3J B;  3NS1 A;  5IOI A;  2C7N B;  4YSZ B;  2D11 A;  2JQR B;  2PLP A;  3U2S C;  2MX2 A;  2NBU A;  1WXQ A;  1WX8 A;  1QKZ A;  3IXS A;  2LGI A;  1VRA B;  5IKC M;  4YWG G;  1DGJ A;  2KO3 A;  1PQS A;  3RI7 C;  1E8Y A;  1NVI D;  2ZEQ A;  2ZW1 A;  2N9L A;  1YX6 B;  3IVF A;  3PRZ A;  4YT0 B;  2EEL A;  1YN4 A;  3ZGZ A;  2XBB C;  2DLB A;  5EE9 A;  4D2K A;  1ZDV A;  4GN1 A;  4KDI C;  2KJR A;  1V1P A;  3R8B A;  2IDY A;  1C4P A;  2BF8 B;  4DWF A;  1GOZ A;  3BY4 B;  3TEX A;  3OJ3 A;  2Z0E B;  3ZXV A;  1KM7 A;  1WH3 A;  3UF8 A;  3VTU A;  4FLH A;  1F9J A;  1DOI A;  1TZO A;  4FHK A;  3Q3O C;  4BKG A;  1WYG A;  2WDR B;  3NZS A;  3QQ8 B;  1EU3 A;  5IA7 A;  1C3T A;  2WXR A;  1SJE D;  3Q14 C;  2IND C;  2JYE A;  4NAW B;  4BOS C;  4LLG M;  1VZ6 A;  2GOW A;  1KH0 A;  2MHJ A;  3R2T A;  1E7P B;  1HQR D;  1JWS D;  5KHO A;  1IBX A;  4KGR A;  3VRA B;  2KDM A;  3UQA A;  2MH7 A;  2YVC A;  1UGJ A;  4MEL A;  1ISN A;  1RFK A;  4K7U A;  3ZUN A;  3VH4 B;  1WE7 A;  2DEN B;  2PTL A;  5CX3 A;  4NQL B;  4C80 A;  1WRI A;  1K8R B;  1PDX A;  5HHD G;  4MDK E;  3QAR A;  3WAM A;  4BVU C;  2V3P A;  3Q3F A;  3U7D A;  3CSF A;  1QF6 A;  2Q5W D;  4W9H A;  2YEP F;  4KV2 A;  4WJQ A;  3PTF C;  3DBL I;  4CYE A;  1UUP A;  1QQR A;  4W9J A;  2FBW B;  2RGF A;  2MWS B;  3DBH I;  2BYF A;  3DOW A;  3RNC C;  4GLS C;  3DBL B;  2WQY B;  3H7P A;  2LAS A;  3BII D;  2IY0 B;  5E6J A;  3NZ3 A;  1UBI A;  3RFZ B;  4KGT A;  4J3O D;  4RM8 A;  3J9C A;  2BS3 B;  3U8Z A;  1C79 A;  4JLC A;  3EC8 A;  1D4B A;  1SIF A;  2HJ8 A;  3LB8 C;  1YIW A;  4LJO B;  1KFY B;  3Q8A A;  5H8Y E;  3DBR I;  4IC7 B;  5T8I A;  4IM2 A;  1WE6 A;  4M0W B;  5G5G A;  4URK A;  1TY0 A;  2L76 A;  1ESF A;  2ZNV B;  3RYT A;  4HWI B;  2DAJ A;  4IWP A;  2V4I B;  2LGS A;  4WIP A;  3AEF B;  3QCA A;  2N9P C;  1CJE A;  2MJ3 A;  1H4R A;  2K9X A;  1P7E A;  3MP9 A;  1ZUD 2;  2L0F A;  3H1U A;  1CMX B;  5CHW A;  3AE2 B;  5AZH A;  3BZD B;  4M00 A;  3PZD A;  4WQO B;  1TS4 A;  4C4V A;  2BPS A;  2DYB A;  1JML A;  3GE3 C;  2DYO A;  2K8C A;  3FAH A;  4FXC A;  2V3N A;  3TUO A;  1HEZ E;  2N7E A;  3IFW B;  2JZP A;  3AE8 B;  2B3A A;  3DQV A;  1OFF A;  3L54 A;  2WXP A;  2G45 B;  4HK2 A;  1QOF A;  4K3B A;  1T0R C;  1P7F A;  1WGY A;  2KWC A;  3PRP B;  2MBO A;  2IGD A;  3PPA A;  2KQS A;  4W9E A;  1V2Y A;  1TZ1 A;  1JRP A;  3IT4 B;  2IY1 B;  4EZJ A;  4P16 A;  2KC1 A;  3SR6 A;  3B2G A;  3ZTD A;  1UF0 A;  1XT9 B;  2KXJ A;  2LJI A;  2JXT A;  1XLQ A;  2R2O A;  1ET6 A;  1P9D U;  1EWC A;  1V49 A;  2RD0 A;  2WXK A;  4AP4 C;  4WQM A;  2KFK A;  1N5X A;  4A8X C;  3ZVV A;  4A3O A;  4JPS A;  1WX9 A;  4EEW A;  4AUQ C;  1JRO A;  1SB3 C;  2KNB A;  3K9O B;  5GMV A;  1NEN B;  3A1Q B;  3P4S B;  4ICU A;  1YOV B;  3V62 A;  3N30 A;  2RR9 A;  1L0V B;  1QIL A;  3L0W B;  1RAX A;  4EE2 A;  5HFY A;  1PYW D;  3M3J A;  3U4E G;  1K51 A;  3BVM A;  2WDQ B;  4JWU C;  3NOB A;  3VFK A;  1I4H A;  1M94 A;  4IDI A;  2X8X X;  4ZYS A;  2RMM A;  4RFB A;  2KYW A;  2IPK D;  1J19 A;  4KGS A;  2IO1 B;  1E9M A;  2QHO A;  3P4R