2ZZTA

Crystal structure of the cytosolic domain of the cation diffusion facilitator family protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
83
Chain Sequence
MKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTYFIEMDIEVDGKMSVKDAHELTVKIRKEMLKRRDDIEDVTIHVEPLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Crystal structure of the cytosolic domain of the cation diffusion facilitator family protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 18
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16916 ZT_dimer Dimerisation domain of Zinc Transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 2zztA00
3W8PA 2QFIA 2ZZTA 5HSPA 3BYRA 3BYPA 3H90A 3W66A 3W65A 3W64A 3W60A 3W5YA 3W63A 3W5ZA 3W8GA 3W5XA 3W62A 3W61A
chains in the Genus database with same CATH superfamily
2BR0A 4A47A 5HLFB 2LQ8A 3V2UC 1J5EJ 1VQLS 3RBDA 5ETTA 4JI4F 2EFQA 1CJVB 4IH5A 3D6HB 2XYGB 2XYPB 1NMEB 2BACA 2OAUA 3W60A 3TJ8A 2OD4A 3QO9A 2HS4A 4OZNA 1N54B 4DPOA 4B3OA 1JWWA 1PYOB 1PAUB 1ZPWX 1SJFA 1RU1A 5L1KA 1DQAA 2R2TA 2FY8A 2DCUB 4G65A 3VF0B 2I5JB 2BJDA 4JI6J 1DBDA 4M5MA 5HJYA 3PKYA 4NMXA 2HLTA 2IDLA 3IS9B 4Q43A 5HP1A 3CJKB 1X4CA 3CD0A 2GVZA 3WHIA 3D9BA 4HDHA 1URRA 4NLWA 2ALZA 1AB8A 2DNQA 3PIOQ 1SJRA 2KTQA 3HVRA 4PXEA 4C3MA 2PI5A 2XCPA 2FQQB 1TELA 1H74A 2AJQA 4CO1A 4I6WA 2MTLA 2ZDOA 4LSZB 1DURA 1TK8A 1JJ4A 2W4DA 4NCAA 3R2DJ 2EWHA 2RQ4A 5T7LA 3IG1B 2IA0A 4UZBA 3EZOA 4LF4J 3MM5B 2B8QA 3M4XA 3PW0A 2B9WA 2QA1A 1DLOB 3M2RA 3TJAA 1PJ6A 4IKAA 1Q86T 3SBMA 2RS8A 1WOSA 3VAJA 4X4SA 4LUBA 2QJ3A 4IRCA 3R7BB 4QIVA 1SV5B 1U1NA 3OSNA 1DQ9A 2Y1JA 2RRNA 4OYAA 2C2KB 5E33A 3KYLA 4B3SF 5KFBA 3LAMA 1VISA 1O8BA 3KHLA 1RLCL 3WX4A 1FI4A 2F4FA 3CNQP 4F0MA 1TZ0A 1WD6A 2DHSA 2CZ9A 2KL8A 3RAXA 4EI2A 1F9EB 4DFKA 1KEKA 1Q7YT 3HKZD 4ECQA 3CCWA 5ETQA 4IFYA 1S1WA 3BF4A 2VJUA 2BE2A 1PJ5A 3ET6A 5F0UA 3T5JA 1IJFB 1TK0A 5L9XA 4DV2F 2NYHA 4IOCQ 2YTCA 3B6BA 4K4YA 4DLEA 1BQMB 4FVMA 3CJ3A 2HNZB 2CQ3A 5B0FA 1B0TA 1KTQA 4JV0A 5LSLA 2HHHJ 4C8YA 2OD6A 5DS7A 3NMRA 1UVIA 3E01B 5FJ4A 2KYZA 2WTFA 2MEWA 3OL6A 1J5OB 2VQEF 4RNOA 4P73A 3TEGA 3DGPA 2N3OA 4H4KC 4NLYA 4LFBJ 3OTOF 3ETMA 2XNQA 1MWYA 2CVIA 2MQPA 1JLFA 2CPXA 3SQGB 2J9DE 2F9JA 4DZDA 5IXUA 1HBNB 3MM8B 5EWFA 3UN3A 4DV3J 2KI2A 1AUDA 5A8RB 5IT4A 1GK8A 3K5MA 2V8PA 2HVEA 1KHVA 2YKNB 2KT2A 4IQMA 2WK4A 2UXBF 4HH0A 1IM4A 2FGCA 1IKWA 3BGRB 5CXTA 2G9OA 2YNGB 4OI6A 2YNFB 4HTIA 5KT4A 5BR8F 2MZTA 4CLFA 3IRXB 2VKZG 4B17A 4J9UE 2UUWA 3M6VA 1U8WA 3OXGA 3KK3B 2J0WA 1XNRF 1U1LA 1WORA 1H98A 1SI9A 1S49A 3ENVA 2BRLA 2VQFF 2BBEA 5EN1A 2EKYA 2QLBB 3PZPA 1RB0A 4DQQA 1BLUA 1NLKL 4CTAB 2KXNB 1NK5A 3DLKA 2XSJB 3QT6A 1KQKA 2PFDA 3HVAA 3AJ1A 5L1IA 4RW4A 4K8RA 1GAOA 2HAFA 3BS9A 1FRHA 5HQMA 3OFHA 1N8RT 2GHWA 1NXIA 5B0CA 4DLGA 4RU2A 1A7GE 3M9NB 2YX4A 2GA7A 5DGBA 2IYGA 2DGQA 4KQZA 5G0RA 3OPKA 1U48A 4PG8A 2V9KA 5AXNA 4X2BA 3TEHB 1U1KA 2DR7A 2KVQE 1JXVA 1FA0A 1IBKF 1AUSL 3V4IA 4KHPF 4TNOA 4FDFA 2J9EA 2CPFA 3IGVA 1Y9OA 1KQSR 1IBCB 1KONA 1S9GB 3KMSA 3GZ7A 5CABA 4ZA1A 3DGVA 1MNEA 1XERA 1X4DA 3JTPA 1URNA 5KFLA 3ZTRA 4PXDA 3KG0A 2JEJA 3I56S 5HMXA 5HAOA 3GPAA 2VU5A 1ZOTA 4ZCMA 4NLOA 1JJ2R 2QMXA 3LP1B 2Y1LB 2UVUA 1CS4A 2Z30B 7FDRA 3A8IA 3HJVA 3SSSA 1RT7B 4K4WA 5DGAA 1KD1T 2HIYA 2AEJA 4NLTA 5ETVA 3BO2A 4WFAQ 1JLEA 4DF8A 1RWWB 4PG4A 4JV5F 3J81j 1N32J 1TV6B 4H4KA 4USJC 4FYDA 1VRUB 1SH2A 1WHVA 1I1GA 2DXEA 3HVTA 5H9FK 2VFSA 4WXOA 5AJ3F 2E5LF 3MEDB 2QYGA 4TQRA 2MGZB 1T7PA 1XMOF 3KXDA 3QGGA 1M1GA 4ZPCA 2HHPA 5HL7Q 3GFZA 4GKKF 1DHMA 5C24B 4ED8A 3DM2A 1FKPB 4IRDA 4XAKA 4ZIVA 1CJUB 4F4WA 1N56A 2LEPA 3MMBB 2DNMA 1NO8A 1NBEB 2HRUA 2Z58B 1BE4A 1SPBP 3QBCA 2IVFB 1VBYA 4F26A 5H9EJ 2R8GA 4DZ6A 1UWAA 2DHHA 4O3OA 2ZC4A 1WC0A 3C14B 3T1YJ 4DPUA 5E3AA 2GJFA 4ZJQA 2ZHAA 1FTRA 4ICLA 2PA3A 2W24A 2B8PA 4EMDA 4PRFA 1RT5B 5KFUA 4DX5A 2DR8A 4DEZA 2YKOA 2PIIA 3BKUA 3FSXA 1SQGA 2DR9A 4WFBQ 1S1TA 5IV3A 2IIHA 1I6JA 2DRAA 1QM9A 5D78A 2OSQA 5KG4A 2BANA 3PVXA 3GV8B 2ZH7A 1NU4A 2KZZA 4I7FB 1QSYA 2RHSB 3MFHA 2FJVA 3Q23A 1NK0A 1VQKS 3NGDA 3JSMA 2GAHC 1RTDA 4AQYF 1FRLA 2B43A 2P6TA 4F4ZA 2G1DA 3SMZA 4J7CA 1LW0B 1LW2A 3VCDA 4A8KA 3UCGA 4DV1J 1UA1A 4NCGA 1RAAB 1Y5IB 2VODA 2AMCB 3GE9A 2FJWA 1WG1A 1NDKA 3GLJA 4KFBA 3BJYA 2KXFA 3CC7S 4RW6B 4ZJOA 1GTEA 3THPA 5DZ6A 2YKMB 2WRMA 4EBDA 4FYXB 1HMVB 4LBIA 5KG0A 4LRFA 4N76A 3I4PA 2DNNA 1R31A 2N4DA 1OY6A 3Q2SC 2GIFA 2FLOA 1NZAA 3CJ0A 3HLUA 1KQGB 3OVAA 3H8YA 2LDIA 3JAMY 2EVZA 1JXLA 4XDDA 1YRUA 2E9ZA 4AL7A 1UW9A 1U6BA 4JYAF 4YB6A 4L6V3 1KVIA 2P6SA 2C2ZB 2UXCJ 3PIPQ 3CJQA 4ZLNA 3IR6B 1T9TA 2FZKB 4D3HA 2MKJA 4I56A 1TKDA 1HPZA 3AJ2A 3UW1A 4GRSA 5GMKa 2Z2MA 1W2IA 4A8OA 3A4TA 4NI2B 4HACB 1K8AT 1G2EA 4P2FA 4BC9A 3K8WA 2OFGX 2CQIA 4DPYA 5ADZA 2HMIB 1HBOA 3QRQA 1F5CA 4B3MF 1PJ7A 1VK3A 4X4OA 5LJ3Y 1SJQA 2V2VA 5ETOA 2C3OA 4PKDB 2RQKA 4C8KA 2XWYA 3KJFB 2EFGA 2RUSA 3NXZA 2D69A 1U4BA 3CWJA 1CQMA 1YG0A 3HMJG 2MKYA 2DO0A 2D3O1 3AQPA 3BZQA 3UNGC 1FD8A 3DLGB 1RCOB 1NJYA 3NNHA 2Q79A 1HI8A 3VAFA 3PDNA 4KHMA 2UUAF 2E9RX 4OJHA 1TQLA 4FYVB 3CDWA 3AAWB 2A6MA 4ZHRA 4P2XA 1DTTB 3BR9A 3QZ8A 3CDBA 5AXMA 2CJBA 3DXBA 1FK9A 3F56A 5HJXA 2PMWA 1Q5YA 5JVGQ 1S1UA 2ASJA 1TU0B 4UZCA 3VR1A 3W2VB 1AA1B 3ENQA 4FF2A 3GU0A 4OYPA 3AODA 4O4RA 4NLDA 1FJGJ 4JP8A 4EO6A 2PN6A 2OJ3A 5ETNA 2KN4A 3BPSP 3NWGA 3V6JA 5FDLB 3OR2A 4OYBA 2IJNA 4JI0F 2OPPA 1PG5B 2YWHA 1RHUB 1WC5A 3RB0A 2HQDA 2OPSA 1IR1A 2A2CA 3I0SA 3DLEB 5CYJA 3TAMB 4OJ3A 2AV5A 3N6NA 3DDKA 4CO5A 4PQAA 2VBWA 1GMWA 3CVKA 5KFFA 1WC3A 2RVJA 1RABB 2XY5A 4KGVB 4OJGA 5A8WB 4J9VA 3RUBL 4ECSA 4X84A 1RAGB 5JXSA 2NQPA 2AD9A 5L1LA 3AXKA 4Y65A 1B99A 2IMWP 3M2VA 3MHYA 2GGPB 4PYAA 1NPRA 1K47A 3JQMA 2AWZA 3QFHA 2RRBA 4YY3F 5L46A 2RJZA 8RUCA 4C3KA 2DXDA 2R7WA 1NH7A 2BE9B 2DHXA 5B0AA 4NXMJ 3RBEA 1KOOA 5AXKA 2OPQA 3OJUA 1U0HA 2FVPA 3RR7A 5J2PA 4ZN3A 1R0AB 1AFIA 4K7QA 3KLHB 3IWNC 4KKOA 2XSFA 1SJ4P 3K58A 1LWCB 1Y5LB 1VQ7S 2Y0SD 4KH1B 3M2UB 2CPIA 1RTIA 2WVEA 3BR8A 1EB0A 1X5PA 4JI8F 3OLAA 1UVJA 2PGCA 2W7OA 1C0UB 3G96A 3T41A 3V6DA 1Z4UA 5A8KB 2GCFA 3GFXA 3OJSA 3Q8QB 3OR1B 4CDIA 3L7UA 1M5KC 2JRSA 5KFKA 3M6XA 3NGRA 3NGUA 4MAKA 1ZM2A 1RHQB 4GVBB 3M32A 2GVDA 3DRPB 4C98A 4CH0S 4OZ2A 3R1LA 4B9VA 3TVYA 5LMUJ 5D77A 2YH0A 3QFWA 4DCJB 5DDQC 3SDEA 2V8HA 1AYEA 1YZ7A 2IC3A 1FXRA 1R8CA 1TUVA 2UUBF 1RQ0A 1RZMA 4UOGA 2MKIA 1U6ZA 4C8ZA 4B3SJ 3I9V9 4ZCKA 1JLAB 2C42A 1LWFB 2F8EX 1S4FA 5DLGA 3CE8A 3L9ZA 3ELHA 5C7PA 2BKOA 5SZTA 1EX8A 4DR7F 2OMOA 2MKCA 4YDXA 1TK5A 1NDPA 3KLIB 3L4BC 2EBEA 2HFZA 4FXWA 3GR1A 3BN7A 3VGTA 1JLGB 5DQGA 2V2ZA 1NJWA 1V3RA 2GW8A 4DV2J 4KB7A 4CH1A 2KKHA 3DYAA 2ZH6A 1DRZA 3EZ5A 3MPVA 2L9WA 5SUHA 3ONQA 2ZUAA 2KVIA 2K3IA 1C1CA 2ZWPA 4WIIA 3EX7B 1HARA 3JQKA 3OHAA 1BY9A 1YHQS 3QT8A 1KKHA 3I4HX 5KFXA 3G4SS 2J0XA 1YJTA 2VQEJ 7FD1A 4ID5B 2B51A 5KFSA 2HBQB 4NLVA 1QTNB 1SCJB 3UDEA 1P1TA 4L74A 4J91A 3MEGB 2DH7A 3CB4A 4MK7A 3HHLA 1VLOA 5I3UB 1FRJA 5DETA 4U9RA 2I1RA 1IM6A 4P7VA 2ZJRQ 3QAEA 3W65A 1F6TA 5B0EA 1RT3B 3GSDA 2KFZA 4CZCA 1BWEA 3HHEA 5KT6A 4QR1A 1PCAA 2KT3A 2JDJA 2WVDA 1N36F 2UXBJ 3KHGA 2COLA 4JUZA 4RW9B 1S1XA 2DITA 3BKFA 2H51B 3H2UB 1QTMA 4Q0BB 3UD3P 2IPOB 4RNNA 1ZAWA 4LVOP 4BDPA 2RILA 1U2CA 3PR5B 5IFMA 1FE4A 2AJ1A 3HHLD 5CH7B 2XLJA 1XNRJ 1Q16B 3GFYA 1EETB 3MECB 4WTYA 4YUDA 4RWWA 3DN9A 3W5ZA 2E66A 4TXSA 4FXVA 5LMNF 1UWBA 2H4YB 2W9BB 2HNYB 1DZ5A 3JSBA 3OT9A 1HNZF 4OX7A 3ULHA 1VLYA 3HCXA 5F41A 4JBCA 1S4EA 4DDFA 1NHUA 2HVDA 1F9HA 4ENOA 2ZJQQ 3NEKA 2ROGA 1SBRA 2CQ1A 3I9ZA 3NAHA 2HHUA 2ABYA 5CD4A 4UF4A 1S59A 4QZVB 5E3RA 3Q8RB 3EPGA 4F4YA 2VONA 2V34A 3AA9A 2A6OA 4HH1A 3NWRA 2BQRA 2Y9HA 1FJEB 4K5SA 3QO9B 2E7WA 4OX8A 1FD2A 1VC0A 3NP5A 2MXYA 2PMHA 5C42B 4DUYF 1TKTA 1EKRA 3PCOB 5J2NA 4ZK7M 1L3UA 3CO9A 1HQUA 3P96A 1S76D 4NRTA 2UU9F 3RAMA 4ZPBA 3RW6A 1B4SA 1VGYA 2CPEA 4U8VA 4B9UA 1D8ZA 4URSA 4ILLA 3N6LA 1UTAA 5DRKA 4USWA 2ZZTA 4K4ZA 3VWSA 4YS2A 3FGVA 5DDOC 5HP1B 3BN4A 3CUNA 1Q8KA 3HD1A 2IBKA 5LSOA 3F41A 5HANA 2GVZB 1S48A 4CWBA 4JV5J 5HATA 5HSPA 4A8SA 5K8PA 5G4DA 3VZIA 5A0YA 1F3VA 4OHXA 3SQOP 3N01A 4C8LA 3Q0AA 3M8ZA 4JI5F 