2ZZPB

The crystal structure of human atg4b(c74s)- lc3(1-124) complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
119
structure length
119
Chain Sequence
EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/structural protein
molecule keywords Cysteine protease ATG4B
total genus 34
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zzpB00
2KDBA 3L13A 4BBNF 2MW5A 3JVZX 1WE6A 1JRUA 4GDLB 2KNBA 3R3MA 4GSWA 4OVUA 5E6PA 4GU2A 3U8ZA 4ANVA 2DYMA 1UELA 2L8JA 4WJQA 1YJ1A 2ZNVC 2J0MA 4I6NB 2BYVE 2V3SA 2C5LC 4MELA 1WXVA 1P0RA 4KDLB 4GGQA 3QJZA 4TQ1A 3V6CB 3TCAA 2AYOB 4JL9A 2Z59B 3V60A 2FCQA 1EF1A 2ZEQA 1J0GA 2GOWA 3H9DA 1OTRB 3JSVA 4MSQB 1WY8A 1OGWA 1XT9B 1GNUA 2DAFA 2KMCA 3B0AA 1EF5A 3AULA 2O2VA 2CR5A 3DBSA 4DBGA 3H7PA 3ZRFA 1I35A 2RSUA 2PE9A 4IW0A 5TR5A 5CTRC 4BKGA 4DHJB 3APCA 3JW0X 2NPTB 4FLHA 2N7DA 3DVNV 2JPHA 2KQSA 4JQWC 3UGBB 4PS3A 2KDEB 1T0YA 2JY6A 2MP2B 4GN1A 4LDTD 2N9PC 2O2VB 4K1RB 1E5WA 1WIAA 2KLCA 4WJNA 4HLEA 3Q3FA 3S2AA 2K8CA 3A9KA 4KIKA 2JT4B 2LASA 4M0WB 4DK5A 5G55A 5IA7A 3U7DA 3RD2A 2L0TA 3CMMB 3H1UA 2K8HA 4HJKA 3DBLI 4I6PA 3L0WB 4NNJB 1J8CA 1LM8B 2LZ6A 2JVCA 2RGFA 3QCAA 5L95C 1WR1A 2JWZA 2L7RA 5GMVA 4KSKC 3ZNID 3K9PB 1GJZA 4BOSC 5E6NA 2AWTA 2Z0EB 3ZO5B 1VCBA 2HD5B 4II2B 1BT0A 3LJ3A 3V6EB 1H4RA 3PV1A 2MBQA 3ML8A 3KYDD 4IM0A 3DVGX 2VRRB 2MQJA 4IWQA 2KMAA 2M17A 1G6JA 1EUVB 2MX2A 1KM7A 2FCMA 1Z2MA 3Q3JA 3VFKA 3L54A 2C7NB 4MJSB 3VTVA 3VTWA 2LD9A 2G4DB 2L05A 4FHKA 4ANWA 1CMXB 2G45B 4FJVB 2D3GA 4FJYA 1UH6A 2NR2A 3GOEA 1E90A 3N30A 1V86A 2PE6B 3N32A 1S3SG 2J7QB 2KJRA 3M3JA 3RYTA 3ZNZB 2ASQA 4KZCA 3M63B 4JLCA 4DHZE 3EC8A 3SHQA 1TBEA 3PLVA 3QHTA 2PEAA 4NAWB 3MTNB 2KWVB 4W9LA 1WH3A 1Q5WB 4MM3A 3KVFB 3SDLC 2JF5A 3IHPC 2KFKA 3AI5A 2WDTB 4CHKA 4BKSA 2C60A 3HK0A 1GG3A 3NZUA 1WXMA 3QIJA 4PYZA 4W9KA 4W9HA 4HVBA 1YD8U 2ZPNA 2LWPA 1TGZB 2RPQA 4F8CB 2K1FA 5J18A 5J17A 4CYEA 4X57B 2EMTA 1GC7A 3SU8X 2O6VD 4NQKE 1FXTB 4JIOU 1V80A 2L3ZA 4MSMB 2C7MB 3NS8A 2FNJB 2KC1A 4LCDE 5G2NA 2KC2A 3KUDB 5CHFA 1WXSA 3ZW3A 4MDKE 3ZDTA 2KZRA 4E71A 2W9NA 4W9JA 1LXDA 2NS5A 3P2BA 5DPTA 3UIPB 2MRPA 4PS7A 2KHWB 2DYOA 3ZNGC 2CU1A 3PRPB 4GXBA 1RFAA 1WZ3A 1YIWA 2L0FA 3DDCB 2NBVB 2XBBC 1KLVA 4EUTA 4K7WA 1E8WA 4FHJA 2IO2B 3A1QB 3AU4A 3VAWA 3KW5B 5AEKB 3I3TB 4NAWA 2C7HA 3PPAA 1PQSA 4G11A 5KHQA 2GBNA 1UBQA 2FIFA 3DPDA 3PREA 5AZGA 3W1SA 4BBNC 3KYCD 3PGEA 2K6DB 3H6NA 1XQQA 3JYUA 4NJ6A 3UIOB 1M94A 4W9EA 2KJHB 2N1WA 2FIDA 2GBRA 3OJ3A 1E7VA 1E8XA 2MBHA 2MBOA 3HHMA 5IAAC 4B9KA 1UBIA 3WALA 3VHTC 2O6VB 3APFA 3C0RB 3ZRCA 1F9JA 4WAAA 4LJPB 4FA6A 3W1SC 4IC7B 3TIXA 1C1YB 1EO6A 1J19A 4NY0A 5D2MB 3EHVA 4LDTB 5J2RA 2DHZA 3CF6E 4ANUA 1D3ZA 2WYQA 4G50A 2BKFA 4FADA 2RR9A 4W9FA 3OJ4B 2ZJDA 3MJWA 4HPLB 4EEWA 1WI0A 4HDQA 4ZYNA 2J0KA 1V5OA 3A1QA 3PVLA 2KQ7A 4A3PA 1WZ0A 3APDA 2R2QA 3EECA 4EKUA 1A5RA 2IY1B 2IYDB 3CSTA 1HE8A 3PS6A 2IZVB 4ZRKA 1WX7A 2HJ8A 2IO0B 2WX0A 2LGYA 2PJHA 4J6IA 1WJ6A 1WRDB 2FCSA 1IPGA 2C9WB 2EKEC 2IO1B 2KLGA 3BY4B 3QX1A 3RUIB 4BKTA 3ECIA 1SE9A 2XK5B 3ZNHB 1WX8A 3HM3A 3QA8A 2KFJA 3KH0A 1WFYA 3DVGY 3VUWA 3DBRI 2CS4A 2G4SA 3L10B 2CHZA 3QK0A 1WMHB 2ZNVB 1WYWB 3DBHI 4AJYB 4M8MA 1P9DU 2CKHB 2ZCCA 4WJPA 2JXXA 4B6WA 1SGHA 2LRWA 2Z0DB 1L2NA 2LGXA 4GMVA 1GC6A 3ZVVA 2V1YA 4MGYE 2WWZA 2JRHA 2KJ6A 2DZMA 1E7UA 3B1LX 4W9DA 3UQBA 1WJNA 3DQVA 4TV3A 4DWFA 4MGZE 1P1AA 1ZKHA 4ZRJA 5JH5C 3M62B 4YL8A 2KX3A 1LQBA 1WJ4A 3A4RA 2KN5A 2NCNA 2DX5B 2REXA 4HK2A 3WAOA 2NPTA 4HDOA 2BYFA 2GMIC 4IM3A 2BF8B 3IG3A 2KK8A 5DCNA 1YQBA 4DDID 3AXCA 4HXDA 1QZEA 1VD2A 1WR6E 2XK5A 3QWZB 2ZPYA 4WJOA 3T9LA 1I42A 2A5UA 1LFDA 2MLBA 3KUZA 2V4LA 4HWIB 5AZFA 4GDKA 1YX6B 3V61A 2FUHB 3RZFA 4GIVA 4IG7B 1WMHA 2D10A 4KSLC 2R2OA 4BVUC 3R7RA 2B3AA 2YLMA 2CHXA 3NY5A 3QQ8B 1WGDA 2KTFA 2ZCBA 2LI5A 3A4SC 3DOWA 5L83A 1AARA 1OEYJ 3TJPA 1WE7A 1RAXA 5CHVC 4HCPB 4KV2A 1WX9A 3D32A 4G0NB 3UQAA 4DHZB 1ZGUB 4F1SA 5EDSA 2BGFA 4CO7A 4AJWA 1UD7A 4F7ZA 2K8BA 4FJZA 3VVWB 4ANXA 1WJUA 2LXAA 2MWSB 3IFWB 1TZ1A 3VDZA 1RLFA 3SD5A 1Q1OA 4JGHB 3L08A 1NBFC 3QC8B 2DZKA 2PPHA 1U4AA 2M8SA 5D94A 4MH0E 4NJ7A 3WA0A 4ASWC 1V5TA 2NBUA 5BO4B 2LUEA 3PZDA 5JHAA 1S1QB 1WGGA 2NBWB 2WX1A 1ZW7A 1UZXB 2FAZA 3DCGA 3VXWA 1GUAB 4TUUA 2EMSA 3ONSA 4BFRA 2KXJA 2JRIB 2LVQA 1KOTA 3GZNI 4AWJA 5CHWA 1MG8A 3KUCB 3PT2B 4I6LB 2FCNA 3PHWB 2D07B 1OQYA 2GBKA 2UYZB 3ZDMC 3VUXA 4BKSD 4EZLA 4KDIC 3T8MA 4MEMA 5CX3A 5HKHA 3B08A 2BWFA 5D7GA 5LXHA 3DVNU 1V9JA 1NI2A 4K7SA 4PS8A 3CSFA 4AP4C 1R4NI 3JSVB 2O6VA 5KHOA 1V81A 2AL3A 2BPSA 5D6JB 3ZTDA 4AOFA 1R4MI 2KWCA 2DAJA 4N9F4 4PYUA 4E74A 3QAQA 3H7PB 1WXAA 2IBIB 3EFUA 1Q0WB 4XC2A 4K7UA 4A20A 3PHXB 1TTNA 2DZIA 2G3QB 1ISNA 4GDKB 3ZKJC 2N9EB 2N1VA 4ZDVA 2ZZPB 3ZLZA 3IVFA 1IYFA 1OEYA 2KOXA 1SIFA 2KANA 5LXIB 4FULA 3UINB 2UWQA 4EFOA 2KDIA 1UGMA 4ICVA 2CHWA 3X23A 3WIMA 2MSED 1WM3A 5FR6A 1YX5B 3WAPA 2KX0A 3ZTCA 4FBJB 2AL6A 1WGRA 3K9OB 3ZUNA 4IM2A 2QHOA 4ICUA 4MGKE 3IBEA 2OJRA 2YVCA 3RZWC 3V62A 3L17A 2BYEA 1KJTA 4XX5A 4II3B 3VQIA 1Y8RC 3NOBA 2N7EA 3WAMA 2ZVNA 3BINA 2N9XA 3NHEB 2MCNB 2KWUB 3RULA 1L7YA 5DPSA 2XEWA 1NDDA 2GBMA 4XZ4A 4OVVA 4TQ0A 2LVPA 2M1MA 2A4ZA 2KTRA 3ENEA 2IY0B 3MHSD 4GDLA 3ZIMA 4W9GA 2L00B 4B95A 2LXCA 3N3KB 5C1ZA 2LJ5A 4LJOB 2NVUI 5C23A 1H8CA 3TBLD 4GB9A 3AU5A 2HE7A 4WWPA 4WWOA 2L76A 3HIZA 3X0WA 4WWNA 3VH3B 1WGYA 3PTFC 2AEHA 3LDZE 3O65B 3RCZA 2KTRB 3R7QA 3A33B 4K81A 2HTHA 2JUOA 2KVRA 3H7SA 3PRMB 3UF8A 4EZKA 2DZJA 2KDFB 3PLUA 3PRZA 4FN2A 4KVGB 3A9JB 4A3OA 2D11A 5E6OA 3QARA 3ALBA 4M8NA 4URKA 5JZEB 2GBJA 2MP2A 2M4NA 2BKRB 3VUYA 4E3CA 3TL5A 2KD0A 2DENB 4DDGD 5JHBA 1WM2A 2KFKB 4RM8A 5DPWA 2KKCA 3R66C 5AZHA 3W1YA 4DHJD 2K39A 4BOZB 1WGHA 4AUQC 1P3QU 1Z5SB 2OOBB 4GOCA 3OLMD 3NZSA 2LRUA 1X1MA 2LVOA 3OAWA 3VH4B 3L16A 2ZVOA 2N4FA 4W9IA 3TMPB 4MGIE 3ML9A 4RM9A 2M0XA 4ZRIA 3VTUA 1WF9A 2J0JA 2RD0A 1XD3B 1E8ZA 3HM6X 5DPRA 2D2QA 1V2YA 1RRBA 4RMAA 2JZ3B 2K6QA 1E8YA 2BWES 4W9CA 2MBBB 2I1JA 4KZ0A 4NPNA 3M95A 2MA9B 2KO3A 2IO3B 3RT3B 3PSEB 4IWOA 4P7IA 4WQOB 4NQLB 4HPMB 4EZJA 4HCNB 4TKNA 4G3XB 2Y5BB 2JZZA 4EOYA 2K25A 3A9KB 4KIKB 1K8RB 3A9JA 2I1KA 4IWPA 3WANA 1V6EA 3U30A 4MJSA 2MBEA 2DYBA 2LGDA 5LLIA 1IP9A 4DXAB 4IUMB 1P98A 1C3TA 1V49A
chains in the Genus database with same CATH superfamily