B;  4W9K A;  2LZ6 A;  2AQ2 B;  1FPY A;  1HE8 A;  1WRD B;  3LJ3 A;  2LWP A;  2JSV X;  2HTM E;  3W1S C;  3H9D A;  1RYJ A;  2ZCB A;  4RGN A;  4A90 A;  4MEM A;  4DDG D;  1N62 A;  2GI9 A;  4KSK C;  3ONS A;  4TKN A;  2LI5 A;  1OGW A;  2ZPY A;  1N61 A;  1PGA A;  3KVF B;  1WY8 A;  2FIF A;  2KAN A;  3QX1 A;  3ZTC A;  2BW2 A;  3AE6 B;  1WMH A;  1ZKH A;  4FJV B;  2Y5C A;  1B9R A;  3VAW A;  1ZXI A;  2DBY A;  4EUT A;  1AN8 A;  3PLU A;  1F52 A;  4HKZ E;  4NNJ B;  4FA6 A;  2LGX A;  1GG3 A;  3ZDM C;  3H7P B;  3T8M A;  1FXT B;  2XEW A;  4EKU A;  1RLF A;  3I57 A;  2MQJ A;  4S17 A;  3WAL A;  1WGH A;  3DHG C;  1WXM A;  5CHV C;  3ZNI D;  3EEC A;  4AJY B;  3W2D A;  2GBJ A;  4K3C A;  4IM3 A;  2N4F A;  4K7S A;  4US9 A;  1RWS A;  1AWD A;  1WSP A;  1XQQ A;  3ZRF A;  3ZNH B;  1OEY A;  3VTW A;  2AQ3 B;  2D2Q A;  4TQ1 A;  1CK1 A;  1R4N B;  2RPV A;  1OEY J;  3ZQ4 A;  2KKC A;  5BYS A;  3VXW A;  2AL3 A;  4R3D A;  3LYY A;  4DXA B;  3GZN B;  3NVZ A;  4MGZ E;  3TSS A;  1IPG A;  4WJP A;  4M01 A;  2WXN A;  1WZ3 A;  3P4P B;  1VR9 A;  1SGH A;  3Q6B A;  1RRB A;  2NCN A;  1XD3 B;  4ANV A;  1WJ6 A;  1WR6 E;  2J53 A;  1NYR A;  2R2Q A;  2G1E A;  1V5O A;  1P0R A;  4OHJ A;  2L83 A;  3AE3 B;  2Z8L A;  2RDB C;  1A5R A;  4MGY E;  4Q2J A;  4C00 A;  2QC8 A;  3HM6 X;  5TSS A;  4LTU A;  2DZJ A;  1MG8 A;  1VJK A;  1GJZ A;  1KF6 B;  1V80 A;  4LNN A;  3MC0 B;  3UGB B;  2LJ5 A;  1QOB A;  3HIZ A;  2E6X A;  3KW5 B;  3V61 A;  1IBX B;  2KMM A;  1QOG A;  3PO0 A;  1D5Z C;  5KHQ A;  3VQI A;  2L00 B;  1WGG A;  2KTR B;  2PVO D;  1JWB D;  3NJT A;  3DBH B;  2ONQ A;  3Q8E A;  4L23 A;  4DHZ E;  3CMM B;  1R4M I;  1JWM D;  3HHM A;  3RZW C;  2ZPN A;  2M19 A;  3ZIM A;  2MP2 A;  4X57 B;  3AMZ A;  3IAS 1;  4HCN B;  5I4D A;  3DBS A;  3O65 B;  3L08 A;  4P1B C;  1WR1 A;  1YX5 B;  3AEG B;  1K53 A;  2KLG A;  1Q0W B;  1EM7 A;  1XO3 A;  2GBR A;  1KTK A;  2O6V B;  1MPE A;  5JH5 C;  2WLB A;  3H6N A;  1B1Z A;  2LHE A;  1CZP A;  1E6E B;  1VCB A;  1LM8 B;  3DHH C;  4ICV A;  2QCZ A;  3DPD A;  3WIM A;  3E9S A;  3C0R B;  2M8S A;  3P1M A;  2CHZ A;  3VHT C;  1WF9 A;  2CU3 A;  2JRH A;  2IBI B;  2XK5 A;  2WXO A;  4IOI E;  4ZYN A;  4KX6 B;  5AZF A;  1I4P A;  5JXV A;  1SE4 A;  4GDK A;  5DCN A;  1KLG D;  1HZ5 A;  3ZXR A;  5LXI B;  3FIL A;  2CS4 A;  4F8C B;  2O6V D;  1WIA A;  2CJN A;  3VUY A;  1IP9 A;  4WJO A;  4BBN F;  2JWZ A;  4KIK B;  4FN2 A;  1L0X B;  4JQW C;  1T0Y A;  2Z59 B;  2NVU I;  1ZP0 B;  1PUT A;  2A5U A;  4AQ7 A;  1WGD A;  3B9J A;  5E6N A;  4MJS B;  4LDT D;  3MJ5 A;  2K8B A;  1Z5S B;  1KJT A;  2J7Q B;  2PKO A;  4ITK A;  4LNO A;  5AEK B;  4ZOH C;  2EKE C;  4BKS D;  1YD8 U;  2G3Q B;  1SSN A;  2OHF A;  3L10 B;  1Q1O A;  4MGI E;  1KRH A;  4HPP A;  1G6J A;  4W9F A;  5D3D A;  3SU8 X;  5CTR C;  4YXD B;  2LVP A;  1F1H A;  3LDZ E;  4TSS A;  3EA6 A;  3HVD A;  3ABV B;  3P42 A;  5BO4 B;  3BYY B;  4DQO C;  1KLV A;  5HG2 A;  4PYZ A;  1PGX A;  1FD6 A;  3IG3 A;  4GIV A;  4N59 A;  1V81 A;  1L5P A;  2V0G A;  1ROE A;  3MHS D;  4RGM A;  4IM0 A;  4A9A A;  