5AJ3J 4CNYA 2E5LJ 1XR7A 2YWGA 2DISA 1WHYA 1HHQA 2GQQA 1XMOJ 3KKFA 4GKKJ 2HQ3A 3ZO7A 3IBWA 1TL5A 3VV2B 5GADU 5T7LB 3FJ2A 3TNVA 3NCQA 3UD5A 3VTIA 2P2CB 3M2RB 2GHVC 2EFNA 2QO3A 1WKLA 2LMIA 3BQ2A 3IR7B 3PJXA 2V8GA 2VG6A 4FS2A 3NRBA 4DSFA 1LEOA 2Z4PA 2ZH1A 1IVZA 5F9LA 1CG2A 3P5TL 4QPTA 3D0GE 2HGNA 2D3UA 4TY8B 3S01A 2BKPA 4Q45A 2QSWA 4ED5A 2KB2A 3CCRS 4RNHA 1SJ3P 2W2OP 3FMBA 3G9CA 1NHVA 2XLIA 4IFYB 1S1WB 2BE2B 3H2VE 3ET6B 2LVWA 3MCOA 1X7VA 5E5NA 3M6WA 5L38A 4IH6A 1HBNA 2BJ1A 2DNPA 2CQ4A 1RHKB 1RHRB 3CJ5A 3EE3A 3D28A 2YPZA 1S6PA 2QL5B 2XGQA 2OUGA 2NSCA 2KXHA 4CO2A 3QMQA 1HWKA 3FFIA 2AJFE 4KRWA 1D9FA 4WE1A 3BGRA 3RB6A 2CADA 2XCAA 1T02A 3J7A1 4OZ5A 3FRYA 4X4UA 4R8UA 2CZVC 2C1EB 3D7SB 1S9FA 1JLFB 3G6XA 2LQJA 1PYTA 3UO0A 1LWEA 2ZZMA 4KIAA 2ZNZA 4DR2F 2MJNA 2JC0A 3HVWA 3GIJA 4DHVA 4OHYA 1NK4A 3CCQS 4B9LA 3ETOA 4ZKAA 3ZZOA 2OPRA 2R3VA 3BGLA 3DRSA 1Y00A 1NK8A 4DR4F 2WSFC 3HHKA 4DR3F 1Y5NB 3UN2A 1GX5A 3D66A 3GIMA 3O8WA 1IKWB 4LIRA 2BZ2A 3GSIA 5LXRA 3AD8C 2ALYB 4QWEA 1N5YA 4S0MA 1EJ7L 2XBPA 1XNQF 1Y4ZB 2XI2A 4KH0B 1J5EF 1LK5A 2IBOA 5IQQA 4ETXA 4FKYA 4OV6A 4P2MA 3GIRA 4N7TA 4TLQA 2BOPA 1S0VA 3GV7B 4JYAJ 5L1JA 2JL9A 3CW2C 1FE0A 1IBLJ 2OO4A 1T9WA 4USIA 2RDJA 3V81A 1RBOB 2E7XA 3PTWA 1ELOA 3DLKB 1NKBA 1UVKA 2R7QA 2AZ1A 1OSCA 1K1SA 1Y3KA 2E44A 5T14A 2VG7A 4B9NA 3KWMA 4Y3CA 1XIQA 4Y34A 4CRJA 2ZOGA 3UWTA 2JOQA 3C6TA 1J2VA 2Z57B 4AFFA 4FKXA 5G0RB 2B7CB 4B3MJ 4DR6J 2NZCA 4B3TF 3OVBA 3OL9A 1KSPA 1MMDA 1DFDA 3TZYA 4F02A 1T03A 3FVYA 1H2VZ 5FLXY 3V4IB 1L5UA 3VVUA 1OMSA 4JI2F 4Y2MA 3O1LA 1ROFA 4G6VB 3FBFA 1TL1A 1CLFA 1IKYB 4H54A 4QBUA 3GIIA 1F2HA 3TUPA 1Q8IA 1ZAVA 1RTZA 5AT1B 4WBFA 1IKVA 1SKWA 1WELA 1M5HA 4HT5A 1WF0A 5K14B 2LQ9A 3PNIA 5GADI 3BEGB 2GMLA 4FPRA 3G2XA 1FKPA 4DV0J 1CS4B 1GMUA 2X51A 1UFWA 3ZZRA 5I42B 3NL0A 5D0EA 2W1BA 2D3OR 3IC1A 3MEKA 1JLEB 1W25A 2VC0A 4ED4A 3AA8A 3Q8SB 2FGOA 5IT0A 3FSYA 1PGZA 2HQFA 2YY3A 3PX6A 1NJXA 3C14A 3HVTB 1C2PA 4KV8A 3CMAS 2FHKA 4O3RA 4HVZA 4HDGA 1IR0A 3JAMU 3SCJE 5D4PA 1D9DA 1VHFA 4G1QA 4U7UK 5CD4H 2C3MA 4CO3A 3DM2B 3K5OA 5IZHA 2ZD1A 4DL6A 4CT8A 1HD1A 3P6YC 4DUTA 2GNKA 2C2EA 5KFDA 1SQFA 1OO0B 3HM9A 1VQ9S 1YRXA 5I3QA 4KSEB 2BQ3A 1GXLA 2GO8A 4C48A 2EXUA 3QIPA 2BJEA 2DNZA 3QRRA 2EBGA 2A18A 3M8YA 2MB0B 2HVZA 2HGLA 3R5DA 4UUWA 2MHNA 4X65J 2VF3A 4MKYA 3H20A 4ICLB 5D0GA 3M8RA 4ERDA 5KFWA 4C0BA 3CCVS 1RA6A 5EX0A 4IG0A 4YY3J 1S6QA 4ED7A 1BQNA 5LOQA 5F8IA 3P49B 1HW9A 5KFHA 2BANB 2CIMA 1FX4A 3QQCD 1W2BR 2CQHA 2CQGA 4ZLLA 1EP4A 3MEEA 4XPCA 1IKXA 4Z37A 2ROEA 4NCBA 3HT0A 4DV3F 3TVKA 2YNIA 3CJ2A 1RTDB 4E2FB 1X0PA 4J9LA 4ECWA 2AKWB 5IT9Y 5HBMA 1LW2B 4O0IA 1S10A 1RT4A 4J9NA 4Q2MA 1FRXA 1N33F 1WOPA 2K3KA 4JI8J 3KK2A 4DWIA 3PHTA 3E51A 1LXNA 3CO0P 5KFTA 4KFBB 3V6KA 4JB8B 2M2BA 1KBRA 3OXLA 2NREA 1HNWF 2U2FA 2Z8QA 1EKSA 1TFYA 1OQ6A 1QY7A 4OIXA 3R8YA 4QR0A 1X9MA 4U7CA 4TYAA 1YIJS 3FCWA 1WTBA 1FVSA 2EC2A 1WEXA 5ETPA 4WFZA 5HI7A 1FO1A 3BM7A 3W62A 5B09A 2NXJA 1MU2A 3DFEA 3RTVA 2ZH5A 2ZEJA 3PKMA 2X1GA 2NXNA 2B3TB 2UUBJ 3HSZA 1YKWA 2AJ4A 4DV4J 1D3WA 2H9ZA 4FYYB 1M5PC 3MD3A 4DPXA 3N79A 2DGOA 2RQCA 4DOZA 3W8PA 4ZITA 2MY8A 3JSYA 3IP0A 4WFNQ 1U8SA 1SH3A 4DR7J 3BSCA 4QYZJ 2D7SA 3P5BP 1HPZB 2W2PP 4IFVA 2DEJA 2W2NP 5K9FA 2C3UA 2BJ8A 1Q8LA 4GKJF 1YBTA 2VPWB 4NZ7A 2FIUA 2AP6A 4LBHA 3B54A 2IY5B 2IM2A 1JJCB 2EFOA 4XO0A 2RHQB 4NLQA 1JKHA 4XIUA 3IBFB 1HBOB 2L3MA 2HFNA 3KUHA 3HK2A 4JOUA 4C8NA 2CG8A 3K17A 3NBPA 3A3PB 1UEUA 3H4DA 3ZFVA 1NK9A 2ZH8A 2FY1A 3CCES 3CXCR 4DQSA 4AT1B 3PRBA 2Q6CA 3PRDA 4LSLA 1N32F 3GB0A 4K4UA 4B02A 5FDLA 3VAIA 3S6EA 5HQLA 5THWA 1HIYA 3QYYA 1NAQA 2XULA 3QJPA 4ZHRB 4OZLA 3SXLA 2HHWA 2V0NA 3H98A 3F44A 1FK9B 2Y3YA 4YB7A 1S1UB 1B0VA 1WEYA 4I68A 5L39A 3PEHA 5J1PA 1VBZA 4E98A 4N47A 4DV5J 4AXJA 2WOMA 2V4QA 3OR2B 1WNEA 4ZVEA 3NKYA 2PE8A 4CLWA 1FNXH 5F0WA 2OPPB 3BSAA 3Q8VA 4QPXA 1S57A 4ES2A 4MKVA 1UA0A 1RK8A 2OPSB 5DM6Q 4V19X 3I0SB 5D4LA 2CQPA 5LMNJ 1U26A 1RWMB 4BWJA 2VH7A 4EZ6A 1YQHA 1HNZJ 2G2ZA 2W25A 3VGVA 4LSNA 2FLNA 4DSLA 4CLLA 3D0IE 2HBYB 1RAIB 3W7BA 5CYQA 4EK2A 2CQBA 2VPZB 1QUVA 4DU7A 2UVVA 1RJJA 3FBBA 1CULA 2DGWA 3LTOA 2OLWA 1AW0A 3KNAA 4JV2A 2JVRA 4PABA 4DV1F 3M2VB 2PO4A 2AGOA 1RAFB 4ZVQB 2VFRA 2HWHA 2H5EA 2XMJA 2DRDA 2FHJA 1NKEA 1QLNA 3CPWR 1HA1A 2HHXA 1KLMA 1ZAXA 2UU9J 3BSNA 1XR5A 1U2FA 3GCWP 3FBEA 3KHHA 2OTJS 3I55S 2OPQB 1U0HB 3EJMA 4H4MA 5J2PB 3CJSA 1WDDA 3I87A 4KKOB 1P1LA 2EW9A 4RW8B 1FRKA 1F9FA 4IRKA 3IR5B 2HLUA 3MCNA 4QWCA 2DH9A 1RTIB 4NLPA 5LSRA 5KFJA 1X4BA 3BYPA 1C1BA 5J1NA 2FHJD 2K7KA 1YGYA 4JI5J 3V6DB 4CM2A 3DDIA 4HT7A 1TL7A 1RLDA 2VD3A 3RGIA 2DKOB 1SL1A 3EGNA 5A2QY 1H38A 2EKNA 4X4VA 1TFWA 1YBAA 4E8UA 5DQHA 1WHWA 2R7SA 3GG1A 4K4SA 2MZRA 4ZDNA 3M32B 2GVDB 5K20B 1PBAA 2DPJA 3SIPB 3P8BB 3SDEB 2YWEA 1UVLA 2IC3B 3EMTA 4F2SA 4UQTA 4J5OA 2V4JA 2QFIA 2DY1A 2YXLA 1RISA 1NZ8A 3N28A 1NSKL 2V63A 3JS9A 2FB0A 1UZHA 1WF2A 1N0UA 1S0OA 1S6OA 1HBMA 2I6WA 3LP0A 2OEKA 1KOHA 2VDIA 3GP9A 5KFQA 4F04B 4ID5A 2W7PA 1AXQA 3K57A 1VJWA 1R8AA 4FPIA 4HYKA 4MMOA 1LV5A 2K7JA 4F3QA 2HHTA 1R3NA 1X5OA 4NOHA 2PC6A 2MQOA 3DLJA 2KO1A 3IM9A 2MYFA 3DYAB 4L73A 4M1KA 4FBUA 2KDOA 3N6MA 4B9TA 3R6LB 4FZVA 2XGPA 2H48B 1C1CB 2ATLA 2XI3A 4EBEA 5E3CA 2MKHA 4U8YA 2GC8A 4NA1A 1REVA 2VFUA 2RH3A 4BLGA 3M7VA 5LL6d 5HMWA 2HW3A 1TKXA 4M5GA 1KN6A 4O3PA 4Y00A 2FHOB 1X31C 3MM9A 2HQGA 3HHLB 2A1BA 3LH2S 1RDRA 1T9XA 5KFRA 3Q8YA 1LFPA 1MW7A 1NJZA 4DR2J 4KPYA 2QLFB 5KFAA 4WKRA 3UVJA 3CC4S 4J9RA 1LWXA 3U7JA 3D1QA 5GAGU 5L9NA 2W9BA 2ILZA 4DR3J 1K73T 2QN6B 4DCOB 5GAEU 3I82A 1I3OB 3M8PA 2HVHA 4NA3A 3T9ZA 1S1XB 3MMJA 5DLFA 2ZH9A 4CLUA 4I69A 1X5SA 1UEKA 2DD8S 2EFPA 2NPFA 1C0TB 1XNQJ 1VS3A 3KMQA 4EBCA 4LF8J 2QA4S 4M8LA 2VBXA 2ZHOA 4OLPA 5F9NA 3I5BA 4LR7A 1RYSA 1RAOA 3CJ4A 2J6TA 3FC9A 4IR1A 4YOEA 5D15A 2F65A 3KG1A 1VQOS 4P72A 1T94A 1UWBB 2CFXA 2B4PA 3LOUA 2JLGA 2AX0A 5C2CA 4NYZA 5C42A 1REGX 4K0KF 4ZPTR 2Q66A 3DC2A 4RNMA 2MMYA 1EARA 2WVCA 4WZQA 4F3OA 4ZPDA 3NCPA 4NZ0A 3Q89A 3B82A 1B3TA 2MPUA 1RYRA 4NXMF 3TA1A 4DG1A 2C3PA 4B3TJ 1UETA 4JI7J 3EVOA 1P8GA 3M30A 2J0SD 1YITS 3QGHA 4JI2J 3P4UB 3N4WA 3KHRA 2RS2A 4P9SA 1AT1B 4ZVGA 2RQMA 1TKTB 5J2NB 1WC4A 1JLQA 4C8OA 1HQUB 4DSKA 2RKIA 1FERA 3FZ2A 1YJ7A 3AOBA 1EAYC 2UP1A 3A8KA 3MAQA 3G82A 1B0PA 1ICEB 2G0JA 4RJVA 1NH8A 2GHPA 1HNVA 3Q24A 2WZ1A 5B08A 2QFJA 5LMUF 4DFPA 4PUOA 1FVQA 4UW2A 1RI7A 5A0YB 2QMUB 4DCPB 3FEXB 3BH6B 1RWKB 1GTHA 3L7PA 4R5PA 1BC6A 4ZMMA 3W2WA 2M7SA 2KT5A 1LKZA 2AU0A 1QAIA 2NCKL 4DL2A 4N41A 3CTRA 2NYIA 4TY8A 3EXCX 1CPZA 4LF2A 4LIWA 2ZM6J 2V67A 1D0EA 2JSXA 2FVQA 2QTWA 3MTJA 2VB6A 2J7KA 3PM9A 2P5VA 4EFAC 4NYOA 5C5JA 4I4BA 2E1CA 2BEFA 2A10A 1FESA 3EXYA 2EG1A 2VG6B 4DXLA 2CZ4A 1VHIA 2VA3A 3R6GB 3D6FB 1HR0J 1E6VA 5EWEA 2V2KA 1H72C 4FXDA 3SFGA 2CVEA 3C66A 2BRKA 2X7IA 2HWIA 2DPIA 1R7IA 1W7WA 3DXSX 4URQU 2CQ2A 4A8FA 5FLXU 3R7NB 1RT2A 3U02A 4CYUA 2DR6A 1X4FA 5D4NA 2VV5A 2YPYA 2BXJA 1M90T 4A8WA 5KG6A 4C0HA 3QWPA 3A3NB 5B7WA 1G4CA 2M3DA 4HHHA 3RR8A 2HFSA 1OWXA 2NSBA 1M0SA 5DM7Q 1S6PB 5GAEI 4ZP6A 2B0GA 3EDQB 1NDCA 2NLWA 1UVMA 5ITHA 3NS5A 3FFIB 2E7VA 4WE1B 4A8QA 3EGWB 3ZZUA 1Q0NA 2HPUA 1AZSB 1N33J 4DQRA 1L3KA 4C4WA 3C46A 4R8UB 3OTEA 4TU8A 2MQ8A 4EGLA 2B4VA 3T5KA 5J2QA 1JQGA 3QNWB 1LWEB 2H5IB 2E5GA 2QL9B 1D8YA 2H5JB 4GMKA 3TWZA 2DNHA 2DGSA 1HNWJ 3X3UA 2OPRB 4ZVPB 4NWBA 3LW5C 3DRSB 3PW2A 1NPPA 4I64A 1S0MA 4B3RJ 1JIHA 4L72B 2CJAA 2NR0A 1SB6A 2CJQA 1N5VA 2LP4A 4EYHB 4OYZA 1VRTA 3CD7A 3M9OB 5MLCV 2H54B 2XHCA 3FRZA 3IO1A 4F3MA 3MOZA 1AFJA 2ZBCA 3OFFA 1N5YB 3PO5A 2W2QP 2MKKA 2EFVA 4CLYA 2HIQA 2W8LA 4LF9F 4F67A 1NK7A 5C25A 3H0PA 4OYMA 4CI0B 3CJTA 3W9IA 2FYXA 3PX4A 3GJSB 1KR4A 2QA2A 1XMQF 2FC8A 3V81B 4EYIB 5JVHQ 1IKYA 4YHHF 3G71S 4RR5A 4O23A 1HNXF 2VG7B 1HI0P 4GKJJ 1OQ3A 2XY6A 2EG2A 3CJRA 2J6UA 6AT1B 1YJVA 4I2QA 2HS0A 1KS2A 3C6TB 2G4BA 5ETRA 3T6BA 5K14A 2QIFA 2FZGB 3AJDA 1FT8A 2BW7A 1D9AA 2Y8WA 1GFWB 4ILMA 4HEA9 1T03B 1MROA 2BE7D 5I42A 2WONA 4G3IA 5F8NA 3MUTP 2ZZNA 1Q81T 1T95A 3IXQA 1CJTA 1TL1B 1RT6A 2EPIA 5IT9U 3NOCA 2QV6A 3EVMA 2ASDA 4L3KA 5KG1A 3D2WA 2CYYA 4ECZA 2J7WA 4QW8A 1IKVB 