3Q8FA 4BBNF 1AN8A 4GDLB 3R3MA 4OVUA 4YTNB 4ARCA 4WQMA 2IGDA 4GGQA 4TQ1A 2LUMA 1J0GA 1EF1A 1OTRB 2PIAA 3B0AA 1XEEA 1EF5A 2CR5A 3DBSA 3H7PA 3ZRFA 2RSUA 1GOZA 1JCKB 1D5ZC 2QMTA 4KGRA 5CTRC 4C00A 2QC8A 4FLHA 2N7DA 2KDEB 4GN1A 1MHXA 4K1RB 2KLCA 3I5JC 4KIKA 2JT4B 2LASA 4OVZA 3CMMB 1CQVA 3IT4B 4HJKA 4PT5A 3DBLI 4I6PA 3L0WB 3QCAA 1WR1A 3UI3A 2L7RA 3K9PB 5E6NA 1JWMD 4II2B 1BT0A 1H4RA 3PV1A 3ML8A 1FD6A 3DVGX 2MQJA 4IWQA 2KMAA 2WDQB 2M17A 1EUVB 1C9FA 3Q3JA 3VTVA 2C7NB 1E7PB 4ANWA 4LNFA 2G45B 4FJVB 1VRAB 1UH6A 1E90A 1V86A 2PE6B 5T8IA 2J7QB 1E10A 3Q3MC 2FBWB 4DHZE 3SHQA 1TBEA 2KWVB 4W9LA 5H92C 4LNIA 2KFKA 1GAQB 2WDTB 4L1BA 3R2TA 4W9KA 1TS5A 4USAA 1SE4A 4W9HA 4HVBA 2ZPNA 2LWPA 1TGZB 2RPQA 2K1FA 3SU8X 2O6VD 4NQKE 5G2NA 3KUDB 2IJ0A 1SJHD 1WXSA 3ZW3A 2KZRA 4E71A 1EM7A 3ETRA 1ET9A 1LXDA 2NS5A 3UIPB 4RFBA 3ZQ4A 3AM9A 2NBVB 1KLVA 1E8WA 2IO2B 1XLQA 3A1QB 5H8YE 4ACFA 2C7HA 1IBXA 4OZAA 2FIFA 5AZGA 3W1SA 3KYCD 4LK0M 1VZ8A 3JYUA 4NJ6A 1ZP0B 2GBRA 3AEGB 4HKQA 2JZPA 5IAAC 2ICIA 4B9KA 3APFA 2WU2B 3T3NA 3ZRCA 3W1SC 4IC7B 1PGBA 3TIXA 1C1YB 1J19A 4NY0A 3IT6B 5J2RA 4C7ZA 2WXGA 2BKFA 1UWXA 4FADA 4W9FA 1VJKA 3PVLA 3NVZA 3APDA 1A5RA 2SEBD 1HE8A 1C4CA 2GI9A 1BXTA 2HJ1A 4J6IA 2GB1A 2HJ8A 1XO3A 3BY4B 5IP4D 1F77A 1WX8A 3MC0B 1RM6C 3DVGY 1OFFA 2WXFA 3QK0A 2DNFA 2X8XX 2SAKA 4RGOS 3BYTB 4WJPA 1PFDA 2K9XA 1SGHA 1L2NA 2LGXA 3U52E 2NTSA 1E0ZA 3AE5B 2Y3AA 2JRHA 2J4XA 3RNCC 3ZJTA 2L1AA 1P1AA 4ZRJA 4XYCA 4YL8A 1WJ4A 2KN5A 1HXYD 2NCNA 4HDOA 2W3RA 3SEBA 2BF8B 5DCNA 4KGSA 4HXDA 1MG4A 3AB5A 4WJOA 3T9LA 2MJ3A 2A5UA 4RNAA 4HWIB 4GIVA 1WMHA 2M56B 4KSLC 4RGTA 1C4PA 1Y56A 3Q14C 4BVUC 3R7RA 1WYGA 2YLMA 2I38A 2KTFA 1ROEA 4G0NB 2V3NA 1UD7A 4F7ZA 3Q8EA 1YN5A 4ANXA 3ZYYX 1Q1OA 3QC8B 4MH0E 3GS2A 1JALA 1V5TA 3PZDA 1S1QB 1WGGA 4A6QA 1MI0A 2TSSA 1NEKB 2KXJA 1KOTA 1I4RA 3GZNI 4BAXA 3FC4A 2N9KA 2N9LA 4KKJA 3PHWB 1OQYA 2HDEA 2YEPB 4KDIC 3B08A 2BWFA 5D7GA 5LXHA 1FCCC 4PS8A 4K7SA 4AP4C 3I57A 3NS1A 3ZTDA 2DAJA 4N9F4 4E74A 2IBIB 3PHXB 1TTNA 2WDRB 4CQNA 2VH2A 2XN9C 3ZKJC 2N9EB 1FCLA 4ZDVA 1QOFA 2ZZPB 4NJCA 4K3BA 3IVFA 1OEYA 2KOXA 2Y5PA 1A70A 5TSSA 2KDIA 2WQYB 3GE8C 2CHWA 3DHGC 1XLPA 5FR6A 1QT9A 2KX0A 4FBJB 3K9OB 4ICUA 4OHJA 5BMGA 2YVCA 3L17A 2E6XA 2K0PA 3VQIA 1IGCA 2ON8A 3NOBA 3WAMA 2QCZA 2ZVNA 3BINA 3OG5A 1L7YA 1QOGA 1WGKA 2PVOD 2V3PA 3I63C 1N60A 2LFIA 3ENEA 3KLSX 2LXCA 3N1ZC 2BS4B 3NVVA 1LGRA 3TBLD 3AU5A 2L76A 3HIZA 1EWYC 3X0WA 1V1OA 1K51A 3VH3B 1YJIA 3RCZA 3TEYA 1FPYA 1SBBB 2HTHA 2JUOA 2KVRA 4R3DA 3UF8A 3MFGA 1C76A 3PLUA 2DBYA 2M19A 3N20C 1KFYB 1ZDXA 4URKA 2BKRB 3VUYA 2KD0A 2DENB 2X38A 4OW0A 1WM2A 3RN9C 4P16A 5AZHA 3Q8BA 1IUEA 2V9HA 1P3QU 1R4NB 1K53A 1WRIA 1ZE3D 3AE1B 2LGSA 3DWGC 3R2IA 1V2YA 4RMAA 1RYJA 4A90A 2BWES 4W9CA 2I1JA 1EWCA 1XCTL 2KO3A 4YSYB 3PSEB 4IWOA 1FXAA 4HCNB 4G3XB 2K25A 1KF6B 3U30A 2MBEA 2INCC 3L13A 3AE7B 2MW5A 3JVZX 4A9AA 2KNBA 2AQ3B 2JYTA 5E6PA 4GU2A 2L8JA 2ZNVC 2J0MA 2BYVE 2C5LC 3RMKC 1P0RA 4KDLB 3QJZA 3KWVA 2PMVA 3JSVA 1WY8A 1OGWA 1XT9B 3SFDB 5HG2A 3R8BA 4AS1A 1ENFA 1ZUD2 1I35A 1SSNA 4IW0A 4BKGA 1ZPSA 3DVNV 4PS3A 1T0YA 2JY6A 2VZKB 4LDTD 2L32A 2O2VB 4M00A 3Q3FA 2K8CA 4N59A 5G55A 3U7DA 3RD2A 1T0QC 2W54A 4RH6A 2RDBC 5EE0A 5GMVA 4BOSC 1JMLA 2AWTA 1L6VA 3ZO5B 1PUTA 4KGTA 1VCBA 2AX5A 2HD5B 5JXVA 2LGIA 5IOIA 2MBQA 4IM0A 1T0SC 1G6JA 2MX2A 1KM7A 1Z2MA 4DQOC 1L6UA 1N63A 2LD9A 1P7FA 4L2YA 1HTOA 1CMXB 4YSZB 3P4SB 3BVMA 1ET6A 2ZW0A 2I2YA 3GOEA 4M0WA 3U2SC 4KZCA 3M63B 3EC8A 1TJEA 3PLVA 2GRIA 4JWUC 2UU7A 4P1BC 3SDLC 4D2KA 3IHPC 1FIQA 3AE8B 4C80A 4F8CB 2V4IB 5J17A 4CYEA 4X57B 1GC7A 1UWMA 2CU3A 4ZHPA 1SF0A 5CHFA 1NYQA 1JQ4A 2W9NA 4W9JA 3W5UB 5DPTA 5HHDG 1V8CA 2KHWB 4K3CA 1JWBD 1QILA 1D5XC 1NI3A 1AWDA 4EUTA 1RFKA 4H2AA 1KH0A 4BZAA 5GXGB 4MH8A 1D6EC 3AU4A 4XWTA 1FNVA 5AEKB 4NAWA 1N61A 1JWAD 1UBQA 2K6DB 4W9EA 2N1WA 2FIDA 3LYYA 1F1HA 1E8XA 2KYWA 2MBHA 3HHMA 3OWEB 4GLSC 1UBIA 3WALA 1FXIA 2B76B 5BYQA 4LJPB 2QSDA 1EO6A 4US8A 2MEKA 3CF6E 4ANUA 2RR9A 1ZDVA 1F2RI 2ZJDA 1FM0D 1KRHA 3MJWA 1V5OA 3LB8C 2R2QA 1C79A 2IYDB 3CSTA 3RNFC 5E6JA 2PJHA 2WXPA 1WJ6A 2FCSA 2EKEC 3RUIB 3ECIA 1SE9A 2XK5B 3HM3A 3QA8A 4NAMA 3VUWA 3DBRI 2D3AA 1HQRD 1WMHB 4MT5A 2CKHB 2WXHA 4B6WA 2LRWA 4GMVA 2DLBA 2N7JA 2CJOA 4MGYE 2WWZA 2KJ6A 1E7UA 1ZXIA 3B1LX 1WJNA 5JH5C 3M62B 4HK2A 4IM3A 2HTME 1QZEA 1HTQA 1MJDA 4HJGE 3NG0A 3AH7A 3MJ5A 1LFDA 5AZFA 3TEWA 2FUHB 3RZFA 4WIPA 3PO0A 1MHHE 1J7BA 3N9YC 1ZXHA 1YN4A 3A4SC 3DOWA 4YXDB 3TJPA 4LNOA 1WE7A 3B2GA 4HKZE 1WX9A 3D32A 2FE8A 2BVCA 2BGFA 4CO7A 2K8BA 3PZ8A 2MWSB 1TZ1A 3SD5A 3RNAC 1KTKA 1NBFC 2DZKA 4NJ7A 3WA0A 4ASWC 2NBUA 2WX1A 1YMHE 2NBWB 4O1NA 1UZXB 3DCGA 1B1ZA 4TSSA 3P63A 3ONSA 2JRIB 1MG8A 3V3XA 4I6LB 2EELA 2GBKA 2KACA 1TS2A 4EZLA 2IDYA 2KMMA 4MEMA 2CJNA 1NVID 3CSFA 1R4NI 3CIRB 2O6VA 1ZOYB 1V81A 2BPSA 4A8XC 5FKAC 3HVZA 5D6JB 4AOFA 3J9CA 1R4MI 2KWCA 1TKYA 4PYUA 1M4VA 2WS3B 1WXAA 1CJEA 3EFUA 4XC2A 2RDGA 4A20A 4XE0A 2NMQA 3ZJVA 2ZW1A 2N1VA 1PYWD 3AE6B 1TYGB 2OJWA 2KANA 1YJJA 2UWQA 1YX5B 2AL6A 2QHOA 1FRDA 2WXLA 1KJTA 4OZCA 2N7EA 1NYRA 2N9XA 1HA5A 2MCNB 3RULA 2XEWA 3DWMA 1N5XA 4OVVA 4TQ0A 3Q69A 2KTRA 1TKEA 4ZHOA 2IY0B 2QILA 3MHSD 4GDLA 3ZIMA 2L00B 2YEPF 5C1ZA 4LJOB 2NVUI 3AEAB 2WHIA 1N6ZA 1L4DB 4B0MA 3NVYA 3RNBC 2AEHA 3GB1A 3O65B 2KTRB 3A33B 2W82A 3P4QB 2L52A 3H7SA 4KVGB 3PRZA 1L0VB 4M8NA 4JE3B 5JZEB 3N1YC 4N58A 3BIID 3FAHA 4DDGD 3RNGC 1E9MA 1AYFA 4RM8A 3ZGZA 5DPWA 1SEBD 2K39A 4BOZB 2G1EA 1WGHA 2OHFA 1Z5SB 2OOBB 1X1MA 3OAWA 3VH4B 2N4FA 3TMPB 4MGIE 3ABVB 1MPEA 2W55A 3VTUA 1E8ZA 3HVDA 3U4EG 5IN7A 2JZ3B 2K6QA 3VR8B 3NJTA 2MBBB 4KZ0A 4NPNA 3M95A 3RT3B 2WXOA 4ZOHC 4WQOB 4HPMB 2Y5BB 3A9KB 1K8RB 4MJSA 4REZA 1UUPA 1IP9A 4IUMB 1BUIC 2KDBA 1EU3A 1OQQA 1UELA 2GLSA 4I6NB 2BS3B 4UDUC 1WXVA 3V6CB 1EU4A 2AYOB 3TCAA 4JL9A 2Z59B 3V60A 1R4MB 2ZEQA 1XLNA 2GOWA 3H9DA 4MSQB 3BYYB 2KMCA 2H89B 3AULA 2R61A 2O2VA 4DBGA 2PE9A 5TR5A 2IGHA 1IGDA 3APCA 3JW0X 1FFUA 2NPTB 3RI7C 3W9CB 2KQSA 4JQWC 3UGBB 4KKIA 5EE1A 2MP2B 2N9PC 3S2AA 3A9KA 4DK5A 1C78A 3SFEB 4ARIA 1B9RA 4A55A 2L0TA 3EA6A 4OZBA 2Y5CA 2EKIA 3H1UA 1JRPA 2K8HA 3VRBB 1DOIA 2Z0EB 5D3DA 5EE9A 2WXKA 2WXNA 2Q5WD 4C4VA 3GE3C 3V6EB 5HI1A 3W5VB 2OEDA 3BZDB 3Q3OC 1QF6A 3L54A 2KT7A 5G5GA 3U7ZA 3TEZA 3RNEC 3PZ7A 2KJRA 3M3JA 3RYTA 2ASQA 4JLCA 2JXTA 3TUOA 2J42A 2IGGA 3MTNB 1WH3A 3KVFB 2WXJA 2JF5A 2JSVX 4BKSA 2C60A 1GG3A 3NZUA 1V1PB 1WXMA 3QIJA 4YSXB 1Q10A 1YD8U 4FXCA 2EMTA 2D3BA 1FXTB 4JIOU 1V80A 2DWQA 4MSMB 2C7MB 1F2RC 2KC2A 1GB4A 3ZDTA 2WU5B 2LHDA 2MRPA 4PS7A 2DYOA 1RFAA 2L0FA 1VLBA 2XBBC 3SR6A 4WWMA 3KW5B 3I3TB 3AE4B 3RPFC 1PQSA 4G11A 5KHQA 2GBNA 3DPDA 3PREA 2BYTA 1FFVA 2KJHB 2N0SB 3E56A 3OJ3A 3DHIC 3CWIA 1T0RC 2MBOA 3VHTC 1DOYA 3MC9A 4MM3B 1F9JA 2BB6A 4FA6A 5D2MB 3NRZA 3EHVA 2DHZA 2WP9B 1GPXA 4WH4A 1D4BA 3OJ4B 1HEZE 4HPLB 1WI0A 3V05A 4ZYNA 2J0KA 1UNSA 2KQ7A 4A3PA 4RCOA 1WZ0A 1QLBB 2IY1B 1FEHA 2IZVB 5C3JB 1WRDB 4AJYB 1IPGA 2C9WB 2IO1B 2KLGA 3QX1A 1K52A 2KFJA 1WFYA 3ZXRA 2G4SA 4RGMA 3TEXA 2ZNVB 1WYWB 1VZ7A 3DBHI 3AEDB 4M8MA 1P9DU 4Q2JA 2ZCCA 1L5PA 2Z0DB 1GC6A 2KN4A 5C2TB 2QDFA 2WXMA 5FR3A 4DWFA 2WDVB 4MGZE 1ZKHA 1LQBA 3A4RA 4M02A 3LXFA 5MPOA 2REXA 2DX5B 3WAOA 2NPTA 2GMIC 3GZNB 2WXQA 2KK8A 3AECB 1YQBA 4DDID 3AXCA 3QWZB 1I42A 1HZ5A 2KDMA 2V4LA 3NUHB 4GDKA 1YX6B 3V61A 2W3SA 1N62A 4IG7B 2LJIA 2R2OA 1TY2A 1QOAA 2B3AA 2CHXA 1WGDA 2ZCBA 1AARA 1OEYJ 4WURA 3H8HA 1RAXA 5CHVC 4KV2A 4ZRPA 4DHZB 1YOVB 1ZGUB 4YTMB 5EDSA 4AJWA 2PTLA 5EE3A 4FJZA 1C4AA 2LXAA 3VDZA 4P1CC 1RLFA 4HROA 4JGHB 3L08A 5D94A 1U4AA 5BO4B 1I4PA 1ZW7A 2FAZA 3VXWA 2BB5A 1CK1A 1GUAB 3AE2B 3AV8A 3DHHC 3PT2B 3N1XC 4LNKA 1OQRA 5CX3A 5HKHA 3DVNU 1V9JA 5KHOA 2AL3A 4IOIE 1P7EA 5LNK1 3H7PB 3B9JA 4P6VF 1FNUA 1ISNA 1DOXA 3HUIA 4B0EA 2ONQA 4LLGM 2K22A 3VRAB 5LXIB 1XLOA 4EFOA 4ICVA 4HPPA 3WIMA 2MSED 1SJED 3WAPA 1YN3A 4MGKE 3ZXVA 3IBEA 4EE2A 3V62A 2BYEA 4XX5A 4II3B 2JWUA 2MJEA 3NHEB 1NDDA 4XZ4A 3EFCA 1TIFA 4B95A 4W9GA 4JPSA 3AEEB 4GB9A 2HE7A 4WWPA 4DXGA 4WWOA 4C56C 4WWNA 2BBCA 1WGYA 1WXQA 3R7QA 4K81A 2JX5A 3P42A 4YWGG 4EZKA 2DZJA 3A9JB 5E6OA 5BMIA 3QARA 2J52A 3NVWA 2MP2A 2M4NA 4E3CA 1SXTA 5JHBA 2KFKB 2KKCA 3TSSA 1N5WA 1WSPA 2MH7A 2WNMA 1RWSA 1VDVA 4GOCA 3NZSA 3AEBB 3P1MA 