1YNT E;  3Q8B A;  5J17 A;  4EOY A;  1TS5 A;  2LEK A;  2LFI A;  2WXM A;  1WJN A;  2BVC A;  2BWE S;  1A70 A;  3N1Z C;  2K22 A;  1UEL A;  2WXQ A;  4NAM A;  1QT9 A;  1QLB B;  2DZM A;  1WM3 A;  4OZB A;  4OVV A;  3MHZ A;  2NBV B;  2PEA A;  2D3B A;  2C60 A;  3AH7 A;  4ANU A;  1L6V A;  2W82 A;  4FJY A;  5IN7 A;  1LO5 D;  3V3X A;  4GOC A;  3APF A;  4EFO A;  1WX7 A;  1FRR A;  1T0S C;  2G9H D;  3M63 B;  3AV8 A;  3SD5 A;  3VR8 B;  4ACF A;  3WA0 A;  4B95 A;  2HTH A;  2WP9 B;  3NHE B;  2KJ6 A;  2OJW A;  1V1P B;  4MAC A;  3VVW B;  3WCQ A;  5IP4 D;  3JYU A;  2KVZ A;  4NY0 A;  4II3 B;  3DVG X;  1GPX A;  3UIN B;  4GDK B;  3MC8 A;  3A1Q A;  4HDO A;  2MBE A;  3W5V B;  2BYT A;  1SE2 A;  2IO0 B;  3KLS X;  1E7V A;  1FIQ A;  1EF5 A;  2DYM A;  4JL9 A;  4LDT B;  4PYU A;  1E8X A;  3AU5 A;  2KOX A;  1UGM A;  4JIO U;  4AS1 A;  2I1K A;  1HTQ A;  5DPW A;  1R7S A;  3C8Y A;  1MG4 A;  3P4Q B;  3Q2A C;  4O1N A;  1YJJ A;  2J0K A;  3EFU A;  2KD0 A;  2MP2 B;  2M1M A;  2NBW B;  2C7H A;  3B0A A;  5G2N A;  2JX5 A;  2UU7 A;  2AL6 A;  3ZDT A;  1I35 A;  2EMT A;  4L2Y A;  3TEW A;  3URY A;  3N9Y C;  1C1Y B;  2B76 B;  4MGK E;  1GB4 A;  1YQ4 B;  4KVG B;  1J0G A;  3IAM 1;  2WXI A;  2MRP A;  4OVZ A;  1GAQ B;  3A9J A;  2IJ0 A;  3E56 A;  4DHZ B;  4BKS A;  1ZPS A;  3NVW A;  1GNU A;  1R4N I;  3KH0 A;  3JVZ X;  2CR5 A;  5L83 A;  2UYZ B;  3N1Y C;  5C1Z A;  4WAF A;  2ZJD A;  4ZHO A;  4PT5 A;  3KQ4 A;  3AE5 B;  4C4V B;  3AE1 B;  4BBN C;  1QZE A;  1RM6 C;  3V6C B;  4AOF A;  4MM3 A;  2FCS A;  2PVG C;  2O2V A;  1F77 A;  5FK9 C;  3WAN A;  2WX1 A;  4MSM B;  2LRW A;  1DOX A;  3AEB B;  1E5W A;  2RPQ A;  1EF1 A;  2H89 B;  2WXG A;  3N3K B;  3CST A;  2MBQ A;  3RNA C;  4AWJ A;  4B6W A;  5L95 C;  1DOY A;  2MJE A;  1SE3 A;  1SEB D;  1AAR A;  2PW9 A;  3KYC D;  2FID A;  4W9G A;  4N58 A;  4ASW C;  4B9K A;  3PHX B;  4HXD A;  1E8Z A;  2UWQ A;  3DVN V;  2JWU A;  1T6B X;  4GMV A;  4JGH B;  2ZW0 A;  4FHJ A;  2L7R A;  2O6V A;  1VD2 A;  1IGC A;  4XC2 A;  4GDL A;  2Y3A A;  5AZG A;  2RDH A;  2BT6 A;  5LXH A;  3VTV A;  4GGQ A;  4ZDV A;  1WXA A;  2L3Z A;  2KMA A;  1MFW A;  5C23 A;  3L13 A;  2BKR B;  1TY2 A;  3TEY A;  3PZ8 A;  4LCD E;  1D5X C;  3RNE C;  3A33 B;  1VZ7 A;  1K52 A;  5FKA C;  4NQK E;  4LNF A;  2BGF A;  2CHW A;  3MJW A;  4MH0 E;  3AEC B;  4FBJ B;  1C78 A;  1HTO A;  2GBK A;  2WXJ A;  2ZCC A;  4PK1 A;  4FJZ A;  5AUI A;  1BXT A;  1V5T A;  3A4R A;  4XDC A;  4OW0 A;  4ZRI A;  2I2Y A;  1NDD A;  2KDI A;  2KHW B;  3AN1 A;  4GDL B;  3VH3 B;  4IWQ A;  2JZ3 B;  4EZK A;  3W1S A;  1EWY C;  2WWZ A;  2YLM A;  4YSY B;  1WGR A;  2INC C;  3PT2 B;  3NUH B;  1BT0 A;  3HVZ A;  2BQQ A;  4HPM B;  5EE1 A;  3X23 A;  2CHX A;  4PS7 A;  3PGE A;  1HA5 A;  1J7B A;  1R4M B;  1STE A;  4M8M A;  4NAW A;  5GXG B;  1P98 A;  4HEA 1;  2Y5P A;  3DWG C;  3AB5 A;  2N9E B;  1TKE A;  1DYQ A;  1I4G A;  2KX0 A;  2W3R A;  3KUC B;  1C77 A;  3BVZ A;  3U52 E;  3PRE A;  1EU4 A;  3TL5 A;  4OZC A;  2INN E;  4C56 C;  2M0A A;  4WWP A;  3KUZ A;  4IKG A;  5D94 A;  4AJW A;  