3BGFA 1SKRA 4FBTA 4ZP9A 5BYQA 2LEAA 2VOOA 4B9SA 1Q8BA 2N7CA 4V19J 3FEYB 2HRTA 4WKYA 2FUG9 4FNHA 4ZPWR 2F8HA 3AY0A 2HFVA 1Q79A 1RKJA 4KT0C 3Q8UA 2AJ0A 4DV6F 4DMZA 3BGOP 3IRWP 2E1RA 2QG9B 2RF2A 4O3QA 1RCXB 3DU5A 5E3PA 3ITHA 5H9EK 1RWNB 1Z2LA 1OY8A 1HQ2A 3B4DA 3BBBA 2Z2LA 4M5IA 4AE5A 5D3GB 4A46A 4NASA 3OLBA 4KV8B 1OYEA 3RB3A 4Y2IA 2B4UA 4DFMA 1HYSA 2WCXA 2FVCA 2FLPA 3BPDA 1R6YA 2X1AA 4G1QB 1YLXA 2AT1B 1UFKA 2ZD1B 4OI2A 3CCJS 3POTA 2J9DA 2IRYA 4USTA 3HFKA 1SUQA 1WG4A 2VDHA 3N5BA 5HMYA 1RWUA 4LR9A 4ECVA 1HW8A 1VR6A 3BO3A 4ZVSB 4HI1A 1BHNA 4LREA 4DBQA 2ZH3A 4DL7A 1G3OA 2WB4A 1RWPB 3QIPB 3GQCA 1NDLA 2ASLA 2HAIA 2I0XA 2FJBB 4DPTA 3U1LA 5LM7E 2QC3A 2A0FB 3ZNUA 2F1FA 1N6QA 5CYMA 3OL8A 2MHEA 3LO3A 5EDWA 4KTQA 3L3CA 2CDRB 1RGVA 1MMNA 2AHOB 1FNOA 4Q7AA 1F2GA 2ZITA 4IG0B 2V68A 4C8MA 1S6QB 4NZ6A 1I51B 2P8IA 2XZWA 2MY7A 1BQNB 3NCRA 4DN9A 1JK9B 4QOTA 3LAKA 1RAJA 1ZA2B 2ILYA 3RB4A 2IVYA 1ZZFA 3NNCA 3RG6A 2IHR1 1EP4B 3MEEB 3HO1A 1JNRB 1IKXB 4ITSA 5AE3A 1TKZA 4ZPAA 1GH8A 2YNIB 5A6PA 4OZ0A 3DOMA 2MQNA 4PR6A 3UDCA 3VAMA 5D4OA 4NX9A 5HROA 5HBMB 3MR6A 2R4FA 1RT4B 2HURA 1V3SA 2KG0A 3DRRA 3LPYA 1VBXA 4PXBA 3G87A 2CJYB 5E2QA 3KK2B 4F2RA 2YQ3A 3TAPA 1EQ0A 3THTA 3TA2A 2DH8A 1H0HB 4KE5A 1KP6A 4CM0A 2WVBA 1U1MA 2HVIA 3BBFA 4MJKA 1MLAA 2WAQD 1Q1KA 4X64F 2R42A 2R7VA 2R7TA 1U1RA 4OI1A 4JV1A 1IBLF 3PEJA 1RAHB 4ZP7A 1Q5VA 1F0XA 1VIOA 1R27B 3OL7A 2KFNA 4PWWA 1PYSB 1U7LA 2VKRA 4ECXA 3A8EA 4Y0FA 2K06A 1MU2B 1FKOB 1ZM4A 4LMZA 4L75A 4K4TA 3BB5A 4DR6F 2GQ2A 3OSPA 1GNKA 4LRDA 2QGFB 3DLBA 1SJ1A 2M5YA 2J5AA 3I0RA 4MKBA 5IQ6A 4LF5J 1WTFA 3WDOA 1HFEL 1NKCA 4B9MA 1UJ4A 3ILLA 4WFXA 3BO4A 4AXIA 4O4GA 2MSTA 2LEBA 4USMA 3GILA 1RWVB 4IFVB 1UW4A 1FEHA 4TLRA 4OHVA 2A2DA 5BJRA 1M5VC 5EWGA 4U95A 4USUA 8AT1B 5DJBA 5CCMA 1JKHB 4BHQA 3ZZPA 1HHTP 1H7WA 2QYCA 1VQPS 2JEFA 2MKSA 3AD7C 4DV0F 4P75A 2HSEB 3NBPB 1Q4RA 4CLKA 3WC2A 4ED6A 4OZ3A 2O5DA 3IM8A 1TL3A 2HZCA 5CZVA 3VGUA 1RHMB 3QGIA 3D3CJ 1OIAA 4LSLB 3NY0A 1KHWA 1P6TA 3AH6A 3HZEA 4I0WA 1BMQB 4FF1A 2VA2A 4KGKA 3G8QA 4P74A 4RWXA 3SEOA 1UL3A 3TA0A 4QWBA 1WI8A 1RHJB 3NGTA 4ZCIA 2R7XA 2GZOA 2BJ7A 5IM0A 3BGUA 1HD0A 4N77A 3M8SA 2FVRA 4PQUA 2B5JA 3MAAB 3DRYA 2OP5A 2GAGC 1WG5A 1KNZA 1HWLA 1YZ6A 4Z7CA 4X4QA 1YJ9S 4J9QA 5A2QU 4KPCA 5B0BA 1JJHA 2KJWA 4C9DA 3AHPA 4RBUA 1FDNA 5D0HA 4K5RA 2IM0A 2WOMB 4GO7X 5DZ7A 1HWJA 1PILA 1ITPA 2FPHX 4OJ1A 3JQJA 1V5VA 4X65F 3QGPA 4RUCA 2KU7A 4LFAJ 1DARA 4ECUA 2RSQA 2V8DA 1IJEB 3TQ1A 3CCTA 3RZAA 4V1Ak 2LU1A 4TU9A 2IYIA 1VRQC 3GV5B 2PI4A 2CG4A 4K0KJ 2DEIA 2PDAA 2FZCB 1GX6A 3HHLC 3R5BA 4LSNB 4FYWB 4F0KA 3PYGA 1JX4A 1GMWD 3IN5A 3FNNA 1X8DA 3ZZTA 1ZYQA 5CYQB 5GMDA 3BBCA 1VIXA 4C11A 1S0NA 5F3ZA 1A6LA 4ZIWA 1CULB 3MZIA 2AIRB 3Q83A 3UE2A 2V4RA 2ACYA 1OY9A 4RW8A 2N4CA 1QD1A 2JLEA 2VC1A 2W01A 3KJQB 4C3LA 3KFWX 2RIJA 1RAEB 3CD6S 4UUXA 2ZJPQ 2J9CA 4ANEA 3MMAA 3TUJC 3GONA 4M5KA 3A1YG 4DFJA 4ANDA 1X4GA 1FWPA 2F4VF 1KLMB 3M8QA 3CJ8A 4ELUA 4IUFA 2KRBA 3RYLA 2FJDB 3ILIA 4XTTA 2XTJP 5IC6B 3RRGA 3C16B 2ZNYA 2VZ9A 4H4MB 2KRRA 4ECYA 4PXCA 3J80U 2BM0A 1VOMA 1I94F 2XMUA 3DCAA 2F63A 1FHTA 3TOQA 3OW2R 4Q5VA 3TX8A 2R7UA 2W9CA 3ZC4A 1Y0HA 3PYEA 1TUGB 2PEHA 4X4RA 2WB1D 3CC2S 5ETSA 1YJWS 1F5AA 2XG8A 3MM7A 2LCWA 2C2NA 3HDSA 1C1BB 3KLFA 2MZJA 2JH3A 4WU2A 1XJWB 5ETLA 1U2RA 4I2PA 1G6BA 5KT2A 3S7RA 5KT7A 4DV4F 4YB5A 4UOFA 3ZTSA 1TL7B 2UV8G 2XEXA 4KAIA 3UCZP 4DX6A 3C15A 2EK6A 2BJ9A 4P6QA 5CAAA 3MCMA 4OYIA 3EM1A 1QSSA 4PCQA 4M5DA 1HBUA 1NK6A 1WACA 1SC6A 2V4JB 4DS4A 5LJ5Y 1N5QA 2CPJA 3PG9A 2HQCA 4TY9A 1BUXA 5M2RA 1HBMB 3LP0B 1ZPVA 2XNRA 1QVGR 2IRUA 4RUHA 4UQGA 4MIAA 4USHA 1HQEA 3DOLA 4P71A 2PSZA 2YNHA 4KBIA 3V6HA 1NM2A 2J6SA 1W26A 5DO2A 3MPUB 1CEZA 3BV8A 2DR5A 1N88A 3N0VA 2UVRA 4K2XA 4OI0A 1VJQA 4WYLA 2J8SA 1PO6A 4OL8A 1R6VA 2GV1A 4MFBA 3K2YA 1KC8T 4WJBA 1CBKA 2RRAA 3EICA 3ADAC 3VGSA 2KM8B 4GVLA 2OKQA 2K1RA 3FDSA 5KG5A 3F0NA 4DQPA 1REVB 1KDNA 2Q3PA 5IS2A 2DGTA 2QE5A 1G7CB 1VCTA 2P9CA 3BREA 4QU6A 4USVA 1BGXT 5I4MA 2GJIA 2R8IA 2UXDF 1TKXB 3RBXA 4DV5F 3BKTA 3P45B 3CCSS 3BDEA 1DQ8A 3MM9B 1C0TA 4KJIA 3KJNB 3HHNB 4PG7A 1HNIA 3CSKA 4LF1A 1MWZA 3KDNA 4CH7A 1UJ5A 4ZP8A 2XMKA 3O2IA 3UDLA 1Q7LB 3K7RA 2DNLA 2OEMA 1NSAA 3UVJB 4YFUA 1RTHB 2RB7A 4A8YA 1GMVA 2CKWA 2BX6A 3QAUA 3OUYA 4P7TA 4WP9A 4PWUA 1RA7A 3JTOA 1YWXA 5KTQA 2P9GA 2R2SA 4QWAA 3M8PB 2LA4A 1FFSB 1UCNA 2NXUA 5KFOA 1SKSA 4BBYA 2B56A 3EPIA 4YB1P 4URGA 4A8XA 1H7XA 1HWUA 2RE1A 3MF5A 4DR5F 2CQ0A 4Q8FA 1FFWB 2DGUA 4CLPA 3CCZA 3G6VA 2LXFA 1V6HA 4LF9J 2ZWOA 9ATCB 2RDDA 2Z0GA 1HL6A 2K2PA 3THVA 3PJWA 2Q1LA 2DNOA 2XZTB 1QDUB 3E2EA 4Y2CA 1XMQJ 4DUZF 3IFEA 1K0TA 4YQWA 2XO6A 2OELA 3TI0A 4NRUA 2CRLA 2UVWA 1X5TA 4YHHJ 4ED3A 1UJ6A 1HNXJ 2CWXA 1ZTWA 1M1HA 1RP5A 1P9QC 5CA5A 1U24A 1TAUA 1VK8A 3LP2A 4NE9C 3K5PA 2F40A 4DG1B 2IRXA 4Q2LA 3PHEA 5ETKA 1DJ0A 2Z56B 4EZ9A 4K50A 3W64A 4N5SA 3M30B 1LXJA 2FJAB 3NGSA 1ZS6A 2RNEA 1HI1A 2LKZA 1I5OB 4U67Q 1L3TA 2B6AA 1NUEA 1RU2A 2JLFA 4PG6A 1JLQB 2KYXA 1IXKA 2RKIB 1RE1B 2AEMA 2W4CA 2M8HA 4K4XA 4OZ1A 4TN2A 4QIFA 4PWDA 2DJWA 2BM1A 3G6YA 3G82B 2G2YA 2HKEA 3VAGA 1Q82T 4KGMA 2ZE2A 2BA9A 3TP2A 2IA6A 3W5YA 1HNVB 3M8WA 1VQYA 1D09B 2QL7B 4QU7A 1EQMA 4OMFG 4HHUA 4DV6J 1FJ7A 2Y8YA 4RW7A 4O0NA 1ZETA 3F73A 4PUOB 1U1PA 1CC7A 3H59A 2A3JA 3IAS9 4LR8A 4WK1A 3PFEA 1U47A 3DMJA 2E29A 1LQ9A 3CCLS 3ZZYA 1NPKA 4TKTA 4R5PB 2GMHA 3R5CA 4ZVUB 4KR0B 1T05A 1FNMA 3W2WB 1QE1A 2ZVIA 3H40A 4TU7A 5MAOA 3MXHP 1X9SA 1EIYB 2H4WB 3D5MA 5H9FJ 4C97A 3GYXB 3I31A 3I96A 4IDKB 2YWFA 5J1EA 1RT1B 4RBVA 2H3EB 3T3FA 2BW2A 3QLHA 4M5NA 5A6WA 2QLXA 2OI2A 3J81Y 5DG9A 1TMMA 3GIKA 2O3DA 1WF1A 2F5GA 2DB1A 1S6UA 5HVFA 2IVMA 1S99A 2PA8D 3R3TA 3RAQA 3W9HA 1IWAA 2JWNA 4KYZA 1XEZA 1PKUA 1E6VB 1T3OA 2MJUA 3H5UA 3U1NA 1JLCA 2B9XA 1R8HA 1AZSA 3DU6A 1RT2B 4RU9A 4CYUB 2W4PA 4W98A 5GVQA 4H4OB 1DTQA 1OYDA 4ZCLA 2X3DA 1FTCA 3VHQA 2Y0BB 4X4NA 1CJKA 3BYRA 5CQGA 5KOXA 3QT7A 3M1VA 5KG7A 2RAQA 3FQLA 1YX2A 4O44A 5CZXA 1WEZA 1IR2A 4PYDA 2JEIA 1IQTA 1VQ6S 4RUAA 1FJCA 4OLOA 2BYCA 3TW0A 3MR3A 1WC1A 5K8MA 4DF4A 3IBCB 1QAJA 3GJRB 2XY7A 3KLGA 3OV7A 2XS2A 1H2TZ 4P10A 2JC1A 3RU0A 1KVJA 3HULA 3UR0A 1H73A 2FHMA 4J90A 3QWUA 1FDDA 4LF8F 1SC4B 5J2QB 1XWLA 5KG2A 1EHWA 2C28A 1FRMA 1LOUA 1UP1A 2DGVA 2QSFA 3LWMA 4ES3A 2GS8A 4X64J 2Q6BA 3HSJA 4J9PA 1YI2S 4NXNF 3D3BJ 4CLZA 2IMOA 1ACMB 3G6ES 3B4MA 2GMJA 3OQ2A 4DL5A 1IBMF 3SSRA 1VRTB 3TVZA 4F25A 2CNLB 2HK3A 5DQIA 3HPOA 1M5OC 4PEOA 3BSOA 1IN0A 3KLEA 3TZWA 1SL0A 1NRKA 3QJJA 2V6AA 3CDUA 3HF5A 1FXLA 2YKQA 4C7QA 3J7YU 4KY3A 2CJXB 2NXEA 4LFCF 3KDOA 4ZLJA 3NMAA 2ZH4A 4JI7F 2D3ZA 5C25B 2DK2A 2WW4A 4GC7A 4NMLA 3PFOA 3VAKA 4ELVA 5E3QA 1VFJA 2MZQA 3LGHA 3RJMB 1TUWA 4EO8A 2QA4G 4LQ9A 1N34J 3OTDA 4UTGA 3R2CJ 2FC9A 4UOCA 4QQBA 3TUIC 4I2QB 2AF6A 4CLSA 2LA6A 3FCVA 3T6JA 3MFIA 1Y10A 3BH7B 2UUCF 2V8VA 3Q8PB 2N82B 2CQDA 3ZZ0A 1MROB 2DRBA 2JJ4D 1FXDA 2WONB 2RD5C 4G1IA 3JXOA 4U6PA 4CO0A 2VPYB 3O3LA 1EZZB 3FQKA 1CJTB 3LGNA 1RT6B 1QVFR 3MR2A 1OJ4A 2ZBPA 3CULA 2I9SA 2AJ2A 2CPZA 1O51A 5D3GA 3HSDA 1N4LA 5IWAJ 4DV7J 2QEXS 1VQSA 4F36A 4HKQA 1TTHB 4WU3A 1KFDA 1HWIA 4RUBA 2E1AA 1JLBA 2E5JA 5BYRA 3DLHA 1RADB 1HKAA 4YR0A 3MUMP 4Z2XA 4DL4A 3EVWA 4YP3A 5JJBA 1S1VA 3W9JA 3MMCA 2ZM6F 2HYIB 4JI3J 2G13A 5JUMA 3D68A 2RF2B 3ITHB 2OEJA 4W4MA 1VQMS 1XC9A 2LU2A 5I3PA 1R0BG 2IAJB 3HSGA 2MZ1A 4OX9F 4EU0A 1PIEA 2GIRA 4EEYA 1HYSB 3C6UA 1HR0F 2DXFA 3AD9C 1F5BA 3AOAA 2BDPA 3NOGA 3T19A 2CDQA 4WTOB 3HFZB 4I6AA 4MYUA 3AT1B 5J2MB 2NPIA 3POTB 1S9EA 1SUQB 3S1TA 2AX1A 1GQEA 2HBZB 4JI1J 3KK1A 4CLTA 5AE2A 2E1PA 1V5IB 2ACMA 3LWLA 1U1OA 2ZH2A 3GYNA 3SFUA 3W8GA 3L09A 2VHGA 2MQLA 1APSA 4USKA 1RWXB 3HHDA 5DDRC 1N6QB 5CYMB 2YKAA 2OSRA 4FN5A 4F7VA 3DHXA 4IO9Q 1BXNA 4MK9A 3PYFA 5RUBA 2R8HA 4WK3A 5KFEA 2FLLA 4JI4J 1M5SA 1WWHA 5B0DA 5H1SV 1UEVA 3DNCA 2ZUGA 2F4VJ 2KJVA 2CA9A 2HZAA 2C2MB 4PAAA 2R2UA 2O1PA 4R25A 1H6KX 2R7OA 1TKZB 3QSIA 3AXMA 3H5XA 2GQCA 4B3RF 3DOMB 2AZ3A 3JYTA 4C6AA 1YK9A 2JZ5A 1I94J 2L9NA 3L95X 1T9UA 2WW8A 3TAQA 5HROB 3N5FA 2DY9A 3R27A 1L3SA 2MLZA 5D6GA 3H2LA 1FKOA 3DRRB 2CPYA 3J7YI 2M70A 2MSSA 2DNRA 