3ML9A 4RM9A 4ZRIA 1QQRA 2J0JA 2RD0A 3AN1A 3HM6X 4M01A 1RRBA 3Q2AC 4AQ7A 2BS2B 3BK1A 1VZ6A 1LO5D 3MHZA 2MA9B 2MHJA 2IO3B 1L4ZB 4NQLB 4EZJA 4RGNA 4TKNA 4EOYA 3BVGA 3WANA 3A9JA 2I1KA 3IXSA 1V6EA 1ACCA 2DYBA 3KQ4A 1C3TA 3GP7A 4DXFA 1J7AA 1WE6A 1JRUA 4ANVA 3U8ZA 4GSWA 3FKYA 2DYMA 4WJQA 1YJ1A 2G9HD 2V3SA 3DBHB 4MELA 1PGXA 3I9V1 2FCQA 3MC8A 5BMHA 2AQ1B 2WLBA 1GNUA 2DAFA 3RFZB 1UGJA 3EUB2 4DHJB 1I4QA 2D5GA 2JPHA 1E5WA 1WIAA 2J53A 4WJNA 4HLEA 4M0WB 1R7SA 1V1PA 3MP9A 5IA7A 4HRSA 1J8CA 4NNJB 1LM8B 2LZ6A 2JVCA 2RGFA 5L95C 3BVZA 2JWZA 1L0XB 4HEA1 4KSKC 3ZNID 1GJZA 3LJ3A 2PKOA 3KYDD 2VRRB 2K3UA 3VFKA 2FCMA 2INNE 4MJSB 3VTWA 4PK1A 2G4DB 2L05A 4FHKA 4L23A 2D3GA 4FJYA 1ESFA 2NR2A 3N30A 1AW7A 3N32A 1S3SG 3ZNZB 3QHTA 2PEAA 5BYSA 4MACA 4NAWB 5BYRA 5IO9A 4MM3A 1Q5WB 3DBRB 3Q8CA 1QKZA 4CHKA 1KLUD 3AI5A 1XCQL 3HK0A 4N6EB 2WXRA 4PYZA 2V0GA 5J18A 2L3ZA 4LCDE 3NS8A 2FNJB 2KC1A 1GB1A 2LEKA 4RF1A 1TZOA 4MDKE 1UF0A 4C4VB 3KWLA 3P2BA 1T5XD 1YQ4B 2D3CA 3ZNGC 2CU1A 3PRPB 1I4HA 4GXBA 1WZ3A 1YIWA 3DDCB 5HFYA 4K7WA 4FHJA 3VAWA 4TMAB 1I4GA 2L83A 3PPAA 2PW9A 4BBNC 3PGEA 3H6NA 1XQQA 3UIOB 1M94A 1E7VA 4KX6B 2LHEA 2O6VB 3C0RB 4J3OD 2MJDA 1CZPA 4WAAA 1FO4A 1I4XA 3C19A 4LDTB 3W2DA 4LTUA 3E9SA 1D3ZA 2WYQA 4G50A 2E3TA 2RMMA 3L4PA 3AE3B 4EEWA 5AUIA 4C7YA 4HDQA 4ZYSA 3A1QA 2INDC 3EECA 4EKUA 4XWWA 3IAM1 1PGAA 3PS6A 4ZRKA 1E6EB 1WX7A 3FILA 4JWSC 5G5HA 2IO0B 2WX0A 2LGYA 2QJLA 1SB3C 4BKTA 2M0AA 3AE9B 5FK9C 3ZNHB 3KH0A 3P4PB 2CS4A 3L10B 2CHZA 1MFWA 3Q6BA 1WWTA 2JXXA 3ZVVA 2V1YA 1V97A 2VH1A 1VR9A 2DZMA 4W9DA 4IKGA 3UQBA 3DQVA 4TV3A 2KX3A 3EGRA 2BT6A 2BYFA 2BQQA 3IG3A 1TY0A 1FRRA 3Q3NC 1VD2A 1JW9D 1WR6E 1XXGA 2XK5A 4JX1C 1IBXB 2ZPYA 1QOBA 2MLBA 3KUZA 3VR9B 4S17A 2D10A 3T3OA 2QIEB 2LMCA 1SE3A 3NZ3A 3NY5A 3QQ8B 2WGSA 2LI5A 5L83A 1C77A 4HCPB 3UQAA 2AQ2B 4F1SA 1HZ6A 1J7CA 3ZJUA 1K50A 3VVWB 1WJUA 1TKGA 3IFWB 5I4DA 1JWSD 1YQ3B 2JQRB 2PPHA 2M8SA 4NZLB 1DYQA 3FILB 2LUEA 5JHAA 3URYA 4YTPB 5AUKA 4TUUA 2EMSA 4BFRA 1BMLC 2LVQA 4AWJA 5CHWA 3KUCB 2FCNA 2D07B 2UYZB 3ZDMC 3VUXA 4BKSD 3T8MA 2KQ4X 1TS3A 2NTTA 1NI2A 3JSVB 4QAYA 5IKCM 2KVZA 2FUG1 2KWDA 2QEJC 1TT5B 3QAQA 4ITKA 1Q0WB 2WXIA 3DBLB 4LNNA 4K7UA 3WCQA 1T3QA 2DZIA 2G3QB 4XGAB 2PVGC 1KLGD 4GDKB 3ZLZA 1IYFA 1SIFA 1TS4A 4FULA 4RF0A 3UINB 1UGMA 3X23A 3AEFB 1D5MC 1WM3A 1DGJA 2VZKD 3ZTCA 1I7HA 1WGRA 3ZUNA 4IM2A 3B2FA 1L0YB 2OJRA 3RZWC 1Y8RC 3Q8AA 1XF5L 4YT0B 2KWUB 5DPSA 2GBMA 2PLPA 2LVPA 2M1MA 2XNAC 2A4ZA 4ZRQA 3C8YA 1JWUD 3N3KB 4S0RA 2LJ5A 5C23A 1FNWA 1H8CA 5D3IB 2RPVA 2KAJA 1SIJA 1SE2A 4IDIA 3BK2A 2IPKD 4WAFA 3PTFC 3LDZE 1MVKA 3PRMB 2KDFB 4FN2A 1T6BX 4A3OA 4XDCA 2D11A 3ALBA 2GBJA 3TL5A 2BTEA 2Z8LA 2BW2A 3BWUD 3R66C 3W1YA 2RDHA 4DHJD 1FMAD 4AUQC 2INPE 3OLMD 2LRUA 2LVOA 3L16A 2ZVOA 4XDDA 1F52A 4W9IA 1PDXA 2M0XA 2H88B 1JROA 3P4RB 1WF9A 1XD3B 5DPRA 2D2QA 1STEA 1E8YA 1NENB 1YNTE 1F0ZA 4US9A 4P7IA 2JYEA 2K5PA 3IAS1 3HRDD 2JZZA 3O13A 4KIKB 4IWPA 2ACZB 2JU6X 2LGDA 5LLIA 4DXAB 3AMZA 1P98A 1V49A
chains in the Genus database with same CATH topology
2KDBA 3L13A 4BBNF 2MW5A 3JVZX 1WE6A 1JRUA 4GDLB 2KNBA 3R3MA 4GSWA 4OVUA 5E6PA 4GU2A 3U8ZA 4ANVA 2DYMA 1UELA 2L8JA 4WJQA 1YJ1A 2ZNVC 2J0MA 4I6NB 2BYVE 2V3SA 2C5LC 4MELA 1WXVA 1P0RA 4KDLB 4GGQA 3QJZA 4TQ1A 3V6CB 3TCAA 2AYOB 4JL9A 2Z59B 3V60A 2FCQA 1EF1A 2ZEQA 1J0GA 2GOWA 3H9DA 1OTRB 3JSVA 4MSQB 1WY8A 1OGWA 1XT9B 1GNUA 2DAFA 2KMCA 3B0AA 1EF5A 3AULA 2O2VA 2CR5A 3DBSA 4DBGA 3H7PA 3ZRFA 1I35A 2RSUA 2PE9A 4IW0A 5TR5A 5CTRC 4BKGA 4DHJB 3APCA 3JW0X 2NPTB 4FLHA 2N7DA 3DVNV 2JPHA 2KQSA 4JQWC 3UGBB 4PS3A 2KDEB 1T0YA 2JY6A 2MP2B 4GN1A 4LDTD 2N9PC 2O2VB 4K1RB 1E5WA 1WIAA 2KLCA 4WJNA 4HLEA 3Q3FA 3S2AA 2K8CA 3A9KA 4KIKA 2JT4B 2LASA 4M0WB 4DK5A 5G55A 5IA7A 3U7DA 3RD2A 2L0TA 3CMMB 3H1UA 2K8HA 4HJKA 3DBLI 4I6PA 3L0WB 4NNJB 1J8CA 1LM8B 2LZ6A 2JVCA 2RGFA 3QCAA 5L95C 1WR1A 2JWZA 2L7RA 5GMVA 4KSKC 3ZNID 3K9PB 1GJZA 4BOSC 5E6NA 2AWTA 2Z0EB 3ZO5B 1VCBA 2HD5B 4II2B 1BT0A 3LJ3A 3V6EB 1H4RA 3PV1A 2MBQA 3ML8A 3KYDD 4IM0A 3DVGX 2VRRB 2MQJA 4IWQA 2KMAA 2M17A 1G6JA 1EUVB 2MX2A 1KM7A 2FCMA 1Z2MA 3Q3JA 3VFKA 3L54A 2C7NB 4MJSB 3VTVA 3VTWA 2LD9A 2G4DB 2L05A 4FHKA 4ANWA 1CMXB 2G45B 4FJVB 2D3GA 4FJYA 1UH6A 2NR2A 3GOEA 1E90A 3N30A 1V86A 2PE6B 3N32A 1S3SG 2J7QB 2KJRA 3M3JA 3RYTA 3ZNZB 2ASQA 4KZCA 3M63B 4JLCA 4DHZE 3EC8A 3SHQA 1TBEA 3PLVA 3QHTA 2PEAA 4NAWB 3MTNB 2KWVB 4W9LA 1WH3A 1Q5WB 4MM3A 3KVFB 3SDLC 2JF5A 3IHPC 2KFKA 3AI5A 2WDTB 4CHKA 4BKSA 2C60A 3HK0A 1GG3A 3NZUA 1WXMA 3QIJA 4PYZA 4W9KA 4W9HA 4HVBA 1YD8U 2ZPNA 2LWPA 1TGZB 2RPQA 4F8CB 2K1FA 5J18A 5J17A 4CYEA 4X57B 2EMTA 1GC7A 3SU8X 2O6VD 4NQKE 1FXTB 4JIOU 1V80A 2L3ZA 4MSMB 2C7MB 3NS8A 2FNJB 2KC1A 4LCDE 5G2NA 2KC2A 3KUDB 5CHFA 1WXSA 3ZW3A 4MDKE 3ZDTA 2KZRA 4E71A 2W9NA 4W9JA 1LXDA 2NS5A 3P2BA 5DPTA 3UIPB 2MRPA 4PS7A 2KHWB 2DYOA 3ZNGC 2CU1A 3PRPB 4GXBA 1RFAA 1WZ3A 1YIWA 2L0FA 3DDCB 2NBVB 2XBBC 1KLVA 4EUTA 4K7WA 1E8WA 4FHJA 2IO2B 3A1QB 3AU4A 3VAWA 3KW5B 5AEKB 3I3TB 4NAWA 2C7HA 3PPAA 1PQSA 4G11A 5KHQA 2GBNA 1UBQA 2FIFA 3DPDA 3PREA 5AZGA 3W1SA 4BBNC 3KYCD 3PGEA 2K6DB 3H6NA 1XQQA 3JYUA 4NJ6A 3UIOB 1M94A 4W9EA 2KJHB 2N1WA 2FIDA 2GBRA 3OJ3A 1E7VA 1E8XA 2MBHA 2MBOA 3HHMA 5IAAC 4B9KA 1UBIA 3WALA 3VHTC 2O6VB 3APFA 3C0RB 3ZRCA 1F9JA 4WAAA 4LJPB 4FA6A 3W1SC 4IC7B 3TIXA 1C1YB 1EO6A 1J19A 4NY0A 5D2MB 3EHVA 4LDTB 5J2RA 2DHZA 3CF6E 4ANUA 1D3ZA 2WYQA 4G50A 2BKFA 4FADA 2RR9A 4W9FA 3OJ4B 2ZJDA 3MJWA 4HPLB 4EEWA 1WI0A 4HDQA 4ZYNA 2J0KA 1V5OA 3A1QA 3PVLA 2KQ7A 4A3PA 1WZ0A 3APDA 2R2QA 3EECA 4EKUA 1A5RA 2IY1B 2IYDB 3CSTA 1HE8A 3PS6A 2IZVB 4ZRKA 1WX7A 2HJ8A 2IO0B 2WX0A 2LGYA 2PJHA 4J6IA 1WJ6A 1WRDB 2FCSA 1IPGA 2C9WB 2EKEC 2IO1B 2KLGA 3BY4B 3QX1A 3RUIB 4BKTA 3ECIA 1SE9A 2XK5B 3ZNHB 1WX8A 3HM3A 3QA8A 2KFJA 3KH0A 1WFYA 3DVGY 3VUWA 3DBRI 2CS4A 2G4SA 3L10B 2CHZA 3QK0A 1WMHB 2ZNVB 1WYWB 3DBHI 4AJYB 4M8MA 1P9DU 2CKHB 2ZCCA 4WJPA 2JXXA 4B6WA 1SGHA 2LRWA 2Z0DB 1L2NA 2LGXA 4GMVA 1GC6A 3ZVVA 2V1YA 4MGYE 2WWZA 2JRHA 2KJ6A 2DZMA 1E7UA 3B1LX 4W9DA 3UQBA 1WJNA 3DQVA 4TV3A 4DWFA 4MGZE 1P1AA 1ZKHA 4ZRJA 5JH5C 3M62B 4YL8A 2KX3A 1LQBA 1WJ4A 3A4RA 2KN5A 2NCNA 2DX5B 2REXA 4HK2A 3WAOA 2NPTA 4HDOA 2BYFA 2GMIC 4IM3A 2BF8B 3IG3A 2KK8A 5DCNA 1YQBA 4DDID 3AXCA 4HXDA 1QZEA 1VD2A 1WR6E 2XK5A 3QWZB 2ZPYA 4WJOA 3T9LA 1I42A 2A5UA 1LFDA 2MLBA 3KUZA 2V4LA 4HWIB 5AZFA 4GDKA 1YX6B 3V61A 2FUHB 3RZFA 4GIVA 4IG7B 1WMHA 2D10A 4KSLC 2R2OA 4BVUC 3R7RA 2B3AA 2YLMA 2CHXA 3NY5A 3QQ8B 1WGDA 2KTFA 2ZCBA 2LI5A 3A4SC 3DOWA 5L83A 1AARA 1OEYJ 3TJPA 1WE7A 1RAXA 5CHVC 4HCPB 4KV2A 1WX9A 3D32A 4G0NB 3UQAA 4DHZB 1ZGUB 4F1SA 5EDSA 2BGFA 4CO7A 4AJWA 1UD7A 4F7ZA 2K8BA 4FJZA 3VVWB 4ANXA 1WJUA 2LXAA 2MWSB 3IFWB 1TZ1A 3VDZA 1RLFA 3SD5A 1Q1OA 4JGHB 3L08A 1NBFC 3QC8B 2DZKA 2PPHA 1U4AA 2M8SA 5D94A 4MH0E 4NJ7A 3WA0A 4ASWC 1V5TA 2NBUA 5BO4B 2LUEA 3PZDA 5JHAA 1S1QB 1WGGA 2NBWB 2WX1A 1ZW7A 1UZXB 2FAZA 3DCGA 3VXWA 1GUAB 4TUUA 2EMSA 3ONSA 4BFRA 2KXJA 2JRIB 2LVQA 1KOTA 3GZNI 4AWJA 5CHWA 1MG8A 3KUCB 3PT2B 4I6LB 2FCNA 3PHWB 2D07B 1OQYA 2GBKA 2UYZB 3ZDMC 3VUXA 4BKSD 4EZLA 4KDIC 3T8MA 4MEMA 5CX3A 5HKHA 3B08A 2BWFA 5D7GA 5LXHA 3DVNU 1V9JA 1NI2A 4K7SA 4PS8A 3CSFA 4AP4C 1R4NI 3JSVB 2O6VA 5KHOA 1V81A 2AL3A 2BPSA 5D6JB 3ZTDA 4AOFA 