4K7W A;  3BWU D;  4TV3 A;  4ARC A;  2EMS A;  4G11 A;  3B08 A;  4BFR A;  3SEB A;  3DCG A;  4N6E B;  2W54 A;  4WUR A;  4B0M A;  1E7U A;  2C5L C;  2IYD B;  1MI0 A;  1N63 A;  2BYE A;  1WMH B;  1LGR A;  3RMK C;  1FEH A;  1L4D B;  4US8 A;  2JY6 A;  1FCL A;  1P1A A;  3JSV A;  2KFK B;  1KOT A;  1X1M A;  2K25 A;  2GBM A;  3TBL D;  4DK5 A;  1EUV B;  1MHH E;  1C9F A;  3O13 A;  2JZZ A;  4HJG E;  4CO7 A;  1V97 A;  4WH4 A;  4M0W A;  1CQV A;  3T3N A;  1V1O A;  2AEH A;  1SE9 A;  4HRO A;  1J7A A;  1TKG A;  4GU2 A;  3U7Z A;  2L32 A;  4GB9 A;  1ENF A;  1YN3 A;  4USA A;  4ZRP A;  4WWO A;  2L8J A;  2QIL A;  2NPT A;  1VZ8 A;  2OJR A;  2V9H A;  2WNM A;  2K8H A;  4NZL B;  1WWT A;  3HUI A;  1HZ6 A;  5BMI A;  2VH1 A;  3NRZ A;  1KLU D;  4IW0 A;  1YJ1 A;  1AYF A;  3I5J C;  4LNK A;  2N9X A;  4M02 A;  1F0Z A;  1I7H A;  4HDQ A;  1JW9 D;  4A20 A;  2V3S A;  3AE4 B;  3VDZ A;  3EUB 2;  2NS5 A;  1WJ4 A;  1L6U A;  2FCN A;  2JRI B;  2JYT A;  2K6D B;  1IGD A;  3AI5 A;  4YTM B;  1XEE A;  4ANX A;  2DWQ A;  4KZ0 A;  1Z2M A;  1N60 A;  4NJ7 A;  2MSE D;  2N7J A;  3ML8 A;  4PS3 A;  5EE3 A;  3AU4 A;  4MM3 B;  2JPH A;  2KN5 A;  2XNA C;  2QIE B;  4W9L A;  3GB1 A;  2W9N A;  3LXF A;  2OED A;  2ACZ B;  4XE0 A;  3V60 A;  2K0P A;  2VZK B;  5BMH A;  4I6P A;  2C9W B;  3GZN I;  3L4P A;  1FMA D;  1I4X A;  2D10 A;  4RF1 A;  2M17 A;  3JW0 X;  4KSL C;  4A55 A;  3GS2 A;  1YMH E;  3BK2 A;  2J0M A;  3RT3 B;  2W3S A;  2HDE A;  1E10 A;  1TT5 B;  3NVV A;  5LLI A;  3MTN B;  3RD2 A;  1L2N A;  4YTN B;  4A3P A;  3TEZ A;  2EKI A;  2XK5 B;  2FUH B;  1WYW B;  3NY5 A;  1LQB A;  2FAZ A;  4II2 B;  2MLB A;  5EE0 A;  2FCQ A;  3RPF C;  3FIL B;  4OVU A;  4RCO A;  2VZK D;  2VRR B;  4DHJ B;  2LVO A;  2BS2 B;  2JVC A;  1TS2 A;  2YEP B;  4KIK A;  2X38 A;  1GC7 A;  1MVK A;  2G4D B;  2KC2 A;  2D3A A;  1JWA D;  3PLV A;  3WAO A;  2N1W A;  4DXF A;  2D07 B;  1UH6 A;  2LHD A;  1OQQ A;  2KWD A;  2DX5 B;  1NI2 A;  2FUG 1;  1J8C A;  3AE9 B;  2MA9 B;  2PE6 B;  2WS3 B;  2GLS A;  1N5W A;  4GSW A;  2HJ1 A;  3ML9 A;  4WJN A;  1Q10 A;  4DDI D;  4XZ4 A;  4XYC A;  4JX1 C;  3M95 A;  4IG7 B;  1TYG B;  1ACC A;  5G55 A;  2FE8 A;  1WXS A;  5D2M B;  3SDL C;  5E6O A;  1OQR A;  2RDG A;  3FKY A;  2VH2 A;  2KVR A;  4KKI A;  1FO4 A;  2QJL A;  4RM9 A;  2PJH A;  3KWL A;  3L17 A;  1PFD A;  2M0X A;  2Z0D B;  2ICI A;  3T9L A;  2KMC A;  5JHB A;  5BYQ A;  1WGK A;  1LFD A;  4KDL B;  3M62 B;  3APC A;  1QOA A;  2QSD A;  2ASQ A;  2NTT A;  3SFE B;  1TIF A;  1I42 A;  2M4N A;  3R3M A;  4RMA A;  2DHZ A;  5AUK A;  4DXG A;  2CU1 A;  4HCP B;  2LGY A;  1ZGU B;  3BVG A;  2DZI A;  3R7R A;  1FXI A;  2KTF A;  1L7Y A;  2J42 A;  3A9K B;  2KWU B;  3ALB A;  4EZL A;  1VDV A;  4I6L B;  2KDB A;  5EDS A;  1D5M C;  2KJH B;  2D5G A;  2E3T A;  2M56 B;  2JU6 X;  4ANW A;  1EO6 A;  4K1R B;  1I4R A;  2WU5 B;  2JUO A;  2R61 A;  3H8H A;  1XLN A;  2IGG A;  4TUU A;  1Y56 A;  3NG0 A;  5JHA A;  5J18 A;  2JXX A;  2NTS A;  2D3C A;  3S2A A;  3WAP A;  1UWX A;  4IUM B;  3ZO5 B;  2WXH A;  1UBQ A;  2MW5 A;  2WHI