2HBRB 2N3LA 5HN0A 2LXIA 4ED0A 4LRCA 1F1BB 4F4AA 2CUYA 3T5HA 2AW0A 2CQCA 3OTBA 4DR1F 2R8JA 4WXWA 2WSEC 2DHGA 5CHCB 3SCLE 3VQSA 1Z2ZA 4MIWA 2FDNA 1U49A 1SC3B 4QYZK 2BABA 2BMBA 2HWTA 2YKPA 4NYPA 2HHVA 2VG5A 2VBYA 4KO0A 4PPZA 2V69A 2VBZA 4QIGA 3W5XA 1UAWA 3B8HA 2AYMA 3DI6A 3KUGA 1WHXA 1B70B 1KLNA 1N48A 1X0FA 3W63A 3ENWA 4EUVA 4NA2A 3ZZZA 4FS1A 3OTCA 3MM6A 3K59A 3I0RB 3ZTQA 3VVTA 1MSWD 1RTJA 2MQMA 2WBMA 2GJ2A 2W2MP 4Z7YA 2J76E 2LLZA 4O4GB 4RX6A 3CF5Q 2LXUA 2ZFHA 2F7VA 4QIEA 2ZC3A 3LPEA 4C0OC 3O44A 2I2YA 1KWMA 5KFYA 4WCEQ 4Y28C 1NNDA 2D1CA 1VQ5S 3ICLA 5IC4B 4KGXB 2CJKA 2DNYA 4RO0A 3MAAA 4NLUA 1YSJA 4BS2A 1U02A 1TL3B 4X62F 5HQ8A 2UXDJ 1TVRA 2MLXA 4ELTA 3Q22A 4NPOA 1Q78A 4Y2AA 1E6YA 3R9LA 4OFZA 1SVDA 2RU3A 2XHWA 3OTOJ 3IGNA 2G2OA 2HNDB 3DOKA 2HG4A 5LT5A 3MR7A 5IM0B 2ZBQA 3GCXP 1SC1B 3U27A 4AD6A 2PEBA 5ETMA 2V2QA 1NHKL 3LALA 4PQUB 2B5JB 3A3OB 1V9OA 1R43A 3KJVA 2I38A 2GIQA 4LF6F 2DIVA 3G86A 3HZGA 5HVGA 2UZAA 4M5JA 5KG3A 2XMWA 1RXOB 4DR5J 4A48A 1WI6A 4IG3A 3WZ0A 4Y2KA 4ZLPA 3QJLA 2L48A 2LYVA 1KRPA 1PBUA 2QMWA 4M5HA 2KM8C 1A9NB 4YEAA 5BR8J 1M1KT 1T8EA 3CEDA 4WIQA 1S72S 5HLFA 1SXLA 4DUZJ 3TRGA 2NXCA 3K8VA 5F8LA 1CJVA 2ZHBA 2VQFJ 4FF3A 3SZ2A 3RW7A 6FDRA 2KZMA 4OYWA 3VAHA 3WIUA 3K89A 2POKA 3CIMA 4FNIA 4DJBA 1Q53A 2FD2A 2IDEA 4A4JA 4C11B 3GYGA 2XMMA 3QZ7A 3C16A 3FBCA 3ILJA 4K4VA 2V94A 3AOCA 3QPIA 4R0JA 4XPEA 3HFVA 2I5JA 4L3NA 4I67A 4IOAQ 3PR4A 1IWGA 4ATNA 4DL3A 4OYOA 2F8MA 1IBKJ 3FKBA 3IS9A 2U1AA 3CGIA 3MMAB 2NZ4A 4KHPJ 3FSIA 3PJ9A 4LQ3A 1R89A 3CJKA 4LRBA 4UY85 3M8QB 1UZDA 2VIHA 4M95A 1CC8A 3ISZA 4B3OB 4Q8EA 1JXEA 3WX8A 4QCLA 2QRRA 2VASA 3AB2B 3EGZA 4KC5A 2KFYA 4ECRA 5A76A 2Q43A 4ID8A 1FX2A 1NJIT 1PSDA 2W9CB 1FDBA 1RWOB 2AYBA 3MDFA 1JNZB 4CQ1A 1ZBTA 3D4JA 3IG1A 3I5AA 1XBWA 4DX8H 3MM5A 3MM7B 3KLFB 3O5TB 1DLOA 2VOPA 3ZNJ1 3RRHA 2HQIA 3A8JA 2EK1A 1V3ZA 2M4MA 5U47A 4I2PB 5DG7A 2O01C 2DTJA 5EHHA 4W92B 1FKAF 1S7IA 1YJRA 4LF5F 1D1UA 1UFLA 3TX0A 3C15B 5BYSA 5F8MA 4L76A 1SV5A 3GR0A 1K44A 1YJUA 4XK8C 5DDPC 1S12A 3D1OA 4DI6A 1LK7A 3PW7A 4M5DB 4ZVTB 1Y11A 3QIDA 4X66F 4HI2A 1HBUB 1TAQA 3H42A 3T1HF 4OI4A 4HHJA 1RBAA 3MPDA 2SXLA 2M9KA 1T9YA 3M6UA 5HK4A 2YX7A 4LRAA 4IQXA 1BQMA 2D41A 3LGMA 3LF0A 4CT9A 2AEFA 1HQEB 2HNZA 3ZTOA 4F0HA 2V5HG 3DOLB 4YMEA 2YNHB 3PO4A 1C4AA 3QRPA 1S97A 4RZRA 3R5AA 3E01A 5FIIA 1WKJA 2WBRA 1J5OA 4F4XA 2PD1A 4MFBB 3NGKA 3VALA 4HLBA 2OGUA 1XN9A 1RTHA 2IM3A 3TO8A 2K8GA 1QAYA 2DO4A 3SQGA 4ED1A 2ZKUA 2K1RB 8ATCB 1RBLA 5KFZA 4A8MP 4BCAA 4MT1A 2DVIA 4LF7F 2JEGA 3MM8A 1FCAA 5D8HB 2M0GB 3IMQJ 4AQYJ 5A8RA 2EEYA 2QX0A 1YVFA 2QLJB 2YKNA 4P2SA 2C2RA 3J7AN 1T3NA 4F50A 3RBZA 1HNIB 4UY8T 3CDAA 3DRXA 3FZBA 2D9OA 3HP6A 4ZOSA 2YWKA 3AB4B 3CCMS 2YNGA 2YNFA 3DGPB 4DSIA 4LFAF 4LT6A 3IRXA 2ATCB 5K5MA 4NXNJ 3SV4A 1YJNS 3KK3A 3Q2TC 5E7OB 4ZPVR 1G1XA 3TYTA 3OUYB 1C4CA 1N52B 5LXYA 1IBMJ 3D6TB 5KT5A 1TP7A 4C2MA 3MAHA 2BQUA 1VBKA 1R8BA 3D67A 4CTAA 1FWLA 2CPDA 2ROPA 2XSJA 4U96A 2D74B 4QW9A 3UCUP 4LFCJ 1WC6A 1AROP 2DCLA 1O0PA 3V4MA 1XQIA 2N7YA 1KTVA 3G8TA 2DBBA 3J81U 2XLKA 1NB2A 4MYTA 1FRIA 4O3SA 1B7YB 3DKDA 3H5SA 3HXMA 3V5RA 1H2UX 3MUVP 3ENAA 1K0VA 4P52A 3TZZA 1U09A 4LJMA 2HEKA 2GO9A 3PXGa 1S5ZA 3W3SA 4NLSA 4PPDA 1ZH5A 1IUJA 2YQ0A 1S9GA 1XTZA 5L8RC 3CIZA 1QAXA 2V9WA 3AQOA 5E0OA 1YDLA 3SYZA 4AUKA 3LP2B 1WDTA 3GTYX 4RW4B 2J8AA 3CT9A 2ZKTA 2UUCJ 3FEZA 3JSRA 1O5JA 4HL9A 2B9EA 3MTKA 1VI7A 4B08A 2O66A 3W1YC 1MN9A 4JI6F 1TMJA 2YWWA 1SIZA 1T0TV 3NNAA 3R5JB 1JMTA 4QJVA 3LP1A 4PZVA 2FJXA 4NLXA 1FFGB 3ZXWA 2AQ4A 4YR3A 1RT7A 2B6AB 4M94A 3SSQA 3PV8A 1CSJA 1RKIA 2H1YA 2OMLA 4U7UD 1TV6A 2ZBRA 4FP9A 4M63A 2F9DA 2I8EA 4RKUC 4PWDB 2X1FA 1VRUA 2LQ5A 4Q44A 2CNNB 3W61A 1MMLA 2UV8A 2UUTA 2UUAJ 2ZE2B 3MEDA 5FD1A 4IDKA 1VC6A 2MGZA 1UKUA 2PFFB 3KNGA 4J9OA 4NLRA 3U1MA 3C8YA 1TR0A 5C24A 2RU9A 2PT0A 1RT1A 4NEYA 3JB9k 1WUUA 4QR2A 2XQCA 4RW7B 2DGXA 1R8PA 1NSQA 1CJUA 1YBUA 3QATA 1SIWB 5DG8A 3MMBA 4WP8A 3DMJB 2MQQA 4LF4F 4RNFA 4E0DA 4OX9J 2HK2A 1UPPA 1X4AA 2PMZD 2R2RA 1HLWA 2JFDA 2XMAA 1T05B 1A0OB 1WSVA 3T1AA 4MKAA 4J9KA 1QE1B 2OIHA 5GAHU 2ADCA 3DHWC 2LDYA 3UNYA 2HFOA 4W90B 4JI0J 1S7HA 3HKWA 3PW5A 1JB0C 1OPIA 4N8NA 2ZVSA 2ADBA 3K5NA 5J1EB 2CPHA 2CNOB 3N9UC 4ZVFA 4H4OA 3GJQB 2V50A 3MD1A 1RT5A 3TQEA 1PAEX 4DSJA 2JNJA 4NEZA 1XR6A 2C3YA 1WSRA 2Z2ZA 1U1QA 3QLHB 3A13A 3AFGA 3D54A 5GAGI 1SL2A 4NLGA 2OH2A 3LQVA 3MR5A 3CMQA 3W66A 2YBVA 3J7Z5 2L08A 2E5IA 4I7FA 4IO1A 2W7AA 2BOAA 1ULRA 1QJHA 2G1HA 1Q95G 2AYEA 4UT4A 2IJRA 1JLCB 3OVSA 2HHHF 1P9YA 3LA0A 5HMZA 1J27A 3PW4A 2ZOFA 1X4HA 1DTQB 1LW0A 5K8OA 3VZHA 4F8RA 2GX8A 2MDAA 1UMJA 4X4PA 2HS3A 2M8DB 5KFPA 2HZVA 1GEHA 1CJKB 4ILRA 2MLYA 4HTJA 1Z1ZA 1VQ4S 1Y3JA 3M1VB 1S1TB 3UN5A 3MI7X 4LFBF 4Y6IA 3H7HB 2XZDB 1N5SA 4O44B 3MCSA 1SQEA 4HR2A 2WVFA 2MZSA 3PACA 4R0EA 2APOA 3D6MB 2NS1B 5HVHA 4RW6A 3R97A 4XDCA 2YKMA 3KLGB 2E9TA 1T9VA 3GFHA 3JSMB 1VYAA 2E5HA 3UPFA 3TR5A 2L9DA 1U6FA 1HMVA 1GT8A 1U0SA 3TJ9A 5BXIA 2LECA 1SH0A 5F8GA 3HJFA 2M88A 3NLCA 2AGQA 1YRTA 1UPMB 4O3NA 4CIOA 5IV4A 5KOWA 3KUEA 3NAIA 4NCGB 1NCLA 5JMNA 3OBIA 3H4BA 4DR1J 4KGZB 1H3DA 3UI3A 3B78A 3FUYA 2BJ3A 1KVKA 3IAM9 2KH9A 3CD5A 3A12A 2Y1IA 3DLLQ 3EYZA 3EUNA 3SCKE 5AXLA 2WHOA 5KFCA 2QZ8A 3G8SA 2YH1A 3BDPA 3KLEB 4CP5A 1DY3A 4AL5A 4AYBD 1YTYA 1GXTA 4DPWA 4ZS6A 4NI2A 2XM3A 4ED2A 4WZMA 4HACA 4I6YA 2W9AA 4OV1A 4RL1A 3H90A 3I5CA 1NSPA 1LNQA 1VQNS 3KLVA 3R5GA 2HMIA 3C3LA 1RSCA 1PC4A 1VQ8S 3BQ0A 3PRVA 3OFGA 7AT1B 2ASYA 3OD2A 1Y7PA 3IWLA 3PY8A 3SV3A 3C19A 4K59A 3OFEA 5F8HA 2XMVA 3DLGA 4QIWD 3HT3A 2VFVA 4OHZA 2B4OA 5E41A 1T11A 3MPYA 1WJ9A 3J7ZT 2P9EA 2JVOA 2XB2D 3SI8A 4I1TA 3K5LA 5C2GA 2G0IA 2OFHX 1VMBA 5KAKA 1QSLA 1DTTA 3E3XA 4LVNP 4OHWA 3LUYA 3US5A 2L41A 4X62J 1MG7A 1TL4A 3MPWA 1K1QA 2YX1A 4RPFA 2IAJA 3W2VA 3NG8A 1RACB 2CXEA 1ZZNA 4IOBA 2C22A 5GAHI 5IOLA 2FVSA 2J7UA 3GG0A 4OI3A 3UR3C 1JLBB 2CNKB 5KFIA 3Q86A 1CVJA 4MH8A 5M2UA 5J2MA 4G1PA 4IYQA 2X3GA 3RRKA 1S1VB 2JX2A 3MMCB 3EZUA 3PX0A 4LF6J 4ZVHA 5K8NA 3DLEA 4GO5X 4TVAB 3TAMA 4DX7A 1ZA1B 2ZDPA 2VJVA 3WBZA 4RBTA 4WF9Q 4ES1A 2HFUA 1N36J 2KG1A 4J9MA 3L7OA 2NUUG 5F3TA 3WC0A 1DAXA 2JFKA 2W8KA 3KTQA 1KQFB 2QLWA 3C6UB 4UOHA 3PYDA 2F3JA 4BWMA 3M9MB 2YQ1A 4TYBA 1S77D 3DDNA 3T1YF 3HX9A 2XYHB 5A8WA 3ILOA 2VPXB 4DSEA 2DNGA 5KT3A 2FTRA 3H5YA 1S9EB 1KFSA 9RUBA 5EUHA 3EGVA 4DN0A 2GFFA 3E8OA 2M52A 2GGPA 2QT7A 3KK1B 3WQPA 4F4KA 3JTNA 2YVSA 4D3GA 4X4TA 1X4EA 2NUHA 2X1BA 4KHRA 4OYXA 1BD6A 4WPAA 3ISNC 4ETZA 3TARA 1O6XA 5EX3A 2R7RA 2AGPA 3EDRB 1R0AA 3QT5A 1WOOA 3H25A 3I32A 3IWXA 3KLHA 4MTPA 1VDHA 3UFCX 3MURP 2BV3A 1LWCA 2B7BB 1PC5A 2XO7A 4GC6A 1BQXA 3M05A 5GMEA 2DYAA 3M2UA 1NEEA 3X1LB 4DUYJ 1CQNA 4QYRA 2B9YA 1X60A 3OXFA 1U45A 1S79A 1C0UA 1U25A 5F8JA 2HHQA 4CCHA 3KG4A 3JYTB 5A8KA 3FCHA 3BQ1A 4NL5A 4WFYA 5KFVA 1F60B 3OR1A 4PG5A 6FD1A 1ZTTA 3VQTA 4YDDB 1MN7A 4MK8A 2HHSA 5KFMA 1X9WA 2DT9A 2HRYA 5EGYA 4IR9A 4YN3B 1IQZA 2BUNA 3MOJB 4GVBA 2VFTA 3DRPA 2OHDA 4AL6A 4LBPA 4ZVRB 3P3DA 2CAJA 4WWSA 5KFGA 5HO4A 3S8SA 1N5TA 3CMES 4OQJA 5M2PA 1UVNA 2XMTA 2Z2YB 3TUZC 1B64A 4M5LA 4IH7A 2J0QD 3TZXA 3UDVA 5AE1A 2VG5B 1JLAA 2BKNA 3D1HA 4KO0B 1K9MT 1N34F 1LWFA 2UXCF 1FWKA 1QUPA 2IJFA 4X66J 3NS7B 4N56A 3SCIE 3C2PA 3FMWA 3T1HJ 4YR2A 3DI6B 3KLIA 4DS5A 4CO4A 1BWVA 3LANA 4ZJLA 2XS5A 2WSCC 4WYWA 1JLGA 4CNZA 4ANCA 1OS5A 2C2DA 4RLEA 3OHBA 2KHCA 3GJTB 3MM6B 4DQIA 3TANA 1RTJB 2H65B 2E1MC 5KFNA 2VUGA 3CCUS 3HD2A 4OX6A 2LFVA 3MWBA 1OSDA 3UD4P 2OTLS 2JHEA 5IWAF 2VICA 4DV7F 2BVZA 3WIVA 2EI5A 3ZTPA 2G0CA 3T5LA 1FF2A 1N0VC 3UQSA 4J9SA 2XS7A 2AYGA 2KHDA 2HNDA 2DIUA 1R0CB 3MEGA 1OPZA 4DU8A 4J37A 2CJ9A 2IM1A 2Y1RI 1F3FA 3EWGA 3I6PA 5I3UA 2ERRA 1FDAA 1XK8A 1FEEA 2ZOMA 2RUGA 2HGMA 4OZJA 2IFXA 2CWKA 4LF7J 1XMBA 5CCLA 1P27B 1RT3A 4JI3F 3GMGA 3NS6A 2ZBIA 2R9LA 1B7FA 5B0GA 1LFWA 3MGJA 2RDIA 2RMLA 3R1HA 4ECTA 4BC7A 1MWQA 1TVRB 3K0JA 4WP3A 2XWXA 4RW9A 3O6QA 2DNKA 1E6YB 2XC9A 1FJGF 2DHAA 3R7SB 3D0HE 4Q0BA 1L3VA 3DOKB 2FJEB 4QWDA 4EWTA 3QSYB 5T41A 2R8KA 1SKUB 4ALZA 3J80Y 1EETA 2EC0A 1NB7A 3KOAA 3MECA 3KJVB 3ISND 4FVCA 1RUSA 1ZM9A 4MIBA 4TQSA 4DR4J 3T9NA 4JI1F 4FF4A 2LQBA 2O67A 2HNYA 1GXUA 3IA0A 4ER8A 4IG3B 2RT3A 4DL0C 3FK4A 3GWCA 2D9PA 4K2JA 5D0RA 4ZN1A 3HI9A 1ZM3A 4ZVOB 4N8OA 2VL1A 1HHSA 1WKKA 3CDEA 2C2OB 1VC5A