1R4MI 2KWCA 2DAJA 4N9F4 4PYUA 4E74A 3QAQA 3H7PB 1WXAA 2IBIB 3EFUA 1Q0WB 4XC2A 4K7UA 4A20A 3PHXB 1TTNA 2DZIA 2G3QB 1ISNA 4GDKB 3ZKJC 2N9EB 2N1VA 4ZDVA 2ZZPB 3ZLZA 3IVFA 1IYFA 1OEYA 2KOXA 1SIFA 2KANA 5LXIB 4FULA 3UINB 2UWQA 4EFOA 2KDIA 1UGMA 4ICVA 2CHWA 3X23A 3WIMA 2MSED 1WM3A 5FR6A 1YX5B 3WAPA 2KX0A 3ZTCA 4FBJB 2AL6A 1WGRA 3K9OB 3ZUNA 4IM2A 2QHOA 4ICUA 4MGKE 3IBEA 2OJRA 2YVCA 3RZWC 3V62A 3L17A 2BYEA 1KJTA 4XX5A 4II3B 3VQIA 1Y8RC 3NOBA 2N7EA 3WAMA 2ZVNA 3BINA 2N9XA 3NHEB 2MCNB 2KWUB 3RULA 1L7YA 5DPSA 2XEWA 1NDDA 2GBMA 4XZ4A 4OVVA 4TQ0A 2LVPA 2M1MA 2A4ZA 2KTRA 3ENEA 2IY0B 3MHSD 4GDLA 3ZIMA 4W9GA 2L00B 4B95A 2LXCA 3N3KB 5C1ZA 2LJ5A 4LJOB 2NVUI 5C23A 1H8CA 3TBLD 4GB9A 3AU5A 2HE7A 4WWPA 4WWOA 2L76A 3HIZA 3X0WA 4WWNA 3VH3B 1WGYA 3PTFC 2AEHA 3LDZE 3O65B 3RCZA 2KTRB 3R7QA 3A33B 4K81A 2HTHA 2JUOA 2KVRA 3H7SA 3PRMB 3UF8A 4EZKA 2DZJA 2KDFB 3PLUA 3PRZA 4FN2A 4KVGB 3A9JB 4A3OA 2D11A 5E6OA 3QARA 3ALBA 4M8NA 4URKA 5JZEB 2GBJA 2MP2A 2M4NA 2BKRB 3VUYA 4E3CA 3TL5A 2KD0A 2DENB 4DDGD 5JHBA 1WM2A 2KFKB 4RM8A 5DPWA 2KKCA 3R66C 5AZHA 3W1YA 4DHJD 2K39A 4BOZB 1WGHA 4AUQC 1P3QU 1Z5SB 2OOBB 4GOCA 3OLMD 3NZSA 2LRUA 1X1MA 2LVOA 3OAWA 3VH4B 3L16A 2ZVOA 2N4FA 4W9IA 3TMPB 4MGIE 3ML9A 4RM9A 2M0XA 4ZRIA 3VTUA 1WF9A 2J0JA 2RD0A 1XD3B 1E8ZA 3HM6X 5DPRA 2D2QA 1V2YA 1RRBA 4RMAA 2JZ3B 2K6QA 1E8YA 2BWES 4W9CA 2MBBB 2I1JA 4KZ0A 4NPNA 3M95A 2MA9B 2KO3A 2IO3B 3RT3B 3PSEB 4IWOA 4P7IA 4WQOB 4NQLB 4HPMB 4EZJA 4HCNB 4TKNA 4G3XB 2Y5BB 2JZZA 4EOYA 2K25A 3A9KB 4KIKB 1K8RB 3A9JA 2I1KA 4IWPA 3WANA 1V6EA 3U30A 4MJSA 2MBEA 2DYBA 2LGDA 5LLIA 1IP9A 4DXAB 4IUMB 1P98A 1C3TA 1V49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDB A;  3L13 A;  4BBN F;  2MW5 A;  3JVZ X;  1WE6 A;  1JRU A;  4GDL B;  2KNB A;  3R3M A;  4GSW A;  4OVU A;  5E6P A;  4GU2 A;  3U8Z A;  4ANV A;  2DYM A;  1UEL A;  2L8J A;  4WJQ A;  1YJ1 A;  2ZNV C;  2J0M A;  4I6N B;  2BYV E;  2V3S A;  2C5L C;  4MEL A;  1WXV A;  1P0R A;  4KDL B;  4GGQ A;  3QJZ A;  4TQ1 A;  3V6C B;  3TCA A;  2AYO B;  4JL9 A;  2Z59 B;  3V60 A;  2FCQ A;  1EF1 A;  2ZEQ A;  1J0G A;  2GOW A;  3H9D A;  1OTR B;  3JSV A;  4MSQ B;  1WY8 A;  1OGW A;  1XT9 B;  1GNU A;  2DAF A;  2KMC A;  3B0A A;  1EF5 A;  3AUL A;  2O2V A;  2CR5 A;  3DBS A;  4DBG A;  3H7P A;  3ZRF A;  1I35 A;  2RSU A;  2PE9 A;  4IW0 A;  5TR5 A;  5CTR C;  4BKG A;  4DHJ B;  3APC A;  3JW0 X;  2NPT B;  4FLH A;  2N7D A;  3DVN V;  2JPH A;  2KQS A;  4JQW C;  3UGB B;  4PS3 A;  2KDE B;  1T0Y A;  2JY6 A;  2MP2 B;  4GN1 A;  4LDT D;  2N9P C;  2O2V B;  4K1R B;  1E5W A;  1WIA A;  2KLC A;  4WJN A;  4HLE A;  3Q3F A;  3S2A A;  2K8C A;  3A9K A;  4KIK A;  2JT4 B;  2LAS A;  4M0W B;  4DK5 A;  5G55 A;  5IA7 A;  3U7D A;  3RD2 A;  2L0T A;  3CMM B;  3H1U A;  2K8H A;  4HJK A;  3DBL I;  4I6P A;  3L0W B;  4NNJ B;  1J8C A;  1LM8 B;  2LZ6 A;  2JVC A;  2RGF A;  3QCA A;  5L95 C;  1WR1 A;  2JWZ A;  2L7R A;  5GMV A;  4KSK C;  3ZNI D;  3K9P B;  1GJZ A;  4BOS C;  5E6N A;  2AWT A;  2Z0E B;  3ZO5 B;  1VCB A;  2HD5 B;  4II2 B;  1BT0 A;  3LJ3 A;  3V6E B;  1H4R A;  3PV1 A;  2MBQ A;  3ML8 A;  3KYD D;  4IM0 A;  3DVG X;  2VRR B;  2MQJ A;  4IWQ A;  2KMA A;  2M17 A;  1G6J A;  1EUV B;  2MX2 A;  1KM7 A;  2FCM A;  1Z2M A;  3Q3J A;  3VFK A;  3L54 A;  2C7N B;  4MJS B;  3VTV A;  3VTW A;  2LD9 A;  2G4D B;  2L05 A;  4FHK A;  4ANW A;  1CMX B;  2G45 B;  4FJV B;  2D3G A;  4FJY A;  1UH6 A;  2NR2 A;  3GOE A;  1E90 A;  3N30 A;  1V86 A;  2PE6 B;  3N32 A;  1S3S G;  2J7Q B;  2KJR A;  3M3J A;  3RYT A;  3ZNZ B;  2ASQ A;  4KZC A;  3M63 B;  4JLC A;  4DHZ E;  3EC8 A;  3SHQ A;  1TBE A;  3PLV A;  3QHT A;  2PEA A;  4NAW B;  3MTN B;  2KWV B;  4W9L A;  1WH3 A;  1Q5W B;  4MM3 A;  3KVF B;  3SDL C;  2JF5 A;  3IHP C;  2KFK A;  3AI5 A;  2WDT B;  4CHK A;  4BKS A;  2C60 A;  3HK0 A;  1GG3 A;  3NZU A;  1WXM A;  3QIJ A;  4PYZ A;  4W9K A;  4W9H A;  4HVB A;  1YD8 U;  2ZPN A;  2LWP A;  1TGZ B;  2RPQ A;  4F8C B;  2K1F A;  5J18 A;  5J17 A;  4CYE A;  4X57 B;  2EMT A;  1GC7 A;  3SU8 X;  2O6V D;  4NQK E;  1FXT B;  4JIO U;  1V80 A;  2L3Z A;  4MSM B;  2C7M B;  3NS8 A;  2FNJ B;  2KC1 A;  4LCD E;  5G2N A;  2KC2 A;  3KUD B;  5CHF A;  1WXS A;  3ZW3 A;  4MDK E;  3ZDT A;  2KZR A;  4E71 A;  2W9N A;  4W9J A;  1LXD A;  2NS5 A;  3P2B A;  5DPT A;  3UIP B;  2MRP A;  4PS7 A;  2KHW B;  2DYO A;  3ZNG C;  2CU1 A;  3PRP B;  4GXB A;  1RFA A;  1WZ3 A;  1YIW A;  2L0F A;  3DDC B;  2NBV B;  2XBB C;  1KLV A;  4EUT A;  4K7W A;  1E8W A;  4FHJ A;  2IO2 B;  3A1Q B;  3AU4 A;  3VAW A;  3KW5 B;  5AEK B;  3I3T B;  4NAW A;  2C7H A;  3PPA A;  1PQS A;  4G11 A;  5KHQ A;  2GBN A;  1UBQ A;  2FIF A;  3DPD A;  3PRE A;  5AZG A;  3W1S A;  4BBN C;  3KYC D;  3PGE A;  2K6D B;  3H6N A;  1XQQ A;  3JYU A;  4NJ6 A;  3UIO B;  1M94 A;  4W9E A;  2KJH B;  2N1W A;  2FID A;  2GBR A;  3OJ3 A;  1E7V A;  1E8X A;  2MBH A;  2MBO A;  3HHM A;  5IAA C;  4B9K A;  1UBI A;  3WAL A;  3VHT C;  2O6V B;  3APF A;  3C0R B;  3ZRC A;  1F9J A;  4WAA A;  4LJP B;  4FA6 A;  3W1S C;  4IC7 B;  3TIX A;  1C1Y B;  1EO6 A;  1J19 A;  4NY0 A;  5D2M B;  3EHV A;  4LDT B;  5J2R A;  2DHZ A;  3CF6 E;  4ANU A;  1D3Z A;  2WYQ A;  4G50 A;  2BKF A;  4FAD A;  2RR9 A;  4W9F A;  3OJ4 B;  2ZJD A;  3MJW A;  4HPL B;  4EEW A;  1WI0 A;  4HDQ A;  4ZYN A;  2J0K A;  1V5O A;  3A1Q A;  3PVL A;  2KQ7 A;  4A3P A;  1WZ0 A;  3APD A;  2R2Q A;  3EEC A;  4EKU A;  1A5R A;  2IY1 B;  2IYD B;  3CST A;  1HE8 A;  3PS6 A;  2IZV B;  4ZRK A;  1WX7 A;  2HJ8 A;  2IO0 B;  2WX0 A;  2LGY A;  2PJH A;  4J6I A;  1WJ6 A;  1WRD B;  2FCS A;  1IPG A;  2C9W B;  2EKE C;  2IO1 B;  2KLG A;  3BY4 B;  3QX1 A;  3RUI B;  4BKT A;  3ECI A;  1SE9 A;  2XK5 B;  3ZNH B;  1WX8 A;  3HM3 A;  3QA8 A;  2KFJ A;  3KH0 A;  1WFY A;  3DVG Y;  3VUW A;  3DBR I;  2CS4 A;  2G4S A;  3L10 B;  2CHZ A;  3QK0 A;  1WMH B;  2ZNV B;  1WYW B;  3DBH I;  4AJY B;  4M8M A;  1P9D U;  2CKH B;  2ZCC A;  4WJP A;  2JXX A;  4B6W A;  1SGH A;  2LRW A;  2Z0D B;  1L2N A;  2LGX A;  4GMV A;  1GC6 A;  3ZVV A;  2V1Y A;  4MGY E;  2WWZ A;  2JRH A;  2KJ6 A;  2DZM A;  1E7U A;  3B1L X;  4W9D A;  3UQB A;  1WJN A;  3DQV A;  4TV3 A;  4DWF A;  4MGZ E;  1P1A A;  1ZKH A;  4ZRJ A;  5JH5 C;  3M62 B;  4YL8 A;  2KX3 A;  1LQB A;  1WJ4 A;  3A4R A;  2KN5 A;  2NCN A;  2DX5 B;  2REX A;  4HK2 A;  3WAO A;  2NPT A;  4HDO A;  2BYF A;  2GMI C;  4IM3 A;  2BF8 B;  3IG3 A;  2KK8 A;  5DCN A;  1YQB A;  4DDI D;  3AXC A;  4HXD A;  1QZE A;  1VD2 A;  1WR6 E;  2XK5 A;  3QWZ B;  2ZPY A;  4WJO A;  3T9L A;  1I42 A;  2A5U A;  1LFD A;  2MLB A;  3KUZ A;  2V4L A;  4HWI B;  5AZF A;  4GDK A;  1YX6 B;  3V61 A;  2FUH B;  3RZF A;  4GIV A;  4IG7 B;  1WMH A;  2D10 A;  4KSL C;  2R2O A;  4BVU C;  3R7R A;  2B3A A;  2YLM A;  2CHX A;  3NY5 A;  3QQ8 B;  1WGD A;  2KTF A;  2ZCB A;  2LI5 A;  3A4S C;  3DOW A;  5L83 A;  1AAR A;  1OEY J;  3TJP A;  1WE7 A;  1RAX A;  5CHV C;  4HCP B;  4KV2 A;  1WX9 A;  3D32 A;  4G0N B;  3UQA A;  4DHZ B;  1ZGU B;  4F1S A;  5EDS A;  2BGF A;  4CO7 A;  4AJW A;  1UD7 A;  4F7Z A;  2K8B A;  4FJZ A;  3VVW B;  4ANX A;  1WJU A;  2LXA A;  2MWS B;  3IFW B;  1TZ1 A;  3VDZ A;  1RLF A;  3SD5 A;  1Q1O A;  4JGH B;  3L08 A;  1NBF C;  3QC8 B;  