A;  2W55 A;  2ZZP B;  2GMI C;  3RNB C;  5DPR A;  3GP7 A;  3DBR B;  2PMV A;  1YQ3 B;  1HXY D;  1K50 A;  3I3T B;  4MSQ B;  2A4Z A;  5DPT A;  3HRD D;  3QIJ A;  3ZLZ A;  4YSX B;  2QDF A;  1E8W A;  2AQ1 B;  4BZA A;  4IWO A;  1GB1 A;  1XLP A;  2K3U A;  2LGD A;  3Q69 A;  3TCA A;  3UQB A;  1PGB A;  3VUW A;  1FM0 D;  1V8C A;  3ZJU A;  3I9V 1;  2HE7 A;  1H8C A;  3W5U B;  2ZVO A;  4WAA A;  1OTR B;  2MJD A;  2SAK A;  4HPL B;  1D3Z A;  2N0S B;  3ZJV A;  1N6Z A;  5H92 C;  4MT5 A;  2HD5 B;  4RGO S;  2Y5B B;  3HM3 A;  3ZKJ C;  4K81 A;  2WDT B;  3CIR B;  2MEK A;  2BYV E;  4LK0 M;  1SXT A;  2DAF A;  3PVL A;  1SBB B;  4XGA B;  2KAC A;  2JT4 B;  3ZYY X;  3MFG A;  1Y8R C;  1IUE A;  1YJI A;  4KKJ A;  3EGR A;  2ZVN A;  1ZOY B;  2BTE A;  4A6Q A;  5JZE B;  2FCM A;  5E6P A;  2KX3 A;  4E74 A;  4WWM A;  3R7Q A;  3PSE B;  4F1S A;  2KLC A;  1TKY A;  4JWS C;  4LNI A;  2J52 A;  3QWZ B;  3T3O A;  3KUD B;  1NI3 A;  1D6E C;  3VUX A;  1F2R I;  2WX0 A;  4RH6 A;  1SJH D;  4BOZ B;  1E90 A;  4W9C A;  4B0E A;  3H7S A;  2LVQ A;  3W9C B;  5LNK 1;  3AUL A;  2V4L A;  1V6E A;  3AED B;  5IAA C;  1L4Z B;  3APD A;  3B1L X;  4XWW A;  2LRU A;  3N1X C;  4KZC A;  1FNV A;  2WYQ A;  3PS6 A;  4REZ A;  1V86 A;  2H88 B;  1BUI C;  2J0J A;  2KT7 A;  2PE9 A;  2MBB B;  2N9K A;  2DNF A;  3AXC A;  1XF5 L;  4E3C A;  4P1C C;  2FNJ B;  1T3Q A;  3U30 A;  3HK0 A;  1TJE A;  4BAX A;  3IBE A;  1XXG A;  2C7M B;  3ZRC A;  3P2B A;  3Q3J A;  4NJ6 A;  2BS4 B;  5D3I B;  2WXL A;  3MC9 A;  2PIA A;  1AW7 A;  2RSU A;  1ZDX A;  1XLO A;  2IZV B;  1LXD A;  4I6N B;  1TS3 A;  3A9K A;  1J7C A;  1JAL A;  1UZX B;  2REX A;  1FFU A;  4QAY A;  2K1F A;  2OOB B;  3D32 A;  4H2A A;  2QMT A;  5D7G A;  4DBG A;  3IHP C;  4C7Z A;  3L16 A;  2CJO A;  1ZE3 D;  1FNU A;  3TIX A;  3VR9 B;  4HKQ A;  5MPO A;  3R66 C;  2O2V B;  4C7Y A;  2NR2 A;  2GB1 A;  1JRU A;  3QA8 A;  4P6V F;  1WI0 A;  2IGH A;  1FXA A;  3RN9 C;  2AWT A;  3ETR A;  2PPH A;  2JF5 A;  4N9F 4;  3Q3N C;  1SIJ A;  4XDD A;  2KQ7 A;  1MJD A;  3I63 C;  2K6Q A;  3C19 A;  1YN5 A;  2WGS A;  4G0N B;  3EFC A;  1T0Q C;  4TMA B;  3DHI C;  1OQY A;  2BKF A;  3Q8F A;  5BMG A;  3NVY A;  4GXB A;  4RGT A;  2BBC A;  4YL8 A;  2BB5 A;  2KTR A;  3V05 A;  2AYO B;  1JCK B;  2LMC A;  1UWM A;  4NPN A;  4P7I A;  3QJZ A;  4RF0 A;  5TR5 A;  3SHQ A;  4MJS A;  3NS8 A;  3X0W A;  3EHV A;  3CF6 E;  3N20 C;  3N32 A;  5J2R A;  5G5H A;  5D6J B;  1TBE A;  5FR3 A;  3JSV B;  1C76 A;  2MCN B;  2ZNV C;  1C4A A;  3SFD B;  4ZRQ A;  3QC8 B;  2V1Y A;  1BML C;  4CHK A;  4MH8 A;  2D3G A;  3KWV A;  3UI3 A;  2NMQ A;  4DHJ D;  4CQN A;  2KAJ A;  4ZRK A;  3GOE A;  2N1V A;  3RCZ A;  1P3Q U;  2L05 A;  2MBH A;  1GC6 A;  1TTN A;  2KDE B;  1Q5W B;  4G50 A;  2LUE A;  1WM2 A;  4ARI A;  2WDV B;  1FCC C;  2WXF A;  4UDU C;  3R2I A;  1V9J A;  1FRD A;  3A9J B;  4WWN A;  3RNG C;  1U4A A;  2L0T A;  2L1A A;  4XX5 A;  3VRB B;  4RNA A;  4LJP B;  4W9I A;  1C4C A;  4G3X B;  4NJC A;  2J4X A;  3QK0 A;  3ECI A;  2G4S A;  3GE8 C;  3TJP A;  4J6I A;  1NEK B;  2IO3 B;  4HJK A;  3AEE B;  5HKH A;  2BWF A;  3TMP B;  1WXV A;  2LD9 A;  3ZJT A;  4HRS A;  4HLE A;  3B2F A;  2ON8 A;  1TGZ B;  3PRM B;  3RUI B;  2KWV B;  1S1Q B;  2SEB D;  1WFY A;  1F2R C;  3AE7 B;  4PS8 A;  3OWE B;  1NBF C;  3QAQ A;  3OJ4 B;  3RZF A;  3OAW A;  3P63 A;  1WZ0 A;  3DWM A;  5C2T B;  1S3S G;  3DDC B;  2LXC A;  2L52 A;  3PZ7 A;  2GBN A;  2LUM A;  5CHF A;  3K9P B;  3IT6 B;  1FNW A;  1E0Z A;  1XCT L; 