chains in the Genus database with same CATH topology
3W8PA 2QFIA 2ZZTA 5HSPA 3BYRA 3BYPA 3H90A 3W66A 3W65A 3W64A 3W60A 3W5YA 3W63A 3W5ZA 3W8GA 3W5XA 3W62A 3W61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8P A;  2QFI A;  2ZZT A;  5HSP A;  3BYR A;  3BYP A;  3H90 A;  3W66 A;  3W65 A;  3W64 A;  3W60 A;  3W5Y A;  3W63 A;  3W5Z A;  3W8G A;  3W5X A;  3W62 A;  3W61 A; 
#chains in the Genus database with same CATH topology
 2BR0 A;  4A47 A;  5HLF B;  2LQ8 A;  3V2U C;  1J5E J;  1VQL S;  3RBD A;  5ETT A;  4JI4 F;  2EFQ A;  1CJV B;  4IH5 A;  3D6H B;  2XYG B;  2XYP B;  1NME B;  2BAC A;  2OAU A;  3W60 A;  3TJ8 A;  2OD4 A;  3QO9 A;  2HS4 A;  4OZN A;  1N54 B;  4DPO A;  4B3O A;  1JWW A;  1PYO B;  1PAU B;  1ZPW X;  1SJF A;  1RU1 A;  5L1K A;  1DQA A;  2R2T A;  2FY8 A;  2DCU B;  4G65 A;  3VF0 B;  2I5J B;  2BJD A;  4JI6 J;  1DBD A;  4M5M A;  5HJY A;  3PKY A;  4NMX A;  2HLT A;  2IDL A;  3IS9 B;  4Q43 A;  5HP1 A;  3CJK B;  1X4C A;  3CD0 A;  2GVZ A;  3WHI A;  3D9B A;  4HDH A;  1URR A;  4NLW A;  2ALZ A;  1AB8 A;  2DNQ A;  3PIO Q;  1SJR A;  2KTQ A;  3HVR A;  4PXE A;  4C3M A;  2PI5 A;  2XCP A;  2FQQ B;  1TEL A;  1H74 A;  2AJQ A;  4CO1 A;  4I6W A;  2MTL A;  2ZDO A;  4LSZ B;  1DUR A;  1TK8 A;  1JJ4 A;  2W4D A;  4NCA A;  3R2D J;  2EWH A;  2RQ4 A;  5T7L A;  3IG1 B;  2IA0 A;  4UZB A;  3EZO A;  4LF4 J;  3MM5 B;  2B8Q A;  3M4X A;  3PW0 A;  2B9W A;  2QA1 A;  1DLO B;  3M2R A;  3TJA A;  1PJ6 A;  4IKA A;  1Q86 T;  3SBM A;  2RS8 A;  1WOS A;  3VAJ A;  4X4S A;  4LUB A;  2QJ3 A;  4IRC A;  3R7B B;  4QIV A;  1SV5 B;  1U1N A;  3OSN A;  1DQ9 A;  2Y1J A;  2RRN A;  4OYA A;  2C2K B;  5E33 A;  3KYL A;  4B3S F;  5KFB A;  3LAM A;  1VIS A;  1O8B A;  3KHL A;  1RLC L;  3WX4 A;  1FI4 A;  2F4F A;  3CNQ P;  4F0M A;  1TZ0 A;  1WD6 A;  2DHS A;  2CZ9 A;  2KL8 A;  3RAX A;  4EI2 A;  1F9E B;  4DFK A;  1KEK A;  1Q7Y T;  3HKZ D;  4ECQ A;  3CCW A;  5ETQ A;  4IFY A;  1S1W A;  3BF4 A;  2VJU A;  2BE2 A;  1PJ5 A;  3ET6 A;  5F0U A;  3T5J A;  1IJF B;  1TK0 A;  5L9X A;  4DV2 F;  2NYH A;  4IOC Q;  2YTC A;  3B6B A;  4K4Y A;  4DLE A;  1BQM B;  4FVM A;  3CJ3 A;  2HNZ B;  2CQ3 A;  5B0F A;  1B0T A;  1KTQ A;  4JV0 A;  5LSL A;  2HHH J;  4C8Y A;  2OD6 A;  5DS7 A;  3NMR A;  1UVI A;  3E01 B;  5FJ4 A;  2KYZ A;  2WTF A;  2MEW A;  3OL6 A;  1J5O B;  2VQE F;  4RNO A;  4P73 A;  3TEG A;  3DGP A;  2N3O A;  4H4K C;  4NLY A;  4LFB J;  3OTO F;  3ETM A;  2XNQ A;  1MWY A;  2CVI A;  2MQP A;  1JLF A;  2CPX A;  3SQG B;  2J9D E;  2F9J A;  4DZD A;  5IXU A;  1HBN B;  3MM8 B;  5EWF A;  3UN3 A;  4DV3 J;  2KI2 A;  1AUD A;  5A8R B;  5IT4 A;  1GK8 A;  3K5M A;  2V8P A;  2HVE A;  1KHV A;  2YKN B;  2KT2 A;  4IQM A;  2WK4 A;  2UXB F;  4HH0 A;  1IM4 A;  2FGC A;  1IKW A;  3BGR B;  5CXT A;  2G9O A;  2YNG B;  4OI6 A;  2YNF B;  4HTI A;  5KT4 A;  5BR8 F;  2MZT A;  4CLF A;  3IRX B;  2VKZ G;  4B17 A;  4J9U E;  2UUW A;  3M6V A;  1U8W A;  3OXG A;  3KK3 B;  2J0W A;  1XNR F;  1U1L A;  1WOR A;  1H98 A;  1SI9 A;  1S49 A;  3ENV A;  2BRL A;  2VQF F;  2BBE A;  5EN1 A;  2EKY A;  2QLB B;  3PZP A;  1RB0 A;  4DQQ A;  1BLU A;  1NLK L;  4CTA B;  2KXN B;  1NK5 A;  3DLK A;  2XSJ B;  3QT6 A;  1KQK A;  2PFD A;  3HVA A;  3AJ1 A;  5L1I A;  4RW4 A;  4K8R A;  1GAO A;  2HAF A;  3BS9 A;  1FRH A;  5HQM A;  3OFH A;  1N8R T;  2GHW A;  1NXI A;  5B0C A;  4DLG A;  4RU2 A;  1A7G E;  3M9N B;  2YX4 A;  2GA7 A;  5DGB A;  2IYG A;  2DGQ A;  4KQZ A;  5G0R A;  3OPK A;  1U48 A;  4PG8 A;  2V9K A;  5AXN A;  4X2B A;  3TEH B;  1U1K A;  2DR7 A;  2KVQ E;  1JXV A;  1FA0 A;  1IBK F;  1AUS L;  3V4I A;  4KHP F;  4TNO A;  4FDF A;  2J9E A;  2CPF A;  3IGV A;  1Y9O A;  1KQS R;  1IBC B;  1KON A;  1S9G B;  3KMS A;  3GZ7 A;  5CAB A;  4ZA1 A;  3DGV A;  1MNE A;  1XER A;  1X4D A;  3JTP A;  1URN A;  5KFL A;  3ZTR A;  4PXD A;  3KG0 A;  2JEJ A;  3I56 S;  5HMX A;  5HAO A;  3GPA A;  2VU5 A;  1ZOT A;  4ZCM A;  4NLO A;  1JJ2 R;  2QMX A;  3LP1 B;  2Y1L B;  2UVU A;  1CS4 A;  2Z30 B;  7FDR A;  3A8I A;  3HJV A;  3SSS A;  1RT7 B;  4K4W A;  5DGA A;  1KD1 T;  2HIY A;  2AEJ A;  4NLT A;  5ETV A;  3BO2 A;  4WFA Q;  1JLE A;  4DF8 A;  1RWW B;  4PG4 A;  4JV5 F;  3J81 j;  1N32 J;  1TV6 B;  4H4K A;  4USJ C;  4FYD A;  1VRU B;  1SH2 A;  1WHV A;  1I1G A;  2DXE A;  3HVT A;  5H9F K;  2VFS A;  4WXO A;  5AJ3 F;  2E5L F;  3MED B;  2QYG A;  4TQR A;  2MGZ B;  1T7P A;  1XMO F;  3KXD A;  3QGG A;  1M1G A;  4ZPC A;  2HHP A;  5HL7 Q;  3GFZ A;  4GKK F;  1DHM A;  5C24 B;  4ED8 A;  3DM2 A;  1FKP B;  4IRD A;  4XAK A;  4ZIV A;  1CJU B;  4F4W A;  1N56 A;  2LEP A;  3MMB B;  2DNM A;  1NO8 A;  1NBE B;  2HRU A;  2Z58 B;  1BE4 A;  1SPB P;  3QBC A;  2IVF B;  1VBY A;  4F26 A;  5H9E J;  2R8G A;  4DZ6 A;  1UWA A;  2DHH A;  4O3O A;  2ZC4 A;  1WC0 A;  3C14 B;  3T1Y J;  4DPU A;  5E3A A;  2GJF A;  4ZJQ A;  2ZHA A;  1FTR A;  4ICL A;  2PA3 A;  2W24 A;  2B8P A;  4EMD A;  4PRF A;  1RT5 B;  5KFU A;  4DX5 A;  2DR8 A;  4DEZ A;  2YKO A;  2PII A;  3BKU A;  3FSX A;  1SQG A;  2DR9 A;  4WFB Q;  1S1T A;  5IV3 A;  2IIH A;  1I6J A;  2DRA A;  1QM9 A;  5D78 A;  2OSQ A;  5KG4 A;  2BAN A;  3PVX A;  3GV8 B;  2ZH7 A;  1NU4 A;  2KZZ A;  4I7F B;  1QSY A;  2RHS B;  3MFH A;  2FJV A;  3Q23 A;  1NK0 A;  1VQK S;  3NGD A;  3JSM A;  2GAH C;  1RTD A;  4AQY F;  1FRL A;  2B43 A;  2P6T A;  4F4Z A;  2G1D A;  3SMZ A;  4J7C A;  1LW0 B;  1LW2 A;  3VCD A;  4A8K A;  3UCG A;  4DV1 J;  1UA1 A;  4NCG A;  1RAA B;  1Y5I B;  2VOD A;  2AMC B;  3GE9 A;  2FJW A;  1WG1 A;  1NDK A;  3GLJ A;  4KFB A;  3BJY A;  2KXF A;  3CC7 S;  4RW6 B;  4ZJO A;  1GTE A;  3THP A;  5DZ6 A;  2YKM B;  2WRM A;  4EBD A;  4FYX B;  1HMV B;  4LBI A;  5KG0 A;  4LRF A;  4N76 A;  3I4P A;  2DNN A;  1R31 A;  2N4D A;  1OY6 A;  3Q2S C;  2GIF A;  2FLO A;  1NZA A;  3CJ0 A;  3HLU A;  1KQG B;  3OVA A;  3H8Y A;  2LDI A;  3JAM Y;  2EVZ A;  1JXL A;  4XDD A;  1YRU A;  2E9Z A;  4AL7 A;  1UW9 A;  1U6B A;  4JYA F;  4YB6 A;  4L6V 3;  1KVI A;  2P6S A;  2C2Z B;  2UXC J;  3PIP Q;  3CJQ A;  4ZLN A;  3IR6 B;  1T9T A;  2FZK B;  4D3H A;  2MKJ A;  4I56 A;  1TKD A;  1HPZ A;  3AJ2 A;  3UW1 A;  4GRS A;  5GMK a;  2Z2M A;  1W2I A;  4A8O A;  3A4T A;  4NI2 B;  4HAC B;  1K8A T;  1G2E A;  4P2F A;  4BC9 A;  3K8W A;  2OFG X;  2CQI A;  4DPY A;  5ADZ A;  2HMI B;  1HBO A;  3QRQ A;  1F5C A;  4B3M F;  1PJ7 A;  1VK3 A;  4X4O A;  5LJ3 Y;  1SJQ A;  2V2V A;  5ETO A;  2C3O A;  4PKD B;  2RQK A;  4C8K A;  2XWY A;  3KJF B;  2EFG A;  2RUS A;  3NXZ A;  2D69 A;  1U4B A;  3CWJ A;  1CQM A;  1YG0 A;  3HMJ G;  2MKY A;  2DO0 A;  2D3O 1;  3AQP A;  3BZQ A;  3UNG C;  1FD8 A;  3DLG B;  1RCO B;  1NJY A;  3NNH A;  2Q79 A;  1HI8 A;  3VAF A;  3PDN A;  4KHM A;  2UUA F;  2E9R X;  4OJH A;  1TQL A;  4FYV B;  3CDW A;  3AAW B;  2A6M A;  4ZHR A;  4P2X A;  1DTT B;  3BR9 A;  3QZ8 A;  3CDB A;  5AXM A;  2CJB A;  3DXB A;  1FK9 A;  3F56 A;  5HJX A;  2PMW A;  1Q5Y A;  5JVG Q;  1S1U A;  2ASJ A;  1TU0 B;  4UZC A;  3VR1 A;  3W2V B;  1AA1 B;  3ENQ A;  4FF2 A;  3GU0 A;  4OYP A;  3AOD A;  4O4R A;  4NLD A;  1FJG J;  4JP8 A;  4EO6 A;  2PN6 A;  2OJ3 A;  5ETN A;  2KN4 A;  3BPS P;  3NWG A;  3V6J A;  5FDL B;  3OR2 A;  4OYB A;  2IJN A;  4JI0 F;  2OPP A;  1PG5 B;  2YWH A;  1RHU B;  1WC5 A;  3RB0 A;  2HQD A;  2OPS A;  1IR1 A;  2A2C A;  3I0S A;  3DLE B;  5CYJ A;  3TAM B;  4OJ3 A;  2AV5 A;  3N6N A;  3DDK A;  4CO5 A;  4PQA A;  2VBW A;  1GMW A;  3CVK A;  5KFF A;  1WC3 A;  2RVJ A;  1RAB B;  2XY5 A;  4KGV B;  4OJG A;  5A8W B;  4J9V A;  3RUB L;  4ECS A;  4X84 A;  1RAG B;  5JXS A;  2NQP A;  2AD9 A;  5L1L A;  3AXK A;  4Y65 A;  1B99 A;  2IMW P;  3M2V A;  3MHY A;  2GGP B;  4PYA A;  1NPR A;  1K47 A;  3JQM A;  2AWZ A;  3QFH A;  2RRB A;  4YY3 F;  5L46 A;  2RJZ A;  8RUC A;  4C3K A;  2DXD A;  2R7W A;  1NH7 A;  2BE9 B;  2DHX A;  5B0A A;  4NXM J;  3RBE A;  1KOO A;  5AXK A;  2OPQ A;  3OJU A;  1U0H