2DZK A;  2PPH A;  1U4A A;  2M8S A;  5D94 A;  4MH0 E;  4NJ7 A;  3WA0 A;  4ASW C;  1V5T A;  2NBU A;  5BO4 B;  2LUE A;  3PZD A;  5JHA A;  1S1Q B;  1WGG A;  2NBW B;  2WX1 A;  1ZW7 A;  1UZX B;  2FAZ A;  3DCG A;  3VXW A;  1GUA B;  4TUU A;  2EMS A;  3ONS A;  4BFR A;  2KXJ A;  2JRI B;  2LVQ A;  1KOT A;  3GZN I;  4AWJ A;  5CHW A;  1MG8 A;  3KUC B;  3PT2 B;  4I6L B;  2FCN A;  3PHW B;  2D07 B;  1OQY A;  2GBK A;  2UYZ B;  3ZDM C;  3VUX A;  4BKS D;  4EZL A;  4KDI C;  3T8M A;  4MEM A;  5CX3 A;  5HKH A;  3B08 A;  2BWF A;  5D7G A;  5LXH A;  3DVN U;  1V9J A;  1NI2 A;  4K7S A;  4PS8 A;  3CSF A;  4AP4 C;  1R4N I;  3JSV B;  2O6V A;  5KHO A;  1V81 A;  2AL3 A;  2BPS A;  5D6J B;  3ZTD A;  4AOF A;  1R4M I;  2KWC A;  2DAJ A;  4N9F 4;  4PYU A;  4E74 A;  3QAQ A;  3H7P B;  1WXA A;  2IBI B;  3EFU A;  1Q0W B;  4XC2 A;  4K7U A;  4A20 A;  3PHX B;  1TTN A;  2DZI A;  2G3Q B;  1ISN A;  4GDK B;  3ZKJ C;  2N9E B;  2N1V A;  4ZDV A;  2ZZP B;  3ZLZ A;  3IVF A;  1IYF A;  1OEY A;  2KOX A;  1SIF A;  2KAN A;  5LXI B;  4FUL A;  3UIN B;  2UWQ A;  4EFO A;  2KDI A;  1UGM A;  4ICV A;  2CHW A;  3X23 A;  3WIM A;  2MSE D;  1WM3 A;  5FR6 A;  1YX5 B;  3WAP A;  2KX0 A;  3ZTC A;  4FBJ B;  2AL6 A;  1WGR A;  3K9O B;  3ZUN A;  4IM2 A;  2QHO A;  4ICU A;  4MGK E;  3IBE A;  2OJR A;  2YVC A;  3RZW C;  3V62 A;  3L17 A;  2BYE A;  1KJT A;  4XX5 A;  4II3 B;  3VQI A;  1Y8R C;  3NOB A;  2N7E A;  3WAM A;  2ZVN A;  3BIN A;  2N9X A;  3NHE B;  2MCN B;  2KWU B;  3RUL A;  1L7Y A;  5DPS A;  2XEW A;  1NDD A;  2GBM A;  4XZ4 A;  4OVV A;  4TQ0 A;  2LVP A;  2M1M A;  2A4Z A;  2KTR A;  3ENE A;  2IY0 B;  3MHS D;  4GDL A;  3ZIM A;  4W9G A;  2L00 B;  4B95 A;  2LXC A;  3N3K B;  5C1Z A;  2LJ5 A;  4LJO B;  2NVU I;  5C23 A;  1H8C A;  3TBL D;  4GB9 A;  3AU5 A;  2HE7 A;  4WWP A;  4WWO A;  2L76 A;  3HIZ A;  3X0W A;  4WWN A;  3VH3 B;  1WGY A;  3PTF C;  2AEH A;  3LDZ E;  3O65 B;  3RCZ A;  2KTR B;  3R7Q A;  3A33 B;  4K81 A;  2HTH A;  2JUO A;  2KVR A;  3H7S A;  3PRM B;  3UF8 A;  4EZK A;  2DZJ A;  2KDF B;  3PLU A;  3PRZ A;  4FN2 A;  4KVG B;  3A9J B;  4A3O A;  2D11 A;  5E6O A;  3QAR A;  3ALB A;  4M8N A;  4URK A;  5JZE B;  2GBJ A;  2MP2 A;  2M4N A;  2BKR B;  3VUY A;  4E3C A;  3TL5 A;  2KD0 A;  2DEN B;  4DDG D;  5JHB A;  1WM2 A;  2KFK B;  4RM8 A;  5DPW A;  2KKC A;  3R66 C;  5AZH A;  3W1Y A;  4DHJ D;  2K39 A;  4BOZ B;  1WGH A;  4AUQ C;  1P3Q U;  1Z5S B;  2OOB B;  4GOC A;  3OLM D;  3NZS A;  2LRU A;  1X1M A;  2LVO A;  3OAW A;  3VH4 B;  3L16 A;  2ZVO A;  2N4F A;  4W9I A;  3TMP B;  4MGI E;  3ML9 A;  4RM9 A;  2M0X A;  4ZRI A;  3VTU A;  1WF9 A;  2J0J A;  2RD0 A;  1XD3 B;  1E8Z A;  3HM6 X;  5DPR A;  2D2Q A;  1V2Y A;  1RRB A;  4RMA A;  2JZ3 B;  2K6Q A;  1E8Y A;  2BWE S;  4W9C A;  2MBB B;  2I1J A;  4KZ0 A;  4NPN A;  3M95 A;  2MA9 B;  2KO3 A;  2IO3 B;  3RT3 B;  3PSE B;  4IWO A;  4P7I A;  4WQO B;  4NQL B;  4HPM B;  4EZJ A;  4HCN B;  4TKN A;  4G3X B;  2Y5B B;  2JZZ A;  4EOY A;  2K25 A;  3A9K B;  4KIK B;  1K8R B;  3A9J A;  2I1K A;  4IWP A;  3WAN A;  1V6E A;  3U30 A;  4MJS A;  2MBE A;  2DYB A;  2LGD A;  5LLI A;  1IP9 A;  4DXA B;  4IUM B;  1P98 A;  1C3T A;  1V49 A; 
#chains in the Genus database with same CATH topology
 3Q8F A;  4BBN F;  1AN8 A;  4GDL B;  3R3M A;  4OVU A;  4YTN B;  4ARC A;  4WQM A;  2IGD A;  4GGQ A;  4TQ1 A;  2LUM A;  1J0G A;  1EF1 A;  1OTR B;  2PIA A;  3B0A A;  1XEE A;  1EF5 A;  2CR5 A;  3DBS A;  3H7P A;  3ZRF A;  2RSU A;  1GOZ A;  1JCK B;  1D5Z C;  2QMT A;  4KGR A;  5CTR C;  4C00 A;  2QC8 A;  4FLH A;  2N7D A;  2KDE B;  4GN1 A;  1MHX A;  4K1R B;  2KLC A;  3I5J C;  4KIK A;  2JT4 B;  2LAS A;  4OVZ A;  3CMM B;  1CQV A;  3IT4 B;  4HJK A;  4PT5 A;  3DBL I;  4I6P A;  3L0W B;  3QCA A;  1WR1 A;  3UI3 A;  2L7R A;  3K9P B;  5E6N A;  1JWM D;  4II2 B;  1BT0 A;  1H4R A;  3PV1 A;  3ML8 A;  1FD6 A;  3DVG X;  2MQJ A;  4IWQ A;  2KMA A;  2WDQ B;  2M17 A;  1EUV B;  1C9F A;  3Q3J A;  3VTV A;  2C7N B;  1E7P B;  4ANW A;  4LNF A;  2G45 B;  4FJV B;  1VRA B;  1UH6 A;  1E90 A;  1V86 A;  2PE6 B;  5T8I A;  2J7Q B;  1E10 A;  3Q3M C;  2FBW B;  4DHZ E;  3SHQ A;  1TBE A;  2KWV B;  4W9L A;  5H92 C;  4LNI A;  2KFK A;  1GAQ B;  2WDT B;  4L1B A;  3R2T A;  4W9K A;  1TS5 A;  4USA A;  1SE4 A;  4W9H A;  4HVB A;  2ZPN A;  2LWP A;  1TGZ B;  2RPQ A;  2K1F A;  3SU8 X;  2O6V D;  4NQK E;  5G2N A;  3KUD B;  2IJ0 A;  1SJH D;  1WXS A;  3ZW3 A;  2KZR A;  4E71 A;  1EM7 A;  3ETR A;  1ET9 A;  1LXD A;  2NS5 A;  3UIP B;  4RFB A;  3ZQ4 A;  3AM9 A;  2NBV B;  1KLV A;  1E8W A;  2IO2 B;  1XLQ A;  3A1Q B;  5H8Y E;  4ACF A;  2C7H A;  1IBX A;  4OZA A;  2FIF A;  5AZG A;  3W1S A;  3KYC D;  4LK0 M;  1VZ8 A;  3JYU A;  4NJ6 A;  1ZP0 B;  2GBR A;  3AEG B;  4HKQ A;  2JZP A;  5IAA C;  2ICI A;  4B9K A;  3APF A;  2WU2 B;  3T3N A;  3ZRC A;  3W1S C;  4IC7 B;  1PGB A;  3TIX A;  1C1Y B;  1J19 A;  4NY0 A;  3IT6 B;  5J2R A;  4C7Z A;  2WXG A;  2BKF A;  1UWX A;  4FAD A;  4W9F A;  1VJK A;  3PVL A;  3NVZ A;  3APD A;  1A5R A;  2SEB D;  1HE8 A;  1C4C A;  2GI9 A;  1BXT A;  2HJ1 A;  4J6I A;  2GB1 A;  2HJ8 A;  1XO3 A;  3BY4 B;  5IP4 D;  1F77 A;  1WX8 A;  3MC0 B;  1RM6 C;  3DVG Y;  1OFF A;  2WXF A;  3QK0 A;  2DNF A;  2X8X X;  2SAK A;  4RGO S;  3BYT B;  4WJP A;  1PFD A;  2K9X A;  1SGH A;  1L2N A;  2LGX A;  3U52 E;  2NTS A;  1E0Z A;  3AE5 B;  2Y3A A;  2JRH A;  2J4X A;  3RNC C;  3ZJT A;  2L1A A;  1P1A A;  4ZRJ A;  4XYC A;  4YL8 A;  1WJ4 A;  2KN5 A;  1HXY D;  2NCN A;  4HDO A;  2W3R A;  3SEB A;  2BF8 B;  5DCN A;  4KGS A;  4HXD A;  1MG4 A;  3AB5 A;  4WJO A;  3T9L A;  2MJ3 A;  2A5U A;  4RNA A;  4HWI B;  4GIV A;  1WMH A;  2M56 B;  4KSL C;  4RGT A;  1C4P A;  1Y56 A;  3Q14 C;  4BVU C;  3R7R A;  1WYG A;  2YLM A;  2I38 A;  2KTF A;  1ROE A;  4G0N B;  2V3N A;  1UD7 A;  4F7Z A;  3Q8E A;  1YN5 A;  4ANX A;  3ZYY X;  1Q1O A;  3QC8 B;  4MH0 E;  3GS2 A;  1JAL A;  1V5T A;  3PZD A;  1S1Q B;  1WGG A;  4A6Q A;  1MI0 A;  2TSS A;  1NEK B;  2KXJ A;  1KOT A;  1I4R A;  3GZN I;  4BAX A;  3FC4 A;  2N9K A;  2N9L A;  4KKJ A;  3PHW B;  1OQY A;  2HDE A;  2YEP B;  4KDI C;  3B08 A;  2BWF A;  5D7G A;  5LXH A;  1FCC C;  4PS8 A;  4K7S A;  4AP4 C;  3I57 A;  3NS1 A;  3ZTD A;  2DAJ A;  4N9F 4;  4E74 A;  2IBI B;  3PHX B;  1TTN A;  2WDR B;  4CQN A;  2VH2 A;  2XN9 C;  3ZKJ C;  2N9E B;  1FCL A;  4ZDV A;  1QOF A;  2ZZP B;  4NJC A;  4K3B A;  3IVF A;  1OEY A;  2KOX A;  2Y5P A;  1A70 A;  5TSS A;  2KDI A;  2WQY B;  3GE8 C;  2CHW A;  3DHG C;  1XLP A;  5FR6 A;  1QT9 A;  2KX0 A;  4FBJ B;  3K9O B;  4ICU A;  4OHJ A;  5BMG A;  2YVC A;  3L17 A;  2E6X A;  2K0P A;  3VQI A;  1IGC A;  2ON8 A;  3NOB A;  3WAM A;  2QCZ A;  2ZVN A;  3BIN A;  3OG5 A;  1L7Y A;  1QOG A;  1WGK A;  2PVO D;  2V3P A;  3I63 C;  1N60 A;  2LFI A;  3ENE A;  3KLS X;  2LXC A;  3N1Z C;  2BS4 B;  3NVV A;  1LGR A;  3TBL D;  3AU5 A;  2L76 A;  3HIZ A;  1EWY C;  3X0W A;  1V1O A;  1K51 A;  3VH3 B;  1YJI A;  3RCZ A;  3TEY A;  1FPY A;  1SBB B;  2HTH A;  2JUO A;  2KVR A;  4R3D A;  3UF8 A;  3MFG A;  1C76 A;  3PLU A;  2DBY A;  2M19 A;  3N20 C;  1KFY B;  1ZDX A;  4URK A;  2BKR B;  3VUY A;  2KD0 A;  2DEN B;  2X38 A;  4OW0 A;  1WM2 A;  3RN9 C;  4P16 A;  