#chains in the Genus database with same CATH homology
 3UIP B;  3KH0 A;  3JVZ X;  2CR5 A;  2CU1 A;  4W9K A;  2LZ6 A;  5L83 A;  4E71 A;  2UYZ B;  1HE8 A;  1WRD B;  4HCP B;  5C1Z A;  3LJ3 A;  2LWP A;  2NPT B;  2LGY A;  1ZGU B;  3W1S C;  3ZIM A;  2ZJD A;  2ZCB A;  3H9D A;  2DZI A;  3R7R A;  4F7Z A;  4MEM A;  4DDG D;  4KSK C;  3ONS A;  4TKN A;  2LI5 A;  1OGW A;  2ZPY A;  4BBN C;  1QZE A;  1L7Y A;  2KK8 A;  2KTF A;  3V6C B;  4AOF A;  4MM3 A;  3PHW B;  2FCS A;  2O2V A;  3WAN A;  3KVF B;  1WY8 A;  2WX1 A;  4MSM B;  2FIF A;  2KAN A;  2LRW A;  3QX1 A;  3A9K B;  2KWU B;  3ZTC A;  3ALB A;  4EZL A;  1WMH A;  1ZKH A;  1E5W A;  4FJV B;  1IYF A;  3RUL A;  4I6L B;  4BKT A;  2RPQ A;  3ZW3 A;  1EF1 A;  2KDB A;  5EDS A;  2KJH B;  3N3K B;  3CST A;  2MBQ A;  3NZU A;  4AWJ A;  4B6W A;  1RFA A;  3VAW A;  3ZNG C;  4ANW A;  1EO6 A;  1ZW7 A;  4HVB A;  5L95 C;  4K1R B;  4EUT A;  4M8N A;  2JUO A;  3PLU A;  4TUU A;  5DPS A;  5JHA A;  5J18 A;  1AAR A;  2JXX A;  2KDF B;  3S2A A;  4FUL A;  2I1J A;  3KYC D;  3WAP A;  2FID A;  4NNJ B;  3PV1 A;  3KYD D;  2LGX A;  3QHT A;  1GG3 A;  4IUM B;  3OLM D;  2IO2 B;  4W9G A;  3ZDM C;  3ZO5 B;  3DVN U;  4ASW C;  1UBQ A;  1WJU A;  2KZR A;  3H7P B;  3PHX B;  2MW5 A;  4HXD A;  3T8M A;  4B9K A;  3ENE A;  1UD7 A;  1E8Z A;  3A4S C;  2UWQ A;  2ZZP B;  1FXT B;  2XEW A;  3DVN V;  4EKU A;  2GMI C;  1RLF A;  2MQJ A;  5DPR A;  4GMV A;  4JGH B;  3WAL A;  4FHJ A;  1WGH A;  2L7R A;  2N7D A;  2K39 A;  1WXM A;  3I3T B;  5CHV C;  4MSQ B;  3EEC A;  2O6V A;  3V6E B;  1VD2 A;  2A4Z A;  2GBJ A;  4AJY B;  4IM3 A;  4XC2 A;  5DPT A;  2N4F A;  4GDL A;  3QIJ A;  3ZLZ A;  4K7S A;  5AZG A;  1E8W A;  3UIO B;  5LXH A;  1XQQ A;  4IWO A;  4ZRJ A;  3VTV A;  4W9D A;  3ZRF A;  4GGQ A;  1OEY A;  3ZNH B;  3DVG Y;  1WXA A;  4FA6 A;  2L3Z A;  5FR6 A;  3ZNZ B;  4ZDV A;  2KMA A;  3VTW A;  1YQB A;  5C23 A;  4FAD A;  2D2Q A;  2LGD A;  3L13 A;  4TQ1 A;  3TCA A;  3UQB A;  3VUW A;  2BKR B;  3W1Y A;  2CKH B;  2LXA A;  4TQ0 A;  1OEY J;  4LCD E;  2HE7 A;  2KKC A;  1H8C A;  3A33 B;  3VXW A;  2DZK A;  2AL3 A;  2KFJ A;  2ZVO A;  3BIN A;  4NQK E;  4WAA A;  1OTR B;  1GUA B;  2BGF A;  2CHW A;  3MJW A;  4DXA B;  4MGZ E;  4MH0 E;  4HPL B;  1IPG A;  4WJP A;  4FBJ B;  1D3Z A;  2C7N B;  1WZ3 A;  1SGH A;  2GBK A;  2D11 A;  2HD5 B;  2ZCC A;  1RRB A;  2MX2 A;  2NBU A;  1WX8 A;  2NCN A;  1XD3 B;  4FJZ A;  2Y5B B;  4ANV A;  3HM3 A;  1WJ6 A;  1WR6 E;  2R2Q A;  1V5O A;  1P0R A;  3ZKJ C;  4K81 A;  1V5T A;  3A4R A;  2WDT B;  2KO3 A;  4ZRI A;  4MGY E;  1A5R A;  1PQS A;  2BYV E;  1NDD A;  1E8Y A;  2KDI A;  2KHW B;  