A;  2FVP A;  3RR7 A;  5J2P A;  4ZN3 A;  1R0A B;  1AFI A;  4K7Q A;  3KLH B;  3IWN C;  4KKO A;  2XSF A;  1SJ4 P;  3K58 A;  1LWC B;  1Y5L B;  1VQ7 S;  2Y0S D;  4KH1 B;  3M2U B;  2CPI A;  1RTI A;  2WVE A;  3BR8 A;  1EB0 A;  1X5P A;  4JI8 F;  3OLA A;  1UVJ A;  2PGC A;  2W7O A;  1C0U B;  3G96 A;  3T41 A;  3V6D A;  1Z4U A;  5A8K B;  2GCF A;  3GFX A;  3OJS A;  3Q8Q B;  3OR1 B;  4CDI A;  3L7U A;  1M5K C;  2JRS A;  5KFK A;  3M6X A;  3NGR A;  3NGU A;  4MAK A;  1ZM2 A;  1RHQ B;  4GVB B;  3M32 A;  2GVD A;  3DRP B;  4C98 A;  4CH0 S;  4OZ2 A;  3R1L A;  4B9V A;  3TVY A;  5LMU J;  5D77 A;  2YH0 A;  3QFW A;  4DCJ B;  5DDQ C;  3SDE A;  2V8H A;  1AYE A;  1YZ7 A;  2IC3 A;  1FXR A;  1R8C A;  1TUV A;  2UUB F;  1RQ0 A;  1RZM A;  4UOG A;  2MKI A;  1U6Z A;  4C8Z A;  4B3S J;  3I9V 9;  4ZCK A;  1JLA B;  2C42 A;  1LWF B;  2F8E X;  1S4F A;  5DLG A;  3CE8 A;  3L9Z A;  3ELH A;  5C7P A;  2BKO A;  5SZT A;  1EX8 A;  4DR7 F;  2OMO A;  2MKC A;  4YDX A;  1TK5 A;  1NDP A;  3KLI B;  3L4B C;  2EBE A;  2HFZ A;  4FXW A;  3GR1 A;  3BN7 A;  3VGT A;  1JLG B;  5DQG A;  2V2Z A;  1NJW A;  1V3R A;  2GW8 A;  4DV2 J;  4KB7 A;  4CH1 A;  2KKH A;  3DYA A;  2ZH6 A;  1DRZ A;  3EZ5 A;  3MPV A;  2L9W A;  5SUH A;  3ONQ A;  2ZUA A;  2KVI A;  2K3I A;  1C1C A;  2ZWP A;  4WII A;  3EX7 B;  1HAR A;  3JQK A;  3OHA A;  1BY9 A;  1YHQ S;  3QT8 A;  1KKH A;  3I4H X;  5KFX A;  3G4S S;  2J0X A;  1YJT A;  2VQE J;  7FD1 A;  4ID5 B;  2B51 A;  5KFS A;  2HBQ B;  4NLV A;  1QTN B;  1SCJ B;  3UDE A;  1P1T A;  4L74 A;  4J91 A;  3MEG B;  2DH7 A;  3CB4 A;  4MK7 A;  3HHL A;  1VLO A;  5I3U B;  1FRJ A;  5DET A;  4U9R A;  2I1R A;  1IM6 A;  4P7V A;  2ZJR Q;  3QAE A;  3W65 A;  1F6T A;  5B0E A;  1RT3 B;  3GSD A;  2KFZ A;  4CZC A;  1BWE A;  3HHE A;  5KT6 A;  4QR1 A;  1PCA A;  2KT3 A;  2JDJ A;  2WVD A;  1N36 F;  2UXB J;  3KHG A;  2COL A;  4JUZ A;  4RW9 B;  1S1X A;  2DIT A;  3BKF A;  2H51 B;  3H2U B;  1QTM A;  4Q0B B;  3UD3 P;  2IPO B;  4RNN A;  1ZAW A;  4LVO P;  4BDP A;  2RIL A;  1U2C A;  3PR5 B;  5IFM A;  1FE4 A;  2AJ1 A;  3HHL D;  5CH7 B;  2XLJ A;  1XNR J;  1Q16 B;  3GFY A;  1EET B;  3MEC B;  4WTY A;  4YUD A;  4RWW A;  3DN9 A;  3W5Z A;  2E66 A;  4TXS A;  4FXV A;  5LMN F;  1UWB A;  2H4Y B;  2W9B B;  2HNY B;  1DZ5 A;  3JSB A;  3OT9 A;  1HNZ F;  4OX7 A;  3ULH A;  1VLY A;  3HCX A;  5F41 A;  4JBC A;  1S4E A;  4DDF A;  1NHU A;  2HVD A;  1F9H A;  4ENO A;  2ZJQ Q;  3NEK A;  2ROG A;  1SBR A;  2CQ1 A;  3I9Z A;  3NAH A;  2HHU A;  2ABY A;  5CD4 A;  4UF4 A;  1S59 A;  4QZV B;  5E3R A;  3Q8R B;  3EPG A;  4F4Y A;  2VON A;  2V34 A;  3AA9 A;  2A6O A;  4HH1 A;  3NWR A;  2BQR A;  2Y9H A;  1FJE B;  4K5S A;  3QO9 B;  2E7W A;  4OX8 A;  1FD2 A;  1VC0 A;  3NP5 A;  2MXY A;  2PMH A;  5C42 B;  4DUY F;  1TKT A;  1EKR A;  3PCO B;  5J2N A;  4ZK7 M;  1L3U A;  3CO9 A;  1HQU A;  3P96 A;  1S76 D;  4NRT A;  2UU9 F;  3RAM A;  4ZPB A;  3RW6 A;  1B4S A;  1VGY A;  2CPE A;  4U8V A;  4B9U A;  1D8Z A;  4URS A;  4ILL A;  3N6L A;  1UTA A;  5DRK A;  4USW A;  2ZZT A;  4K4Z A;  3VWS A;  4YS2 A;  3FGV A;  5DDO C;  5HP1 B;  3BN4 A;  3CUN A;  1Q8K A;  3HD1 A;  2IBK A;  5LSO A;  3F41 A;  5HAN A;  2GVZ B;  1S48 A;  4CWB A;  4JV5 J;  5HAT A;  5HSP A;  4A8S A;  5K8P A;  5G4D A;  3VZI A;  5A0Y A;  1F3V A;  4OHX A;  3SQO P;  3N01 A;  4C8L A;  3Q0A A;  3M8Z A;  4JI5 F;  5AJ3 J;  4CNY A;  2E5L J;  1XR7 A;  2YWG A;  2DIS A;  1WHY A;  1HHQ A;  2GQQ A;  1XMO J;  3KKF A;  4GKK J;  2HQ3 A;  3ZO7 A;  3IBW A;  1TL5 A;  3VV2 B;  5GAD U;  5T7L B;  3FJ2 A;  3TNV A;  3NCQ A;  3UD5 A;  3VTI A;  2P2C B;  3M2R B;  2GHV C;  2EFN A;  2QO3 A;  1WKL A;  2LMI A;  3BQ2 A;  3IR7 B;  3PJX A;  2V8G A;  2VG6 A;  4FS2 A;  3NRB A;  4DSF A;  1LEO A;  2Z4P A;  2ZH1 A;  1IVZ A;  5F9L A;  1CG2 A;  3P5T L;  4QPT A;  3D0G E;  2HGN A;  2D3U A;  4TY8 B;  3S01 A;  2BKP A;  4Q45 A;  2QSW A;  4ED5 A;  2KB2 A;  3CCR S;  4RNH A;  1SJ3 P;  2W2O P;  3FMB A;  3G9C A;  1NHV A;  2XLI A;  4IFY B;  1S1W B;  2BE2 B;  3H2V E;  3ET6 B;  2LVW A;  3MCO A;  1X7V A;  5E5N A;  3M6W A;  5L38 A;  4IH6 A;  1HBN A;  2BJ1 A;  2DNP A;  2CQ4 A;  1RHK B;  1RHR B;  3CJ5 A;  3EE3 A;  3D28 A;  2YPZ A;  1S6P A;  2QL5 B;  2XGQ A;  2OUG A;  2NSC A;  2KXH A;  4CO2 A;  3QMQ A;  1HWK A;  3FFI A;  2AJF E;  4KRW A;  1D9F A;  4WE1 A;  3BGR A;  3RB6 A;  2CAD A;  2XCA A;  1T02 A;  3J7A 1;  4OZ5 A;  3FRY A;  4X4U A;  4R8U A;  2CZV C;  2C1E B;  3D7S B;  1S9F A;  1JLF B;  3G6X A;  2LQJ A;  1PYT A;  3UO0 A;  1LWE A;  2ZZM A;  4KIA A;  2ZNZ A;  4DR2 F;  2MJN A;  2JC0 A;  3HVW A;  3GIJ A;  4DHV A;  4OHY A;  1NK4 A;  3CCQ S;  4B9L A;  3ETO A;  4ZKA A;  3ZZO A;  2OPR A;  2R3V A;  3BGL A;  3DRS A;  1Y00 A;  1NK8 A;  4DR4 F;  2WSF C;  3HHK A;  4DR3 F;  1Y5N B;  3UN2 A;  1GX5 A;  3D66 A;  3GIM A;  3O8W A;  1IKW B;  4LIR A;  2BZ2 A;  3GSI A;  5LXR A;  3AD8 C;  2ALY B;  4QWE A;  1N5Y A;  4S0M A;  1EJ7 L;  2XBP A;  1XNQ F;  1Y4Z B;  2XI2 A;  4KH0 B;  1J5E F;  1LK5 A;  2IBO A;  5IQQ A;  4ETX A;  4FKY A;  4OV6 A;  4P2M A;  3GIR A;  4N7T A;  4TLQ A;  2BOP A;  1S0V A;  3GV7 B;  4JYA J;  5L1J A;  2JL9 A;  3CW2 C;  1FE0 A;  1IBL J;  2OO4 A;  1T9W A;  4USI A;  2RDJ A;  3V81 A;  1RBO B;  2E7X A;  3PTW A;  1ELO A;  3DLK B;  1NKB A;  1UVK A;  2R7Q A;  2AZ1 A;  1OSC A;  1K1S A;  1Y3K A;  2E44 A;  5T14 A;  2VG7 A;  4B9N A;  3KWM A;  4Y3C A;  1XIQ A;  4Y34 A;  4CRJ A;  2ZOG A;  3UWT A;  2JOQ A;  3C6T A;  1J2V A;  2Z57 B;  4AFF A;  4FKX A;  5G0R B;  2B7C B;  4B3M J;  4DR6 J;  2NZC A;  4B3T F;  3OVB A;  3OL9 A;  1KSP A;  1MMD A;  1DFD A;  3TZY A;  4F02 A;  1T03 A;  3FVY A;  1H2V Z;  5FLX Y;  3V4I B;  1L5U A;  3VVU A;  1OMS A;  4JI2 F;  4Y2M A;  3O1L A;  1ROF A;  4G6V B;  3FBF A;  1TL1 A;  1CLF A;  1IKY B;  4H54 A;  4QBU A;  3GII A;  1F2H A;  3TUP A;  1Q8I A;  1ZAV A;  1RTZ A;  5AT1 B;  4WBF A;  1IKV A;  1SKW A;  1WEL A;  1M5H A;  4HT5 A;  1WF0 A;  5K14 B;  2LQ9 A;  3PNI A;  5GAD I;  3BEG B;  2GML A;  4FPR A;  3G2X A;  1FKP A;  4DV0 J;  1CS4 B;  1GMU A;  2X51 A;  1UFW A;  3ZZR A;  5I42 B;  3NL0 A;  5D0E A;  2W1B A;  2D3O R;  3IC1 A;  3MEK A;  1JLE B;  1W25 A;  2VC0 A;  4ED4 A;  3AA8 A;  3Q8S B;  2FGO A;  5IT0 A;  3FSY A;  1PGZ A;  2HQF A;  2YY3 A;  3PX6 A;  1NJX A;  3C14 A;  3HVT B;  1C2P A;  4KV8 A;  3CMA S;  2FHK A;  4O3R A;  4HVZ A;  4HDG A;  1IR0 A;  3JAM U;  3SCJ E;  5D4P A;  1D9D A;  1VHF A;  4G1Q A;  4U7U K;  5CD4 H;  2C3M A;  4CO3 A;  3DM2 B;  3K5O A;  5IZH A;  2ZD1 A;  4DL6 A;  4CT8 A;  1HD1 A;  3P6Y C;  4DUT A;  2GNK A;  2C2E A;  5KFD A;  1SQF A;  1OO0 B;  3HM9 A;  1VQ9 S;  1YRX A;  5I3Q A;  4KSE B;  2BQ3 A;  1GXL A;  2GO8 A;  4C48 A;  2EXU A;  3QIP A;  2BJE A;  2DNZ A;  3QRR A;  2EBG A;  2A18 A;  3M8Y A;  2MB0 B;  2HVZ A;  2HGL A;  3R5D A;  4UUW A;  2MHN A;  4X65 J;  2VF3 A;  4MKY A;  3H20 A;  4ICL B;  5D0G A;  3M8R A;  4ERD A;  5KFW A;  4C0B A;  3CCV S;  1RA6 A;  5EX0 A;  4IG0 A;  4YY3 J;  1S6Q A;  4ED7 A;  1BQN A;  5LOQ A;  5F8I A;  3P49 B;  1HW9 A;  5KFH A;  2BAN B;  2CIM A;  1FX4 A;  3QQC D;  1W2B R;  2CQH A;  2CQG A;  4ZLL A;  1EP4 A;  3MEE A;  4XPC A;  1IKX A;  4Z37 A;  2ROE A;  4NCB A;  3HT0 A;  4DV3 F;  3TVK A;  2YNI A;  3CJ2 A;  1RTD B;  4E2F B;  1X0P A;  4J9L A;  4ECW A;  2AKW B;  5IT9 Y;  5HBM A;  1LW2 B;  4O0I A;  1S10 A;  1RT4 A;  4J9N A;  4Q2M A;  1FRX A;  1N33 F;  1WOP A;  2K3K A;  4JI8 J;  3KK2 A;  4DWI A;  3PHT A;  3E51 A;  1LXN A;  3CO0 P;  5KFT A;  4KFB B;  3V6K A;  4JB8 B;  2M2B A;  1KBR A;  3OXL A;  2NRE A;  1HNW F;  2U2F A;  2Z8Q A;  1EKS A;  1TFY A;  1OQ6 A;  1QY7 A;  4OIX A;  3R8Y A;  4QR0 A;  1X9M A;  4U7C A;  4TYA A;  1YIJ S;  3FCW A;  1WTB A;  1FVS A;  2EC2 A;  1WEX A;  5ETP A;  4WFZ A;  5HI7 A;  1FO1 A;  3BM7 A;  3W62 A;  5B09 A;  2NXJ A;  1MU2 A;  3DFE A;  3RTV A;  2ZH5 A;  2ZEJ A;  3PKM A;  2X1G A;  2NXN A;  2B3T B;  2UUB J;  3HSZ A;  1YKW A;  2AJ4 A;  4DV4 J;  1D3W A;  2H9Z A;  4FYY B;  1M5P C;  3MD3 A;  4DPX A;  3N79 A;  2DGO A;  2RQC A;  4DOZ A;  