5AZH A;  3Q8B A;  1IUE A;  2V9H A;  1P3Q U;  1R4N B;  1K53 A;  1WRI A;  1ZE3 D;  3AE1 B;  2LGS A;  3DWG C;  3R2I A;  1V2Y A;  4RMA A;  1RYJ A;  4A90 A;  2BWE S;  4W9C A;  2I1J A;  1EWC A;  1XCT L;  2KO3 A;  4YSY B;  3PSE B;  4IWO A;  1FXA A;  4HCN B;  4G3X B;  2K25 A;  1KF6 B;  3U30 A;  2MBE A;  2INC C;  3L13 A;  3AE7 B;  2MW5 A;  3JVZ X;  4A9A A;  2KNB A;  2AQ3 B;  2JYT A;  5E6P A;  4GU2 A;  2L8J A;  2ZNV C;  2J0M A;  2BYV E;  2C5L C;  3RMK C;  1P0R A;  4KDL B;  3QJZ A;  3KWV A;  2PMV A;  3JSV A;  1WY8 A;  1OGW A;  1XT9 B;  3SFD B;  5HG2 A;  3R8B A;  4AS1 A;  1ENF A;  1ZUD 2;  1I35 A;  1SSN A;  4IW0 A;  4BKG A;  1ZPS A;  3DVN V;  4PS3 A;  1T0Y A;  2JY6 A;  2VZK B;  4LDT D;  2L32 A;  2O2V B;  4M00 A;  3Q3F A;  2K8C A;  4N59 A;  5G55 A;  3U7D A;  3RD2 A;  1T0Q C;  2W54 A;  4RH6 A;  2RDB C;  5EE0 A;  5GMV A;  4BOS C;  1JML A;  2AWT A;  1L6V A;  3ZO5 B;  1PUT A;  4KGT A;  1VCB A;  2AX5 A;  2HD5 B;  5JXV A;  2LGI A;  5IOI A;  2MBQ A;  4IM0 A;  1T0S C;  1G6J A;  2MX2 A;  1KM7 A;  1Z2M A;  4DQO C;  1L6U A;  1N63 A;  2LD9 A;  1P7F A;  4L2Y A;  1HTO A;  1CMX B;  4YSZ B;  3P4S B;  3BVM A;  1ET6 A;  2ZW0 A;  2I2Y A;  3GOE A;  4M0W A;  3U2S C;  4KZC A;  3M63 B;  3EC8 A;  1TJE A;  3PLV A;  2GRI A;  4JWU C;  2UU7 A;  4P1B C;  3SDL C;  4D2K A;  3IHP C;  1FIQ A;  3AE8 B;  4C80 A;  4F8C B;  2V4I B;  5J17 A;  4CYE A;  4X57 B;  1GC7 A;  1UWM A;  2CU3 A;  4ZHP A;  1SF0 A;  5CHF A;  1NYQ A;  1JQ4 A;  2W9N A;  4W9J A;  3W5U B;  5DPT A;  5HHD G;  1V8C A;  2KHW B;  4K3C A;  1JWB D;  1QIL A;  1D5X C;  1NI3 A;  1AWD A;  4EUT A;  1RFK A;  4H2A A;  1KH0 A;  4BZA A;  5GXG B;  4MH8 A;  1D6E C;  3AU4 A;  4XWT A;  1FNV A;  5AEK B;  4NAW A;  1N61 A;  1JWA D;  1UBQ A;  2K6D B;  4W9E A;  2N1W A;  2FID A;  3LYY A;  1F1H A;  1E8X A;  2KYW A;  2MBH A;  3HHM A;  3OWE B;  4GLS C;  1UBI A;  3WAL A;  1FXI A;  2B76 B;  5BYQ A;  4LJP B;  2QSD A;  1EO6 A;  4US8 A;  2MEK A;  3CF6 E;  4ANU A;  2RR9 A;  1ZDV A;  1F2R I;  2ZJD A;  1FM0 D;  1KRH A;  3MJW A;  1V5O A;  3LB8 C;  2R2Q A;  1C79 A;  2IYD B;  3CST A;  3RNF C;  5E6J A;  2PJH A;  2WXP A;  1WJ6 A;  2FCS A;  2EKE C;  3RUI B;  3ECI A;  1SE9 A;  2XK5 B;  3HM3 A;  3QA8 A;  4NAM A;  3VUW A;  3DBR I;  2D3A A;  1HQR D;  1WMH B;  4MT5 A;  2CKH B;  2WXH A;  4B6W A;  2LRW A;  4GMV A;  2DLB A;  2N7J A;  2CJO A;  4MGY E;  2WWZ A;  2KJ6 A;  1E7U A;  1ZXI A;  3B1L X;  1WJN A;  5JH5 C;  3M62 B;  4HK2 A;  4IM3 A;  2HTM E;  1QZE A;  1HTQ A;  1MJD A;  4HJG E;  3NG0 A;  3AH7 A;  3MJ5 A;  1LFD A;  5AZF A;  3TEW A;  2FUH B;  3RZF A;  4WIP A;  3PO0 A;  1MHH E;  1J7B A;  3N9Y C;  1ZXH A;  1YN4 A;  3A4S C;  3DOW A;  4YXD B;  3TJP A;  4LNO A;  1WE7 A;  3B2G A;  4HKZ E;  1WX9 A;  3D32 A;  2FE8 A;  2BVC A;  2BGF A;  4CO7 A;  2K8B A;  3PZ8 A;  2MWS B;  1TZ1 A;  3SD5 A;  3RNA C;  1KTK A;  1NBF C;  2DZK A;  4NJ7 A;  3WA0 A;  4ASW C;  2NBU A;  2WX1 A;  1YMH E;  2NBW B;  4O1N A;  1UZX B;  3DCG A;  1B1Z A;  4TSS A;  3P63 A;  3ONS A;  2JRI B;  1MG8 A;  3V3X A;  4I6L B;  2EEL A;  2GBK A;  2KAC A;  1TS2 A;  4EZL A;  2IDY A;  2KMM A;  4MEM A;  2CJN A;  1NVI D;  3CSF A;  1R4N I;  3CIR B;  2O6V A;  1ZOY B;  1V81 A;  2BPS A;  4A8X C;  5FKA C;  3HVZ A;  5D6J B;  4AOF A;  3J9C A;  1R4M I;  2KWC A;  1TKY A;  4PYU A;  1M4V A;  2WS3 B;  1WXA A;  1CJE A;  3EFU A;  4XC2 A;  2RDG A;  4A20 A;  4XE0 A;  2NMQ A;  3ZJV A;  2ZW1 A;  2N1V A;  1PYW D;  3AE6 B;  1TYG B;  2OJW A;  2KAN A;  1YJJ A;  2UWQ A;  1YX5 B;  2AL6 A;  2QHO A;  1FRD A;  2WXL A;  1KJT A;  4OZC A;  2N7E A;  1NYR A;  2N9X A;  1HA5 A;  2MCN B;  3RUL A;  2XEW A;  3DWM A;  1N5X A;  4OVV A;  4TQ0 A;  3Q69 A;  2KTR A;  1TKE A;  4ZHO A;  2IY0 B;  2QIL A;  3MHS D;  4GDL A;  3ZIM A;  2L00 B;  2YEP F;  5C1Z A;  4LJO B;  2NVU I;  3AEA B;  2WHI A;  1N6Z A;  1L4D B;  4B0M A;  3NVY A;  3RNB C;  2AEH A;  3GB1 A;  3O65 B;  2KTR B;  3A33 B;  2W82 A;  3P4Q B;  2L52 A;  3H7S A;  4KVG B;  3PRZ A;  1L0V B;  4M8N A;  4JE3 B;  5JZE B;  3N1Y C;  4N58 A;  3BII D;  3FAH A;  4DDG D;  3RNG C;  1E9M A;  1AYF A;  4RM8 A;  3ZGZ A;  5DPW A;  1SEB D;  2K39 A;  4BOZ B;  2G1E A;  1WGH A;  2OHF A;  1Z5S B;  2OOB B;  1X1M A;  3OAW A;  3VH4 B;  2N4F A;  3TMP B;  4MGI E;  3ABV B;  1MPE A;  2W55 A;  3VTU A;  1E8Z A;  3HVD A;  3U4E G;  5IN7 A;  2JZ3 B;  2K6Q A;  3VR8 B;  3NJT A;  2MBB B;  4KZ0 A;  4NPN A;  3M95 A;  3RT3 B;  2WXO A;  4ZOH C;  4WQO B;  4HPM B;  2Y5B B;  3A9K B;  1K8R B;  4MJS A;  4REZ A;  1UUP A;  1IP9 A;  4IUM B;  1BUI C;  2KDB A;  1EU3 A;  1OQQ A;  1UEL A;  2GLS A;  4I6N B;  2BS3 B;  4UDU C;  1WXV A;  3V6C B;  1EU4 A;  2AYO B;  3TCA A;  4JL9 A;  2Z59 B;  3V60 A;  1R4M B;  2ZEQ A;  1XLN A;  2GOW A;  3H9D A;  4MSQ B;  3BYY B;  2KMC A;  2H89 B;  3AUL A;  2R61 A;  2O2V A;  4DBG A;  2PE9 A;  5TR5 A;  2IGH A;  1IGD A;  3APC A;  3JW0 X;  1FFU A;  2NPT B;  3RI7 C;  3W9C B;  2KQS A;  4JQW C;  3UGB B;  4KKI A;  5EE1 A;  2MP2 B;  2N9P C;  3S2A A;  3A9K A;  4DK5 A;  1C78 A;  3SFE B;  4ARI A;  1B9R A;  4A55 A;  2L0T A;  3EA6 A;  4OZB A;  2Y5C A;  2EKI A;  3H1U A;  1JRP A;  2K8H A;  3VRB B;  1DOI A;  2Z0E B;  5D3D A;  5EE9 A;  2WXK A;  2WXN A;  2Q5W D;  4C4V A;  3GE3 C;  3V6E B;  5HI1 A;  3W5V B;  2OED A;  3BZD B;  3Q3O C;  1QF6 A;  3L54 A;  2KT7 A;  5G5G A;  3U7Z A;  3TEZ A;  3RNE C;  3PZ7 A;  2KJR A;  3M3J A;  3RYT A;  2ASQ A;  4JLC A;  2JXT A;  3TUO A;  2J42 A;  2IGG A;  3MTN B;  1WH3 A;  3KVF B;  2WXJ A;  2JF5 A;  2JSV X;  4BKS A;  2C60 A;  1GG3 A;  3NZU A;  1V1P B;  1WXM A;  3QIJ A;  4YSX B;  1Q10 A;  1YD8 U;  4FXC A;  2EMT A;  2D3B A;  1FXT B;  4JIO U;  1V80 A;  2DWQ A;  4MSM B;  2C7M B;  1F2R C;  2KC2 A;  1GB4 A;  3ZDT A;  2WU5 B;  2LHD A;  2MRP A;  4PS7 A;  2DYO A;  1RFA A;  2L0F A;  1VLB A;  2XBB C;  3SR6 A;  4WWM A;  3KW5 B;  3I3T B;  3AE4 B;  3RPF C;  1PQS A;  4G11 A;  5KHQ A;  2GBN A;  3DPD A;  3PRE A;  2BYT A;  1FFV A;  2KJH B;  2N0S B;  3E56 A;  3OJ3 A;  3DHI C;  3CWI A;  1T0R C;  2MBO A;  3VHT C;  1DOY A;  3MC9 A;  4MM3 B;  1F9J A;  2BB6 A;  4FA6 A;  5D2M B;  3NRZ A;  3EHV A;  2DHZ A;  2WP9 B;  1GPX A;  4WH4 A;  1D4B A;  3OJ4 B;  1HEZ E;  4HPL B;  1WI0 A;  3V05 A;  4ZYN A;  2J0K A;  1UNS A;  2KQ7 A;  4A3P A;  4RCO A;  1WZ0 A;  1QLB B;  2IY1 B;  1FEH A;  2IZV B;  5C3J B;  1WRD B;  4AJY B;  1IPG A;  2C9W B;  2IO1 B;  2KLG A;  3QX1 A;  1K52 A;  2KFJ A;  1WFY A;  3ZXR A;  2G4S A;  4RGM A;  3TEX A;  2ZNV B;  1WYW B;  1VZ7 A;  3DBH I;  3AED B;  4M8M A;  1P9D U;  4Q2J A;  2ZCC A;  1L5P A;  2Z0D B;  1GC6 A;  2KN4 A;  5C2T B;  2QDF A;  2WXM A;  5FR3 A;  4DWF A;  2WDV B;  4MGZ E;  1ZKH A;  1LQB A;  3A4R A;  4M02 A;  3LXF A;  5MPO A;  2REX A;  2DX5 B;  3WAO A;  2NPT A;  2GMI C;  3GZN B;  2WXQ A;  2KK8 A;  3AEC B;  1YQB A;  4DDI D;  3AXC A;  3QWZ B;  1I42 A;  1HZ5 A;  2KDM A;  2V4L A;  3NUH B;  4GDK A;  1YX6 B;  3V61 A;  2W3S A;  1N62 A;  4IG7 B;  2LJI A;  2R2O A;  1TY2 A;  1QOA A;  2B3A A;  2CHX A;  1WGD A;  2ZCB A;  1AAR A;  1OEY J;  4WUR A;  3H8H A;  1RAX A;  5CHV C;  4KV2 A;  4ZRP A;  4DHZ B;  1YOV B;  1ZGU B;  4YTM B;  5EDS A;  4AJW A;  2PTL A;  5EE3 A;  4FJZ A;  