2ZEQ A;  2DAF A;  3PVL A;  4GDL B;  3VH3 B;  1YX6 B;  3HM6 X;  3IVF A;  4IWQ A;  3PRZ A;  2JT4 B;  2JZ3 B;  4EZK A;  3W1S A;  1Y8R C;  2XBB C;  2DZJ A;  2WWZ A;  1MG8 A;  2YLM A;  4KDI C;  4GN1 A;  1GJZ A;  2ZVN A;  1V80 A;  2KJR A;  3UGB B;  1WGR A;  3PT2 B;  1BT0 A;  5JZE B;  4HPM B;  2LJ5 A;  2FCM A;  5E6P A;  3X23 A;  2CHX A;  2KX3 A;  4PS7 A;  3PGE A;  2BF8 B;  4E74 A;  4DWF A;  3R7Q A;  3PSE B;  3BY4 B;  3HIZ A;  2KLC A;  4M8M A;  4F1S A;  4NAW A;  3KW5 B;  3OJ3 A;  3V61 A;  2Z0E B;  1KM7 A;  1P98 A;  2N9E B;  1WH3 A;  3UF8 A;  3VTU A;  3QWZ B;  4FLH A;  5KHQ A;  3VQI A;  2L00 B;  1F9J A;  1WGG A;  2KTR B;  2KX0 A;  3KUD B;  4FHK A;  4BKG A;  3KUC B;  3VUX A;  3NZS A;  3QQ8 B;  2WX0 A;  4DHZ E;  3PRE A;  3TL5 A;  5IA7 A;  3CMM B;  1C3T A;  1R4M I;  4BOZ B;  1E90 A;  4W9C A;  3HHM A;  3RZW C;  4WWP A;  3H7S A;  2ZPN A;  3KUZ A;  4NAW B;  2LVQ A;  2MP2 A;  4K7W A;  5D94 A;  4X57 B;  4TV3 A;  4AJW A;  3AUL A;  4BOS C;  2V4L A;  1V6E A;  3ZNI D;  4HCN B;  2EMS A;  2GOW A;  3DBS A;  5IAA C;  4G11 A;  3B08 A;  3O65 B;  4BFR A;  3APD A;  3L08 A;  3DCG A;  1WR1 A;  1YX5 B;  3B1L X;  2KLG A;  1Q0W B;  1E7U A;  2C5L C;  5KHO A;  2IYD B;  2LRU A;  2GBR A;  2O6V B;  2BYE A;  1WMH B;  5JH5 C;  4KZC A;  3H6N A;  3UQA A;  2JY6 A;  2YVC A;  4MEL A;  1ISN A;  1LM8 B;  1VCB A;  4ICV A;  1P1A A;  3JSV A;  4K7U A;  3ZUN A;  2WYQ A;  3VH4 B;  3PS6 A;  2KFK B;  1WE7 A;  2DEN B;  1X1M A;  2K25 A;  3DPD A;  1V86 A;  3WIM A;  3C0R B;  1KOT A;  2GBM A;  3TBL D;  2M8S A;  5CX3 A;  2CHZ A;  2J0J A;  4NQL B;  3VHT C;  4DK5 A;  1EUV B;  1WF9 A;  2PE9 A;  2MBB B;  2JRH A;  2IBI B;  1K8R B;  2XK5 A;  3AXC A;  4E3C A;  4ZYN A;  2JZZ A;  5AZF A;  4CO7 A;  2FNJ B;  4MDK E;  3QAR A;  3WAM A;  3U30 A;  4BVU C;  3HK0 A;  3Q3F A;  3U7D A;  4GDK A;  3CSF A;  5DCN A;  5LXI B;  2AEH A;  1SE9 A;  2CS4 A;  3IBE A;  4F8C B;  2O6V D;  1WIA A;  4W9H A;  2C7M B;  4GU2 A;  3ZRC A;  3P2B A;  3Q3J A;  4NJ6 A;  4KV2 A;  4WJQ A;  3VUY A;  3PTF C;  3DBL I;  4WJO A;  4BBN F;  1IP9 A;  2JWZ A;  4CYE A;  4GB9 A;  4KIK B;  4FN2 A;  4W9J A;  4JQW C;  1T0Y A;  2Z59 B;  4WWO A;  2L8J A;  2RSU A;  2NVU I;  2NPT A;  2OJR A;  2A5U A;  1WGD A;  2IZV B;  1LXD A;  4I6N B;  2K8H A;  2RGF A;  2MWS B;  3A9K A;  5E6N A;  1UZX B;  4MJS B;  2REX A;  3DBH I;  4LDT D;  2BYF A;  3DOW A;  2K8B A;  1Z5S B;  1KJT A;  4IW0 A;  1YJ1 A;  2J7Q B;  2K1F A;  2OOB B;  3D32 A;  5AEK B;  2N9X A;  2EKE C;  3H7P A;  2LAS A;  4HDQ A;  5D7G A;  4A20 A;  1YD8 U;  2G3Q B;  4BKS D;  3IHP C;  4DBG A;  2V3S A;  2IY0 B;  3L10 B;  1Q1O A;  3VDZ A;  4MGI E;  3L16 A;  1UBI A;  1G6J A;  3TIX A;  2NS5 A;  1WJ4 A;  4W9F A;  3R66 C;  2O2V B;  4RM8 A;  2NR2 A;  3SU8 X;  3U8Z A;  5CTR C;  1JRU A;  3QA8 A;  2FCN A;  1WI0 A;  2JRI B;  2K6D B;  2LVP A;  3EC8 A;  4JLC A;  3AI5 A;  1SIF A;  2HJ8 A;  1YIW A;  3LDZ E;  4LJO B;  4ANX A;  2AWT A;  3DBR I;  4KZ0 A;  2PPH A;  4IC7 B;  2JF5 A;  5BO4 B;  1Z2M A;  4IM2 A;  1WE6 A;  4N9F 4;  4NJ7 A;  2MSE D;  