3W8P A;  4ZIT A;  2MY8 A;  3JSY A;  3IP0 A;  4WFN Q;  1U8S A;  1SH3 A;  4DR7 J;  3BSC A;  4QYZ J;  2D7S A;  3P5B P;  1HPZ B;  2W2P P;  4IFV A;  2DEJ A;  2W2N P;  5K9F A;  2C3U A;  2BJ8 A;  1Q8L A;  4GKJ F;  1YBT A;  2VPW B;  4NZ7 A;  2FIU A;  2AP6 A;  4LBH A;  3B54 A;  2IY5 B;  2IM2 A;  1JJC B;  2EFO A;  4XO0 A;  2RHQ B;  4NLQ A;  1JKH A;  4XIU A;  3IBF B;  1HBO B;  2L3M A;  2HFN A;  3KUH A;  3HK2 A;  4JOU A;  4C8N A;  2CG8 A;  3K17 A;  3NBP A;  3A3P B;  1UEU A;  3H4D A;  3ZFV A;  1NK9 A;  2ZH8 A;  2FY1 A;  3CCE S;  3CXC R;  4DQS A;  4AT1 B;  3PRB A;  2Q6C A;  3PRD A;  4LSL A;  1N32 F;  3GB0 A;  4K4U A;  4B02 A;  5FDL A;  3VAI A;  3S6E A;  5HQL A;  5THW A;  1HIY A;  3QYY A;  1NAQ A;  2XUL A;  3QJP A;  4ZHR B;  4OZL A;  3SXL A;  2HHW A;  2V0N A;  3H98 A;  3F44 A;  1FK9 B;  2Y3Y A;  4YB7 A;  1S1U B;  1B0V A;  1WEY A;  4I68 A;  5L39 A;  3PEH A;  5J1P A;  1VBZ A;  4E98 A;  4N47 A;  4DV5 J;  4AXJ A;  2WOM A;  2V4Q A;  3OR2 B;  1WNE A;  4ZVE A;  3NKY A;  2PE8 A;  4CLW A;  1FNX H;  5F0W A;  2OPP B;  3BSA A;  3Q8V A;  4QPX A;  1S57 A;  4ES2 A;  4MKV A;  1UA0 A;  1RK8 A;  2OPS B;  5DM6 Q;  4V19 X;  3I0S B;  5D4L A;  2CQP A;  5LMN J;  1U26 A;  1RWM B;  4BWJ A;  2VH7 A;  4EZ6 A;  1YQH A;  1HNZ J;  2G2Z A;  2W25 A;  3VGV A;  4LSN A;  2FLN A;  4DSL A;  4CLL A;  3D0I E;  2HBY B;  1RAI B;  3W7B A;  5CYQ A;  4EK2 A;  2CQB A;  2VPZ B;  1QUV A;  4DU7 A;  2UVV A;  1RJJ A;  3FBB A;  1CUL A;  2DGW A;  3LTO A;  2OLW A;  1AW0 A;  3KNA A;  4JV2 A;  2JVR A;  4PAB A;  4DV1 F;  3M2V B;  2PO4 A;  2AGO A;  1RAF B;  4ZVQ B;  2VFR A;  2HWH A;  2H5E A;  2XMJ A;  2DRD A;  2FHJ A;  1NKE A;  1QLN A;  3CPW R;  1HA1 A;  2HHX A;  1KLM A;  1ZAX A;  2UU9 J;  3BSN A;  1XR5 A;  1U2F A;  3GCW P;  3FBE A;  3KHH A;  2OTJ S;  3I55 S;  2OPQ B;  1U0H B;  3EJM A;  4H4M A;  5J2P B;  3CJS A;  1WDD A;  3I87 A;  4KKO B;  1P1L A;  2EW9 A;  4RW8 B;  1FRK A;  1F9F A;  4IRK A;  3IR5 B;  2HLU A;  3MCN A;  4QWC A;  2DH9 A;  1RTI B;  4NLP A;  5LSR A;  5KFJ A;  1X4B A;  3BYP A;  1C1B A;  5J1N A;  2FHJ D;  2K7K A;  1YGY A;  4JI5 J;  3V6D B;  4CM2 A;  3DDI A;  4HT7 A;  1TL7 A;  1RLD A;  2VD3 A;  3RGI A;  2DKO B;  1SL1 A;  3EGN A;  5A2Q Y;  1H38 A;  2EKN A;  4X4V A;  1TFW A;  1YBA A;  4E8U A;  5DQH A;  1WHW A;  2R7S A;  3GG1 A;  4K4S A;  2MZR A;  4ZDN A;  3M32 B;  2GVD B;  5K20 B;  1PBA A;  2DPJ A;  3SIP B;  3P8B B;  3SDE B;  2YWE A;  1UVL A;  2IC3 B;  3EMT A;  4F2S A;  4UQT A;  4J5O A;  2V4J A;  2QFI A;  2DY1 A;  2YXL A;  1RIS A;  1NZ8 A;  3N28 A;  1NSK L;  2V63 A;  3JS9 A;  2FB0 A;  1UZH A;  1WF2 A;  1N0U A;  1S0O A;  1S6O A;  1HBM A;  2I6W A;  3LP0 A;  2OEK A;  1KOH A;  2VDI A;  3GP9 A;  5KFQ A;  4F04 B;  4ID5 A;  2W7P A;  1AXQ A;  3K57 A;  1VJW A;  1R8A A;  4FPI A;  4HYK A;  4MMO A;  1LV5 A;  2K7J A;  4F3Q A;  2HHT A;  1R3N A;  1X5O A;  4NOH A;  2PC6 A;  2MQO A;  3DLJ A;  2KO1 A;  3IM9 A;  2MYF A;  3DYA B;  4L73 A;  4M1K A;  4FBU A;  2KDO A;  3N6M A;  4B9T A;  3R6L B;  4FZV A;  2XGP A;  2H48 B;  1C1C B;  2ATL A;  2XI3 A;  4EBE A;  5E3C A;  2MKH A;  4U8Y A;  2GC8 A;  4NA1 A;  1REV A;  2VFU A;  2RH3 A;  4BLG A;  3M7V A;  5LL6 d;  5HMW A;  2HW3 A;  1TKX A;  4M5G A;  1KN6 A;  4O3P A;  4Y00 A;  2FHO B;  1X31 C;  3MM9 A;  2HQG A;  3HHL B;  2A1B A;  3LH2 S;  1RDR A;  1T9X A;  5KFR A;  3Q8Y A;  1LFP A;  1MW7 A;  1NJZ A;  4DR2 J;  4KPY A;  2QLF B;  5KFA A;  4WKR A;  3UVJ A;  3CC4 S;  4J9R A;  1LWX A;  3U7J A;  3D1Q A;  5GAG U;  5L9N A;  2W9B A;  2ILZ A;  4DR3 J;  1K73 T;  2QN6 B;  4DCO B;  5GAE U;  3I82 A;  1I3O B;  3M8P A;  2HVH A;  4NA3 A;  3T9Z A;  1S1X B;  3MMJ A;  5DLF A;  2ZH9 A;  4CLU A;  4I69 A;  1X5S A;  1UEK A;  2DD8 S;  2EFP A;  2NPF A;  1C0T B;  1XNQ J;  1VS3 A;  3KMQ A;  4EBC A;  4LF8 J;  2QA4 S;  4M8L A;  2VBX A;  2ZHO A;  4OLP A;  5F9N A;  3I5B A;  4LR7 A;  1RYS A;  1RAO A;  3CJ4 A;  2J6T A;  3FC9 A;  4IR1 A;  4YOE A;  5D15 A;  2F65 A;  3KG1 A;  1VQO S;  4P72 A;  1T94 A;  1UWB B;  2CFX A;  2B4P A;  3LOU A;  2JLG A;  2AX0 A;  5C2C A;  4NYZ A;  5C42 A;  1REG X;  4K0K F;  4ZPT R;  2Q66 A;  3DC2 A;  4RNM A;  2MMY A;  1EAR A;  2WVC A;  4WZQ A;  4F3O A;  4ZPD A;  3NCP A;  4NZ0 A;  3Q89 A;  3B82 A;  1B3T A;  2MPU A;  1RYR A;  4NXM F;  3TA1 A;  4DG1 A;  2C3P A;  4B3T J;  1UET A;  4JI7 J;  3EVO A;  1P8G A;  3M30 A;  2J0S D;  1YIT S;  3QGH A;  4JI2 J;  3P4U B;  3N4W A;  3KHR A;  2RS2 A;  4P9S A;  1AT1 B;  4ZVG A;  2RQM A;  1TKT B;  5J2N B;  1WC4 A;  1JLQ A;  4C8O A;  1HQU B;  4DSK A;  2RKI A;  1FER A;  3FZ2 A;  1YJ7 A;  3AOB A;  1EAY C;  2UP1 A;  3A8K A;  3MAQ A;  3G82 A;  1B0P A;  1ICE B;  2G0J A;  4RJV A;  1NH8 A;  2GHP A;  1HNV A;  3Q24 A;  2WZ1 A;  5B08 A;  2QFJ A;  5LMU F;  4DFP A;  4PUO A;  1FVQ A;  4UW2 A;  1RI7 A;  5A0Y B;  2QMU B;  4DCP B;  3FEX B;  3BH6 B;  1RWK B;  1GTH A;  3L7P A;  4R5P A;  1BC6 A;  4ZMM A;  3W2W A;  2M7S A;  2KT5 A;  1LKZ A;  2AU0 A;  1QAI A;  2NCK L;  4DL2 A;  4N41 A;  3CTR A;  2NYI A;  4TY8 A;  3EXC X;  1CPZ A;  4LF2 A;  4LIW A;  2ZM6 J;  2V67 A;  1D0E A;  2JSX A;  2FVQ A;  2QTW A;  3MTJ A;  2VB6 A;  2J7K A;  3PM9 A;  2P5V A;  4EFA C;  4NYO A;  5C5J A;  4I4B A;  2E1C A;  2BEF A;  2A10 A;  1FES A;  3EXY A;  2EG1 A;  2VG6 B;  4DXL A;  2CZ4 A;  1VHI A;  2VA3 A;  3R6G B;  3D6F B;  1HR0 J;  1E6V A;  5EWE A;  2V2K A;  1H72 C;  4FXD A;  3SFG A;  2CVE A;  3C66 A;  2BRK A;  2X7I A;  2HWI A;  2DPI A;  1R7I A;  1W7W A;  3DXS X;  4URQ U;  2CQ2 A;  4A8F A;  5FLX U;  3R7N B;  1RT2 A;  3U02 A;  4CYU A;  2DR6 A;  1X4F A;  5D4N A;  2VV5 A;  2YPY A;  2BXJ A;  1M90 T;  4A8W A;  5KG6 A;  4C0H A;  3QWP A;  3A3N B;  5B7W A;  1G4C A;  2M3D A;  4HHH A;  3RR8 A;  2HFS A;  1OWX A;  2NSB A;  1M0S A;  5DM7 Q;  1S6P B;  5GAE I;  4ZP6 A;  2B0G A;  3EDQ B;  1NDC A;  2NLW A;  1UVM A;  5ITH A;  3NS5 A;  3FFI B;  2E7V A;  4WE1 B;  4A8Q A;  3EGW B;  3ZZU A;  1Q0N A;  2HPU A;  1AZS B;  1N33 J;  4DQR A;  1L3K A;  4C4W A;  3C46 A;  4R8U B;  3OTE A;  4TU8 A;  2MQ8 A;  4EGL A;  2B4V A;  3T5K A;  5J2Q A;  1JQG A;  3QNW B;  1LWE B;  2H5I B;  2E5G A;  2QL9 B;  1D8Y A;  2H5J B;  4GMK A;  3TWZ A;  2DNH A;  2DGS A;  1HNW J;  3X3U A;  2OPR B;  4ZVP B;  4NWB A;  3LW5 C;  3DRS B;  3PW2 A;  1NPP A;  4I64 A;  1S0M A;  4B3R J;  1JIH A;  4L72 B;  2CJA A;  2NR0 A;  1SB6 A;  2CJQ A;  1N5V A;  2LP4 A;  4EYH B;  4OYZ A;  1VRT A;  3CD7 A;  3M9O B;  5MLC V;  2H54 B;  2XHC A;  3FRZ A;  3IO1 A;  4F3M A;  3MOZ A;  1AFJ A;  2ZBC A;  3OFF A;  1N5Y B;  3PO5 A;  2W2Q P;  2MKK A;  2EFV A;  4CLY A;  2HIQ A;  2W8L A;  4LF9 F;  4F67 A;  1NK7 A;  5C25 A;  3H0P A;  4OYM A;  4CI0 B;  3CJT A;  3W9I A;  2FYX A;  3PX4 A;  3GJS B;  1KR4 A;  2QA2 A;  1XMQ F;  2FC8 A;  3V81 B;  4EYI B;  5JVH Q;  1IKY A;  4YHH F;  3G71 S;  4RR5 A;  4O23 A;  1HNX F;  2VG7 B;  1HI0 P;  4GKJ J;  1OQ3 A;  2XY6 A;  2EG2 A;  3CJR A;  2J6U A;  6AT1 B;  1YJV A;  4I2Q A;  2HS0 A;  1KS2 A;  3C6T B;  2G4B A;  5ETR A;  3T6B A;  5K14 A;  2QIF A;  2FZG B;  3AJD A;  1FT8 A;  2BW7 A;  1D9A A;  2Y8W A;  1GFW B;  4ILM A;  4HEA 9;  1T03 B;  1MRO A;  2BE7 D;  5I42 A;  2WON A;  4G3I A;  5F8N A;  3MUT P;  2ZZN A;  1Q81 T;  1T95 A;  3IXQ A;  1CJT A;  1TL1 B;  1RT6 A;  2EPI A;  5IT9 U;  3NOC A;  2QV6 A;  3EVM A;  2ASD A;  4L3K A;  5KG1 A;  3D2W A;  2CYY A;  4ECZ A;  2J7W A;  4QW8 A;  1IKV B;  3BGF A;  1SKR A;  4FBT A;  4ZP9 A;  5BYQ A;  2LEA A;  2VOO A;  4B9S A;  1Q8B A;  2N7C A;  4V19 J;  3FEY B;  2HRT A;  4WKY A;  2FUG 9;  4FNH A;  4ZPW R;  2F8H A;  3AY0 A;  2HFV A;  1Q79 A;  1RKJ A;  4KT0 C;  3Q8U A;  2AJ0 A;  4DV6 F;  4DMZ A;  3BGO P;  3IRW P;  2E1R A;  2QG9 B;  2RF2 A;  4O3Q A;  1RCX B;  3DU5 A;  5E3P A;  3ITH A;  5H9E K;  1RWN B;  1Z2L A;  1OY8 A;  1HQ2 A;  3B4D A;  3BBB A;  2Z2L A;  4M5I A;  4AE5 A;  5D3G B;  4A46 A;  4NAS A;  3OLB A;  4KV8 B;  1OYE A;  3RB3 A;  4Y2I A;  2B4U A;  4DFM A;  1HYS A;  2WCX A;  2FVC A;  2FLP A;  3BPD A;  1R6Y A;  2X1A A;  4G1Q B;  1YLX A;  2AT1 B;  1UFK