1C4A A;  2LXA A;  3VDZ A;  4P1C C;  1RLF A;  4HRO A;  4JGH B;  3L08 A;  5D94 A;  1U4A A;  5BO4 B;  1I4P A;  1ZW7 A;  2FAZ A;  3VXW A;  2BB5 A;  1CK1 A;  1GUA B;  3AE2 B;  3AV8 A;  3DHH C;  3PT2 B;  3N1X C;  4LNK A;  1OQR A;  5CX3 A;  5HKH A;  3DVN U;  1V9J A;  5KHO A;  2AL3 A;  4IOI E;  1P7E A;  5LNK 1;  3H7P B;  3B9J A;  4P6V F;  1FNU A;  1ISN A;  1DOX A;  3HUI A;  4B0E A;  2ONQ A;  4LLG M;  2K22 A;  3VRA B;  5LXI B;  1XLO A;  4EFO A;  4ICV A;  4HPP A;  3WIM A;  2MSE D;  1SJE D;  3WAP A;  1YN3 A;  4MGK E;  3ZXV A;  3IBE A;  4EE2 A;  3V62 A;  2BYE A;  4XX5 A;  4II3 B;  2JWU A;  2MJE A;  3NHE B;  1NDD A;  4XZ4 A;  3EFC A;  1TIF A;  4B95 A;  4W9G A;  4JPS A;  3AEE B;  4GB9 A;  2HE7 A;  4WWP A;  4DXG A;  4WWO A;  4C56 C;  4WWN A;  2BBC A;  1WGY A;  1WXQ A;  3R7Q A;  4K81 A;  2JX5 A;  3P42 A;  4YWG G;  4EZK A;  2DZJ A;  3A9J B;  5E6O A;  5BMI A;  3QAR A;  2J52 A;  3NVW A;  2MP2 A;  2M4N A;  4E3C A;  1SXT A;  5JHB A;  2KFK B;  2KKC A;  3TSS A;  1N5W A;  1WSP A;  2MH7 A;  2WNM A;  1RWS A;  1VDV A;  4GOC A;  3NZS A;  3AEB B;  3P1M A;  3ML9 A;  4RM9 A;  4ZRI A;  1QQR A;  2J0J A;  2RD0 A;  3AN1 A;  3HM6 X;  4M01 A;  1RRB A;  3Q2A C;  4AQ7 A;  2BS2 B;  3BK1 A;  1VZ6 A;  1LO5 D;  3MHZ A;  2MA9 B;  2MHJ A;  2IO3 B;  1L4Z B;  4NQL B;  4EZJ A;  4RGN A;  4TKN A;  4EOY A;  3BVG A;  3WAN A;  3A9J A;  2I1K A;  3IXS A;  1V6E A;  1ACC A;  2DYB A;  3KQ4 A;  1C3T A;  3GP7 A;  4DXF A;  1J7A A;  1WE6 A;  1JRU A;  4ANV A;  3U8Z A;  4GSW A;  3FKY A;  2DYM A;  4WJQ A;  1YJ1 A;  2G9H D;  2V3S A;  3DBH B;  4MEL A;  1PGX A;  3I9V 1;  2FCQ A;  3MC8 A;  5BMH A;  2AQ1 B;  2WLB A;  1GNU A;  2DAF A;  3RFZ B;  1UGJ A;  3EUB 2;  4DHJ B;  1I4Q A;  2D5G A;  2JPH A;  1E5W A;  1WIA A;  2J53 A;  4WJN A;  4HLE A;  4M0W B;  1R7S A;  1V1P A;  3MP9 A;  5IA7 A;  4HRS A;  1J8C A;  4NNJ B;  1LM8 B;  2LZ6 A;  2JVC A;  2RGF A;  5L95 C;  3BVZ A;  2JWZ A;  1L0X B;  4HEA 1;  4KSK C;  3ZNI D;  1GJZ A;  3LJ3 A;  2PKO A;  3KYD D;  2VRR B;  2K3U A;  3VFK A;  2FCM A;  2INN E;  4MJS B;  3VTW A;  4PK1 A;  2G4D B;  2L05 A;  4FHK A;  4L23 A;  2D3G A;  4FJY A;  1ESF A;  2NR2 A;  3N30 A;  1AW7 A;  3N32 A;  1S3S G;  3ZNZ B;  3QHT A;  2PEA A;  5BYS A;  4MAC A;  4NAW B;  5BYR A;  5IO9 A;  4MM3 A;  1Q5W B;  3DBR B;  3Q8C A;  1QKZ A;  4CHK A;  1KLU D;  3AI5 A;  1XCQ L;  3HK0 A;  4N6E B;  2WXR A;  4PYZ A;  2V0G A;  5J18 A;  2L3Z A;  4LCD E;  3NS8 A;  2FNJ B;  2KC1 A;  1GB1 A;  2LEK A;  4RF1 A;  1TZO A;  4MDK E;  1UF0 A;  4C4V B;  3KWL A;  3P2B A;  1T5X D;  1YQ4 B;  2D3C A;  3ZNG C;  2CU1 A;  3PRP B;  1I4H A;  4GXB A;  1WZ3 A;  1YIW A;  3DDC B;  5HFY A;  4K7W A;  4FHJ A;  3VAW A;  4TMA B;  1I4G A;  2L83 A;  3PPA A;  2PW9 A;  4BBN C;  3PGE A;  3H6N A;  1XQQ A;  3UIO B;  1M94 A;  1E7V A;  4KX6 B;  2LHE A;  2O6V B;  3C0R B;  4J3O D;  2MJD A;  1CZP A;  4WAA A;  1FO4 A;  1I4X A;  3C19 A;  4LDT B;  3W2D A;  4LTU A;  3E9S A;  1D3Z A;  2WYQ A;  4G50 A;  2E3T A;  2RMM A;  3L4P A;  3AE3 B;  4EEW A;  5AUI A;  4C7Y A;  4HDQ A;  4ZYS A;  3A1Q A;  2IND C;  3EEC A;  4EKU A;  4XWW A;  3IAM 1;  1PGA A;  3PS6 A;  4ZRK A;  1E6E B;  1WX7 A;  3FIL A;  4JWS C;  5G5H A;  2IO0 B;  2WX0 A;  2LGY A;  2QJL A;  1SB3 C;  4BKT A;  2M0A A;  3AE9 B;  5FK9 C;  3ZNH B;  3KH0 A;  3P4P B;  2CS4 A;  3L10 B;  2CHZ A;  1MFW A;  3Q6B A;  1WWT A;  2JXX A;  3ZVV A;  2V1Y A;  1V97 A;  2VH1 A;  1VR9 A;  2DZM A;  4W9D A;  4IKG A;  3UQB A;  3DQV A;  4TV3 A;  2KX3 A;  3EGR A;  2BT6 A;  2BYF A;  2BQQ A;  3IG3 A;  1TY0 A;  1FRR A;  3Q3N C;  1VD2 A;  1JW9 D;  1WR6 E;  1XXG A;  2XK5 A;  4JX1 C;  1IBX B;  2ZPY A;  1QOB A;  2MLB A;  3KUZ A;  3VR9 B;  4S17 A;  2D10 A;  3T3O A;  2QIE B;  2LMC A;  1SE3 A;  3NZ3 A;  3NY5 A;  3QQ8 B;  2WGS A;  2LI5 A;  5L83 A;  1C77 A;  4HCP B;  3UQA A;  2AQ2 B;  4F1S A;  1HZ6 A;  1J7C A;  3ZJU A;  1K50 A;  3VVW B;  1WJU A;  1TKG A;  3IFW B;  5I4D A;  1JWS D;  1YQ3 B;  2JQR B;  2PPH A;  2M8S A;  4NZL B;  1DYQ A;  3FIL B;  2LUE A;  5JHA A;  3URY A;  4YTP B;  5AUK A;  4TUU A;  2EMS A;  4BFR A;  1BML C;  2LVQ A;  4AWJ A;  5CHW A;  3KUC B;  2FCN A;  2D07 B;  2UYZ B;  3ZDM C;  3VUX A;  4BKS D;  3T8M A;  2KQ4 X;  1TS3 A;  2NTT A;  1NI2 A;  3JSV B;  4QAY A;  5IKC M;  2KVZ A;  2FUG 1;  2KWD A;  2QEJ C;  1TT5 B;  3QAQ A;  4ITK A;  1Q0W B;  2WXI A;  3DBL B;  4LNN A;  4K7U A;  3WCQ A;  1T3Q A;  2DZI A;  2G3Q B;  4XGA B;  2PVG C;  1KLG D;  4GDK B;  3ZLZ A;  1IYF A;  1SIF A;  1TS4 A;  4FUL A;  4RF0 A;  3UIN B;  1UGM A;  3X23 A;  3AEF B;  1D5M C;  1WM3 A;  1DGJ A;  2VZK D;  3ZTC A;  1I7H A;  1WGR A;  3ZUN A;  4IM2 A;  3B2F A;  1L0Y B;  2OJR A;  3RZW C;  1Y8R C;  3Q8A A;  1XF5 L;  4YT0 B;  2KWU B;  5DPS A;  2GBM A;  2PLP A;  2LVP A;  2M1M A;  2XNA C;  2A4Z A;  4ZRQ A;  3C8Y A;  1JWU D;  3N3K B;  4S0R A;  2LJ5 A;  5C23 A;  1FNW A;  1H8C A;  5D3I B;  2RPV A;  2KAJ A;  1SIJ A;  1SE2 A;  4IDI A;  3BK2 A;  2IPK D;  4WAF A;  3PTF C;  3LDZ E;  1MVK A;  3PRM B;  2KDF B;  4FN2 A;  1T6B X;  4A3O A;  4XDC A;  2D11 A;  3ALB A;  2GBJ A;  3TL5 A;  2BTE A;  2Z8L A;  2BW2 A;  3BWU D;  3R66 C;  3W1Y A;  2RDH A;  4DHJ D;  1FMA D;  4AUQ C;  2INP E;  3OLM D;  2LRU A;  2LVO A;  3L16 A;  2ZVO A;  4XDD A;  1F52 A;  4W9I A;  1PDX A;  2M0X A;  2H88 B;  1JRO A;  3P4R B;  1WF9 A;  1XD3 B;  5DPR A;  2D2Q A;  1STE A;  1E8Y A;  1NEN B;  1YNT E;  1F0Z A;  4US9 A;  4P7I A;  2JYE A;  2K5P A;  3IAS 1;  3HRD D;  2JZZ A;  3O13 A;  4KIK B;  4IWP A;  2ACZ B;  2JU6 X;  2LGD A;  5LLI A;  4DXA B;  3AMZ A;  1P98 A;  1V49 A; 
#chains in the Genus database with same CATH homology
 2KDB A;  3L13 A;  4BBN F;  2MW5 A;  3JVZ X;  1WE6 A;  1JRU A;  4GDL B;  2KNB A;  3R3M A;  4GSW A;  4OVU A;  5E6P A;  4GU2 A;  3U8Z A;  4ANV A;  2DYM A;  1UEL A;  2L8J A;  4WJQ A;  1YJ1 A;  2ZNV C;  2J0M A;  4I6N B;  2BYV E;  2V3S A;  2C5L C;  4MEL A;  1WXV A;  1P0R A;  4KDL B;  4GGQ A;  3QJZ A;  4TQ1 A;  3V6C B;  3TCA A;  2AYO B;  4JL9 A;  2Z59 B;  3V60 A;  2FCQ A;  1EF1 A;  2ZEQ A;  1J0G A;  2GOW A;  3H9D A;  1OTR B;  3JSV A;  4MSQ B;  1WY8 A;  1OGW A;  1XT9 B;  1GNU A;  2DAF A;  2KMC A;  3B0A A;  1EF5 A;  3AUL A;  2O2V A;  2CR5 A;  3DBS A;  4DBG A;  3H7P A;  3ZRF A;  1I35 A;  2RSU A;  2PE9 A;  4IW0 A;  5TR5 A;  5CTR C;  4BKG A;  4DHJ B;  3APC A;  3JW0 X;  2NPT B;  4FLH A;  2N7D A;  3DVN V;  2JPH A;  2KQS A;  4JQW C;  3UGB B;  4PS3 A;  2KDE B;  1T0Y A;  2JY6 A;  2MP2 B;  4GN1 A;  4LDT D;  2N9P C;  2O2V B;  4K1R B;  1E5W A;  1WIA A;  2KLC A;  4WJN A;  4HLE A;  3Q3F A;  3S2A A;  2K8C A;  3A9K A;  4KIK A;  2JT4 B;  2LAS A;  4M0W B;  4DK5 A;  5G55 A;  5IA7 A;  3U7D A;  3RD2 A;  2L0T A;  3CMM B;  3H1U A;  2K8H A;  4HJK A;  3DBL I;  4I6P A;  3L0W B;  4NNJ B;  1J8C A;  1LM8 B;  2LZ6 A;  2JVC A;  2RGF A;  3QCA A;  5L95 C;  1WR1 A;  2JWZ A;  2L7R A;  5GMV A;  4KSK C;  3ZNI D;  3K9P B;  1GJZ A;  4BOS C;  5E6N A;  2AWT A;  2Z0E B;  3ZO5 B;  1VCB A;  2HD5 B;  4II2 B;  1BT0 A;  3LJ3 A;  3V6E B;  1H4R A;  3PV1 A;  2MBQ A;  3ML8 A;  3KYD D;  4IM0 A;  3DVG X;  2VRR B;  2MQJ A;  4IWQ A;  2KMA A;  2M17 A;  1G6J A;  1EUV B;  2MX2 A;  1KM7 A;  2FCM