4M0W B;  3ML8 A;  4URK A;  2KQ7 A;  2L76 A;  4PS3 A;  3AU4 A;  1KLV A;  2K6Q A;  2JPH A;  2KN5 A;  2ZNV B;  4PYZ A;  3RYT A;  3IG3 A;  4GIV A;  4G0N B;  4HWI B;  1V81 A;  2DAJ A;  4IWP A;  1OQY A;  4W9L A;  2BKF A;  2W9N A;  3MHS D;  4IM0 A;  4GXB A;  4YL8 A;  5J17 A;  2KTR A;  4EOY A;  3QCA A;  3V60 A;  2AYO B;  2N9P C;  4NPN A;  4P7I A;  3QJZ A;  4I6P A;  5TR5 A;  2C9W B;  3GZN I;  3SHQ A;  4MJS A;  1H4R A;  3NS8 A;  3X0W A;  3EHV A;  3CF6 E;  3N32 A;  2D10 A;  5J2R A;  5D6J B;  1TBE A;  2L0F A;  1WJN A;  2M17 A;  3JW0 X;  3JSV B;  3H1U A;  1CMX B;  4KSL C;  5CHW A;  5AZH A;  2BWE S;  2MCN B;  3PZD A;  4WQO B;  2ZNV C;  2J0M A;  1UEL A;  3RT3 B;  2BPS A;  2DYB A;  2V1Y A;  3QC8 B;  5LLI A;  4CHK A;  2DYO A;  2DZM A;  2K8C A;  1WM3 A;  3MTN B;  3RD2 A;  1L2N A;  4OVV A;  4A3P A;  2D3G A;  2NBV B;  2N7E A;  2XK5 B;  2PEA A;  2FUH B;  1WYW B;  3IFW B;  3NY5 A;  2C60 A;  4ANU A;  1LQB A;  4FJY A;  4DHJ D;  2FAZ A;  2B3A A;  4II2 B;  2MLB A;  4ZRK A;  3GOE A;  4GOC A;  3APF A;  3DQV A;  4EFO A;  2FCQ A;  1WX7 A;  3L54 A;  4OVU A;  3M63 B;  2VRR B;  2G45 B;  4DHJ B;  2N1V A;  3RCZ A;  3SD5 A;  1P3Q U;  4HK2 A;  2L05 A;  2MBH A;  1GC6 A;  3WA0 A;  1TTN A;  4B95 A;  1WGY A;  2HTH A;  2KWC A;  2LVO A;  3NHE B;  2MBO A;  2KJ6 A;  2JVC A;  2KDE B;  1Q5W B;  3PPA A;  3PRP B;  2LUE A;  4G50 A;  1WM2 A;  2KQS A;  4KIK A;  4W9E A;  3VVW B;  1V2Y A;  1TZ1 A;  1GC7 A;  3JYU A;  4NY0 A;  2G4D B;  1V9J A;  2IY1 B;  2KC2 A;  4EZJ A;  3A9J B;  3PLV A;  4WWN A;  2KC1 A;  3DVG X;  4II3 B;  2N1W A;  3WAO A;  1U4A A;  2D07 B;  3ZTD A;  3UIN B;  4GDK B;  2L0T A;  3A1Q A;  1XT9 B;  1UH6 A;  4HDO A;  2MBE A;  2DX5 B;  2KXJ A;  4XX5 A;  1NI2 A;  2IO0 B;  1J8C A;  1E7V A;  2MA9 B;  2PE6 B;  2R2O A;  1EF5 A;  4LJP B;  4W9I A;  2DYM A;  4JL9 A;  4G3X B;  4LDT B;  1P9D U;  3QK0 A;  4GSW A;  4PYU A;  1E8X A;  3AU5 A;  3ECI A;  2G4S A;  1V49 A;  3ML9 A;  2KOX A;  4WJN A;  1UGM A;  4DDI D;  4JIO U;  4XZ4 A;  2RD0 A;  3TJP A;  4J6I A;  2I1K A;  3M95 A;  2IO3 B;  4HJK A;  5DPW A;  4IG7 B;  4AP4 C;  2KFK A;  5HKH A;  2BWF A;  5G55 A;  2J0K A;  3EFU A;  3TMP B;  2KD0 A;  1WXS A;  2MP2 B;  5D2M B;  1WXV A;  2LD9 A;  2M1M A;  3SDL C;  4HLE A;  3ZVV A;  5E6O A;  2NBW B;  4A3O A;  2KVR A;  1WX9 A;  1TGZ B;  4EEW A;  2C7H A;  4AUQ C;  3B0A A;  3PRM B;  5G2N A;  3RUI B;  2AL6 A;  2KWV B;  4RM9 A;  3ZDT A;  1I35 A;  2EMT A;  1S1Q B;  2KNB A;  3K9O B;  2PJH A;  5GMV A;  1WFY A;  3L17 A;  3A1Q B;  1C1Y B;  4ICU A;  2M0X A;  2Z0D B;  4MGK E;  3V62 A;  3T9L A;  4PS8 A;  3N30 A;  2KMC A;  4KVG B;  2RR9 A;  1NBF C;  1J0G A;  3L0W B;  1RAX A;  3QAQ A;  5JHB A;  3M3J A;  3OJ4 B;  2MRP A;  3RZF A;  3OAW A;  1LFD A;  3A9J A;  4KDL B;  1WZ0 A;  3M62 B;  3APC A;  4DHZ B;  4BKS A;  3NOB A;  2ASQ A;  1S3S G;  3VFK A;  3DDC B;  2LXC A;  1M94 A;  1I42 A;  2M4N A;  3R3M A;  2GBN A;  4RMA A;  5CHF A;  1J19 A;  3K9P B;  2IO1 B;  1GNU A;  1R4N I;  2DHZ A;  2QHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...