A;  1Z2M A;  3Q3J A;  3VFK A;  3L54 A;  2C7N B;  4MJS B;  3VTV A;  3VTW A;  2LD9 A;  2G4D B;  2L05 A;  4FHK A;  4ANW A;  1CMX B;  2G45 B;  4FJV B;  2D3G A;  4FJY A;  1UH6 A;  2NR2 A;  3GOE A;  1E90 A;  3N30 A;  1V86 A;  2PE6 B;  3N32 A;  1S3S G;  2J7Q B;  2KJR A;  3M3J A;  3RYT A;  3ZNZ B;  2ASQ A;  4KZC A;  3M63 B;  4JLC A;  4DHZ E;  3EC8 A;  3SHQ A;  1TBE A;  3PLV A;  3QHT A;  2PEA A;  4NAW B;  3MTN B;  2KWV B;  4W9L A;  1WH3 A;  1Q5W B;  4MM3 A;  3KVF B;  3SDL C;  2JF5 A;  3IHP C;  2KFK A;  3AI5 A;  2WDT B;  4CHK A;  4BKS A;  2C60 A;  3HK0 A;  1GG3 A;  3NZU A;  1WXM A;  3QIJ A;  4PYZ A;  4W9K A;  4W9H A;  4HVB A;  1YD8 U;  2ZPN A;  2LWP A;  1TGZ B;  2RPQ A;  4F8C B;  2K1F A;  5J18 A;  5J17 A;  4CYE A;  4X57 B;  2EMT A;  1GC7 A;  3SU8 X;  2O6V D;  4NQK E;  1FXT B;  4JIO U;  1V80 A;  2L3Z A;  4MSM B;  2C7M B;  3NS8 A;  2FNJ B;  2KC1 A;  4LCD E;  5G2N A;  2KC2 A;  3KUD B;  5CHF A;  1WXS A;  3ZW3 A;  4MDK E;  3ZDT A;  2KZR A;  4E71 A;  2W9N A;  4W9J A;  1LXD A;  2NS5 A;  3P2B A;  5DPT A;  3UIP B;  2MRP A;  4PS7 A;  2KHW B;  2DYO A;  3ZNG C;  2CU1 A;  3PRP B;  4GXB A;  1RFA A;  1WZ3 A;  1YIW A;  2L0F A;  3DDC B;  2NBV B;  2XBB C;  1KLV A;  4EUT A;  4K7W A;  1E8W A;  4FHJ A;  2IO2 B;  3A1Q B;  3AU4 A;  3VAW A;  3KW5 B;  5AEK B;  3I3T B;  4NAW A;  2C7H A;  3PPA A;  1PQS A;  4G11 A;  5KHQ A;  2GBN A;  1UBQ A;  2FIF A;  3DPD A;  3PRE A;  5AZG A;  3W1S A;  4BBN C;  3KYC D;  3PGE A;  2K6D B;  3H6N A;  1XQQ A;  3JYU A;  4NJ6 A;  3UIO B;  1M94 A;  4W9E A;  2KJH B;  2N1W A;  2FID A;  2GBR A;  3OJ3 A;  1E7V A;  1E8X A;  2MBH A;  2MBO A;  3HHM A;  5IAA C;  4B9K A;  1UBI A;  3WAL A;  3VHT C;  2O6V B;  3APF A;  3C0R B;  3ZRC A;  1F9J A;  4WAA A;  4LJP B;  4FA6 A;  3W1S C;  4IC7 B;  3TIX A;  1C1Y B;  1EO6 A;  1J19 A;  4NY0 A;  5D2M B;  3EHV A;  4LDT B;  5J2R A;  2DHZ A;  3CF6 E;  4ANU A;  1D3Z A;  2WYQ A;  4G50 A;  2BKF A;  4FAD A;  2RR9 A;  4W9F A;  3OJ4 B;  2ZJD A;  3MJW A;  4HPL B;  4EEW A;  1WI0 A;  4HDQ A;  4ZYN A;  2J0K A;  1V5O A;  3A1Q A;  3PVL A;  2KQ7 A;  4A3P A;  1WZ0 A;  3APD A;  2R2Q A;  3EEC A;  4EKU A;  1A5R A;  2IY1 B;  2IYD B;  3CST A;  1HE8 A;  3PS6 A;  2IZV B;  4ZRK A;  1WX7 A;  2HJ8 A;  2IO0 B;  2WX0 A;  2LGY A;  2PJH A;  4J6I A;  1WJ6 A;  1WRD B;  2FCS A;  1IPG A;  2C9W B;  2EKE C;  2IO1 B;  2KLG A;  3BY4 B;  3QX1 A;  3RUI B;  4BKT A;  3ECI A;  1SE9 A;  2XK5 B;  3ZNH B;  1WX8 A;  3HM3 A;  3QA8 A;  2KFJ A;  3KH0 A;  1WFY A;  3DVG Y;  3VUW A;  3DBR I;  2CS4 A;  2G4S A;  3L10 B;  2CHZ A;  3QK0 A;  1WMH B;  2ZNV B;  1WYW B;  3DBH I;  4AJY B;  4M8M A;  1P9D U;  2CKH B;  2ZCC A;  4WJP A;  2JXX A;  4B6W A;  1SGH A;  2LRW A;  2Z0D B;  1L2N A;  2LGX A;  4GMV A;  1GC6 A;  3ZVV A;  2V1Y A;  4MGY E;  2WWZ A;  2JRH A;  2KJ6 A;  2DZM A;  1E7U A;  3B1L X;  4W9D A;  3UQB A;  1WJN A;  3DQV A;  4TV3 A;  4DWF A;  4MGZ E;  1P1A A;  1ZKH A;  4ZRJ A;  5JH5 C;  3M62 B;  4YL8 A;  2KX3 A;  1LQB A;  1WJ4 A;  3A4R A;  2KN5 A;  2NCN A;  2DX5 B;  2REX A;  4HK2 A;  3WAO A;  2NPT A;  4HDO A;  2BYF A;  2GMI C;  4IM3 A;  2BF8 B;  3IG3 A;  2KK8 A;  5DCN A;  1YQB A;  4DDI D;  3AXC A;  4HXD A;  1QZE A;  1VD2 A;  1WR6 E;  2XK5 A;  3QWZ B;  2ZPY A;  4WJO A;  3T9L A;  1I42 A;  2A5U A;  1LFD A;  2MLB A;  3KUZ A;  2V4L A;  4HWI B;  5AZF A;  4GDK A;  1YX6 B;  3V61 A;  2FUH B;  3RZF A;  4GIV A;  4IG7 B;  1WMH A;  2D10 A;  4KSL C;  2R2O A;  4BVU C;  3R7R A;  2B3A A;  2YLM A;  2CHX A;  3NY5 A;  3QQ8 B;  1WGD A;  2KTF A;  2ZCB A;  2LI5 A;  3A4S C;  3DOW A;  5L83 A;  1AAR A;  1OEY J;  3TJP A;  1WE7 A;  1RAX A;  5CHV C;  4HCP B;  4KV2 A;  1WX9 A;  3D32 A;  4G0N B;  3UQA A;  4DHZ B;  1ZGU B;  4F1S A;  5EDS A;  2BGF A;  4CO7 A;  4AJW A;  1UD7 A;  4F7Z A;  2K8B A;  4FJZ A;  3VVW B;  4ANX A;  1WJU A;  2LXA A;  2MWS B;  3IFW B;  1TZ1 A;  3VDZ A;  1RLF A;  3SD5 A;  1Q1O A;  4JGH B;  3L08 A;  1NBF C;  3QC8 B;  2DZK A;  2PPH A;  1U4A A;  2M8S A;  5D94 A;  4MH0 E;  4NJ7 A;  3WA0 A;  4ASW C;  1V5T A;  2NBU A;  5BO4 B;  2LUE A;  3PZD A;  5JHA A;  1S1Q B;  1WGG A;  2NBW B;  2WX1 A;  1ZW7 A;  1UZX B;  2FAZ A;  3DCG A;  3VXW A;  1GUA B;  4TUU A;  2EMS A;  3ONS A;  4BFR A;  2KXJ A;  2JRI B;  2LVQ A;  1KOT A;  3GZN I;  4AWJ A;  5CHW A;  1MG8 A;  3KUC B;  3PT2 B;  4I6L B;  2FCN A;  3PHW B;  2D07 B;  1OQY A;  2GBK A;  2UYZ B;  3ZDM C;  3VUX A;  4BKS D;  4EZL A;  4KDI C;  3T8M A;  4MEM A;  5CX3 A;  5HKH A;  3B08 A;  2BWF A;  5D7G A;  5LXH A;  3DVN U;  1V9J A;  1NI2 A;  4K7S A;  4PS8 A;  3CSF A;  4AP4 C;  1R4N I;  3JSV B;  2O6V A;  5KHO A;  1V81 A;  2AL3 A;  2BPS A;  5D6J B;  3ZTD A;  4AOF A;  1R4M I;  2KWC A;  2DAJ A;  4N9F 4;  4PYU A;  4E74 A;  3QAQ A;  3H7P B;  1WXA A;  2IBI B;  3EFU A;  1Q0W B;  4XC2 A;  4K7U A;  4A20 A;  3PHX B;  1TTN A;  2DZI A;  2G3Q B;  1ISN A;  4GDK B;  3ZKJ C;  2N9E B;  2N1V A;  4ZDV A;  2ZZP B;  3ZLZ A;  3IVF A;  1IYF A;  1OEY A;  2KOX A;  1SIF A;  2KAN A;  5LXI B;  4FUL A;  3UIN B;  2UWQ A;  4EFO A;  2KDI A;  1UGM A;  4ICV A;  2CHW A;  3X23 A;  3WIM A;  2MSE D;  1WM3 A;  5FR6 A;  1YX5 B;  3WAP A;  2KX0 A;  3ZTC A;  4FBJ B;  2AL6 A;  1WGR A;  3K9O B;  3ZUN A;  4IM2 A;  2QHO A;  4ICU A;  4MGK E;  3IBE A;  2OJR A;  2YVC A;  3RZW C;  3V62 A;  3L17 A;  2BYE A;  1KJT A;  4XX5 A;  4II3 B;  3VQI A;  1Y8R C;  3NOB A;  2N7E A;  3WAM A;  2ZVN A;  3BIN A;  2N9X A;  3NHE B;  2MCN B;  2KWU B;  3RUL A;  1L7Y A;  5DPS A;  2XEW A;  1NDD A;  2GBM A;  4XZ4 A;  4OVV A;  4TQ0 A;  2LVP A;  2M1M A;  2A4Z A;  2KTR A;  3ENE A;  2IY0 B;  3MHS D;  4GDL A;  3ZIM A;  4W9G A;  2L00 B;  4B95 A;  2LXC A;  3N3K B;  5C1Z A;  2LJ5 A;  4LJO B;  2NVU I;  5C23 A;  1H8C A;  3TBL D;  4GB9 A;  3AU5 A;  2HE7 A;  4WWP A;  4WWO A;  2L76 A;  3HIZ A;  3X0W A;  4WWN A;  3VH3 B;  1WGY A;  3PTF C;  2AEH A;  3LDZ E;  3O65 B;  3RCZ A;  2KTR B;  3R7Q A;  3A33 B;  4K81 A;  2HTH A;  2JUO A;  2KVR A;  3H7S A;  3PRM B;  3UF8 A;  4EZK A;  2DZJ A;  2KDF B;  3PLU A;  3PRZ A;  4FN2 A;  4KVG B;  3A9J B;  4A3O A;  2D11 A;  5E6O A;  3QAR A;  3ALB A;  4M8N A;  4URK A;  5JZE B;  2GBJ A;  2MP2 A;  2M4N A;  2BKR B;  3VUY A;  4E3C A;  3TL5 A;  2KD0 A;  2DEN B;  4DDG D;  5JHB A;  1WM2 A;  2KFK B;  4RM8 A;  5DPW A;  2KKC A;  3R66 C;  5AZH A;  3W1Y A;  4DHJ D;  2K39 A;  4BOZ B;  1WGH A;  4AUQ C;  1P3Q U;  1Z5S B;  2OOB B;  4GOC A;  3OLM D;  3NZS A;  2LRU A;  1X1M A;  2LVO A;  3OAW A;  3VH4 B;  3L16 A;  2ZVO A;  2N4F A;  4W9I A;  3TMP B;  4MGI E;  3ML9 A;  4RM9 A;  2M0X A;  4ZRI A;  3VTU A;  1WF9 A;  2J0J A;  2RD0 A;  1XD3 B;  1E8Z A;  3HM6 X;  5DPR A;  2D2Q A;  1V2Y A;  1RRB A;  4RMA A;  2JZ3 B;  2K6Q A;  1E8Y A;  2BWE S;  4W9C A;  2MBB B;  2I1J A;  4KZ0 A;  4NPN A;  3M95 A;  2MA9 B;  2KO3 A;  2IO3 B;  3RT3 B;  3PSE B;  4IWO A;  4P7I A;  4WQO B;  4NQL B;  4HPM B;  4EZJ A;  4HCN B;  4TKN A;  4G3X B;  2Y5B B;  2JZZ A;  4EOY A;  2K25 A;  3A9K B;  4KIK B;  1K8R B;  3A9J A;  2I1K A;  4IWP A;  3WAN A;  1V6E A;  3U30 A;  4MJS A;  2MBE A;  2DYB A;  2LGD A;  5LLI A;  1IP9 A;  4DXA B;  4IUM B;  1P98 A;  1C3T A;  1V49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...