A;  2ZD1 B;  4OI2 A;  3CCJ S;  3POT A;  2J9D A;  2IRY A;  4UST A;  3HFK A;  1SUQ A;  1WG4 A;  2VDH A;  3N5B A;  5HMY A;  1RWU A;  4LR9 A;  4ECV A;  1HW8 A;  1VR6 A;  3BO3 A;  4ZVS B;  4HI1 A;  1BHN A;  4LRE A;  4DBQ A;  2ZH3 A;  4DL7 A;  1G3O A;  2WB4 A;  1RWP B;  3QIP B;  3GQC A;  1NDL A;  2ASL A;  2HAI A;  2I0X A;  2FJB B;  4DPT A;  3U1L A;  5LM7 E;  2QC3 A;  2A0F B;  3ZNU A;  2F1F A;  1N6Q A;  5CYM A;  3OL8 A;  2MHE A;  3LO3 A;  5EDW A;  4KTQ A;  3L3C A;  2CDR B;  1RGV A;  1MMN A;  2AHO B;  1FNO A;  4Q7A A;  1F2G A;  2ZIT A;  4IG0 B;  2V68 A;  4C8M A;  1S6Q B;  4NZ6 A;  1I51 B;  2P8I A;  2XZW A;  2MY7 A;  1BQN B;  3NCR A;  4DN9 A;  1JK9 B;  4QOT A;  3LAK A;  1RAJ A;  1ZA2 B;  2ILY A;  3RB4 A;  2IVY A;  1ZZF A;  3NNC A;  3RG6 A;  2IHR 1;  1EP4 B;  3MEE B;  3HO1 A;  1JNR B;  1IKX B;  4ITS A;  5AE3 A;  1TKZ A;  4ZPA A;  1GH8 A;  2YNI B;  5A6P A;  4OZ0 A;  3DOM A;  2MQN A;  4PR6 A;  3UDC A;  3VAM A;  5D4O A;  4NX9 A;  5HRO A;  5HBM B;  3MR6 A;  2R4F A;  1RT4 B;  2HUR A;  1V3S A;  2KG0 A;  3DRR A;  3LPY A;  1VBX A;  4PXB A;  3G87 A;  2CJY B;  5E2Q A;  3KK2 B;  4F2R A;  2YQ3 A;  3TAP A;  1EQ0 A;  3THT A;  3TA2 A;  2DH8 A;  1H0H B;  4KE5 A;  1KP6 A;  4CM0 A;  2WVB A;  1U1M A;  2HVI A;  3BBF A;  4MJK A;  1MLA A;  2WAQ D;  1Q1K A;  4X64 F;  2R42 A;  2R7V A;  2R7T A;  1U1R A;  4OI1 A;  4JV1 A;  1IBL F;  3PEJ A;  1RAH B;  4ZP7 A;  1Q5V A;  1F0X A;  1VIO A;  1R27 B;  3OL7 A;  2KFN A;  4PWW A;  1PYS B;  1U7L A;  2VKR A;  4ECX A;  3A8E A;  4Y0F A;  2K06 A;  1MU2 B;  1FKO B;  1ZM4 A;  4LMZ A;  4L75 A;  4K4T A;  3BB5 A;  4DR6 F;  2GQ2 A;  3OSP A;  1GNK A;  4LRD A;  2QGF B;  3DLB A;  1SJ1 A;  2M5Y A;  2J5A A;  3I0R A;  4MKB A;  5IQ6 A;  4LF5 J;  1WTF A;  3WDO A;  1HFE L;  1NKC A;  4B9M A;  1UJ4 A;  3ILL A;  4WFX A;  3BO4 A;  4AXI A;  4O4G A;  2MST A;  2LEB A;  4USM A;  3GIL A;  1RWV B;  4IFV B;  1UW4 A;  1FEH A;  4TLR A;  4OHV A;  2A2D A;  5BJR A;  1M5V C;  5EWG A;  4U95 A;  4USU A;  8AT1 B;  5DJB A;  5CCM A;  1JKH B;  4BHQ A;  3ZZP A;  1HHT P;  1H7W A;  2QYC A;  1VQP S;  2JEF A;  2MKS A;  3AD7 C;  4DV0 F;  4P75 A;  2HSE B;  3NBP B;  1Q4R A;  4CLK A;  3WC2 A;  4ED6 A;  4OZ3 A;  2O5D A;  3IM8 A;  1TL3 A;  2HZC A;  5CZV A;  3VGU A;  1RHM B;  3QGI A;  3D3C J;  1OIA A;  4LSL B;  3NY0 A;  1KHW A;  1P6T A;  3AH6 A;  3HZE A;  4I0W A;  1BMQ B;  4FF1 A;  2VA2 A;  4KGK A;  3G8Q A;  4P74 A;  4RWX A;  3SEO A;  1UL3 A;  3TA0 A;  4QWB A;  1WI8 A;  1RHJ B;  3NGT A;  4ZCI A;  2R7X A;  2GZO A;  2BJ7 A;  5IM0 A;  3BGU A;  1HD0 A;  4N77 A;  3M8S A;  2FVR A;  4PQU A;  2B5J A;  3MAA B;  3DRY A;  2OP5 A;  2GAG C;  1WG5 A;  1KNZ A;  1HWL A;  1YZ6 A;  4Z7C A;  4X4Q A;  1YJ9 S;  4J9Q A;  5A2Q U;  4KPC A;  5B0B A;  1JJH A;  2KJW A;  4C9D A;  3AHP A;  4RBU A;  1FDN A;  5D0H A;  4K5R A;  2IM0 A;  2WOM B;  4GO7 X;  5DZ7 A;  1HWJ A;  1PIL A;  1ITP A;  2FPH X;  4OJ1 A;  3JQJ A;  1V5V A;  4X65 F;  3QGP A;  4RUC A;  2KU7 A;  4LFA J;  1DAR A;  4ECU A;  2RSQ A;  2V8D A;  1IJE B;  3TQ1 A;  3CCT A;  3RZA A;  4V1A k;  2LU1 A;  4TU9 A;  2IYI A;  1VRQ C;  3GV5 B;  2PI4 A;  2CG4 A;  4K0K J;  2DEI A;  2PDA A;  2FZC B;  1GX6 A;  3HHL C;  3R5B A;  4LSN B;  4FYW B;  4F0K A;  3PYG A;  1JX4 A;  1GMW D;  3IN5 A;  3FNN A;  1X8D A;  3ZZT A;  1ZYQ A;  5CYQ B;  5GMD A;  3BBC A;  1VIX A;  4C11 A;  1S0N A;  5F3Z A;  1A6L A;  4ZIW A;  1CUL B;  3MZI A;  2AIR B;  3Q83 A;  3UE2 A;  2V4R A;  2ACY A;  1OY9 A;  4RW8 A;  2N4C A;  1QD1 A;  2JLE A;  2VC1 A;  2W01 A;  3KJQ B;  4C3L A;  3KFW X;  2RIJ A;  1RAE B;  3CD6 S;  4UUX A;  2ZJP Q;  2J9C A;  4ANE A;  3MMA A;  3TUJ C;  3GON A;  4M5K A;  3A1Y G;  4DFJ A;  4AND A;  1X4G A;  1FWP A;  2F4V F;  1KLM B;  3M8Q A;  3CJ8 A;  4ELU A;  4IUF A;  2KRB A;  3RYL A;  2FJD B;  3ILI A;  4XTT A;  2XTJ P;  5IC6 B;  3RRG A;  3C16 B;  2ZNY A;  2VZ9 A;  4H4M B;  2KRR A;  4ECY A;  4PXC A;  3J80 U;  2BM0 A;  1VOM A;  1I94 F;  2XMU A;  3DCA A;  2F63 A;  1FHT A;  3TOQ A;  3OW2 R;  4Q5V A;  3TX8 A;  2R7U A;  2W9C A;  3ZC4 A;  1Y0H A;  3PYE A;  1TUG B;  2PEH A;  4X4R A;  2WB1 D;  3CC2 S;  5ETS A;  1YJW S;  1F5A A;  2XG8 A;  3MM7 A;  2LCW A;  2C2N A;  3HDS A;  1C1B B;  3KLF A;  2MZJ A;  2JH3 A;  4WU2 A;  1XJW B;  5ETL A;  1U2R A;  4I2P A;  1G6B A;  5KT2 A;  3S7R A;  5KT7 A;  4DV4 F;  4YB5 A;  4UOF A;  3ZTS A;  1TL7 B;  2UV8 G;  2XEX A;  4KAI A;  3UCZ P;  4DX6 A;  3C15 A;  2EK6 A;  2BJ9 A;  4P6Q A;  5CAA A;  3MCM A;  4OYI A;  3EM1 A;  1QSS A;  4PCQ A;  4M5D A;  1HBU A;  1NK6 A;  1WAC A;  1SC6 A;  2V4J B;  4DS4 A;  5LJ5 Y;  1N5Q A;  2CPJ A;  3PG9 A;  2HQC A;  4TY9 A;  1BUX A;  5M2R A;  1HBM B;  3LP0 B;  1ZPV A;  2XNR A;  1QVG R;  2IRU A;  4RUH A;  4UQG A;  4MIA A;  4USH A;  1HQE A;  3DOL A;  4P71 A;  2PSZ A;  2YNH A;  4KBI A;  3V6H A;  1NM2 A;  2J6S A;  1W26 A;  5DO2 A;  3MPU B;  1CEZ A;  3BV8 A;  2DR5 A;  1N88 A;  3N0V A;  2UVR A;  4K2X A;  4OI0 A;  1VJQ A;  4WYL A;  2J8S A;  1PO6 A;  4OL8 A;  1R6V A;  2GV1 A;  4MFB A;  3K2Y A;  1KC8 T;  4WJB A;  1CBK A;  2RRA A;  3EIC A;  3ADA C;  3VGS A;  2KM8 B;  4GVL A;  2OKQ A;  2K1R A;  3FDS A;  5KG5 A;  3F0N A;  4DQP A;  1REV B;  1KDN A;  2Q3P A;  5IS2 A;  2DGT A;  2QE5 A;  1G7C B;  1VCT A;  2P9C A;  3BRE A;  4QU6 A;  4USV A;  1BGX T;  5I4M A;  2GJI A;  2R8I A;  2UXD F;  1TKX B;  3RBX A;  4DV5 F;  3BKT A;  3P45 B;  3CCS S;  3BDE A;  1DQ8 A;  3MM9 B;  1C0T A;  4KJI A;  3KJN B;  3HHN B;  4PG7 A;  1HNI A;  3CSK A;  4LF1 A;  1MWZ A;  3KDN A;  4CH7 A;  1UJ5 A;  4ZP8 A;  2XMK A;  3O2I A;  3UDL A;  1Q7L B;  3K7R A;  2DNL A;  2OEM A;  1NSA A;  3UVJ B;  4YFU A;  1RTH B;  2RB7 A;  4A8Y A;  1GMV A;  2CKW A;  2BX6 A;  3QAU A;  3OUY A;  4P7T A;  4WP9 A;  4PWU A;  1RA7 A;  3JTO A;  1YWX A;  5KTQ A;  2P9G A;  2R2S A;  4QWA A;  3M8P B;  2LA4 A;  1FFS B;  1UCN A;  2NXU A;  5KFO A;  1SKS A;  4BBY A;  2B56 A;  3EPI A;  4YB1 P;  4URG A;  4A8X A;  1H7X A;  1HWU A;  2RE1 A;  3MF5 A;  4DR5 F;  2CQ0 A;  4Q8F A;  1FFW B;  2DGU A;  4CLP A;  3CCZ A;  3G6V A;  2LXF A;  1V6H A;  4LF9 J;  2ZWO A;  9ATC B;  2RDD A;  2Z0G A;  1HL6 A;  2K2P A;  3THV A;  3PJW A;  2Q1L A;  2DNO A;  2XZT B;  1QDU B;  3E2E A;  4Y2C A;  1XMQ J;  4DUZ F;  3IFE A;  1K0T A;  4YQW A;  2XO6 A;  2OEL A;  3TI0 A;  4NRU A;  2CRL A;  2UVW A;  1X5T A;  4YHH J;  4ED3 A;  1UJ6 A;  1HNX J;  2CWX A;  1ZTW A;  1M1H A;  1RP5 A;  1P9Q C;  5CA5 A;  1U24 A;  1TAU A;  1VK8 A;  3LP2 A;  4NE9 C;  3K5P A;  2F40 A;  4DG1 B;  2IRX A;  4Q2L A;  3PHE A;  5ETK A;  1DJ0 A;  2Z56 B;  4EZ9 A;  4K50 A;  3W64 A;  4N5S A;  3M30 B;  1LXJ A;  2FJA B;  3NGS A;  1ZS6 A;  2RNE A;  1HI1 A;  2LKZ A;  1I5O B;  4U67 Q;  1L3T A;  2B6A A;  1NUE A;  1RU2 A;  2JLF A;  4PG6 A;  1JLQ B;  2KYX A;  1IXK A;  2RKI B;  1RE1 B;  2AEM A;  2W4C A;  2M8H A;  4K4X A;  4OZ1 A;  4TN2 A;  4QIF A;  4PWD A;  2DJW A;  2BM1 A;  3G6Y A;  3G82 B;  2G2Y A;  2HKE A;  3VAG A;  1Q82 T;  4KGM A;  2ZE2 A;  2BA9 A;  3TP2 A;  2IA6 A;  3W5Y A;  1HNV B;  3M8W A;  1VQY A;  1D09 B;  2QL7 B;  4QU7 A;  1EQM A;  4OMF G;  4HHU A;  4DV6 J;  1FJ7 A;  2Y8Y A;  4RW7 A;  4O0N A;  1ZET A;  3F73 A;  4PUO B;  1U1P A;  1CC7 A;  3H59 A;  2A3J A;  3IAS 9;  4LR8 A;  4WK1 A;  3PFE A;  1U47 A;  3DMJ A;  2E29 A;  1LQ9 A;  3CCL S;  3ZZY A;  1NPK A;  4TKT A;  4R5P B;  2GMH A;  3R5C A;  4ZVU B;  4KR0 B;  1T05 A;  1FNM A;  3W2W B;  1QE1 A;  2ZVI A;  3H40 A;  4TU7 A;  5MAO A;  3MXH P;  1X9S A;  1EIY B;  2H4W B;  3D5M A;  5H9F J;  4C97 A;  3GYX B;  3I31 A;  3I96 A;  4IDK B;  2YWF A;  5J1E A;  1RT1 B;  4RBV A;  2H3E B;  3T3F A;  2BW2 A;  3QLH A;  4M5N A;  5A6W A;  2QLX A;  2OI2 A;  3J81 Y;  5DG9 A;  1TMM A;  3GIK A;  2O3D A;  1WF1 A;  2F5G A;  2DB1 A;  1S6U A;  5HVF A;  2IVM A;  1S99 A;  2PA8 D;  3R3T A;  3RAQ A;  3W9H A;  1IWA A;  2JWN A;  4KYZ A;  1XEZ A;  1PKU A;  1E6V B;  1T3O A;  2MJU A;  3H5U A;  3U1N A;  1JLC A;  2B9X A;  1R8H A;  1AZS A;  3DU6 A;  1RT2 B;  4RU9 A;  4CYU B;  2W4P A;  4W98 A;  5GVQ A;  4H4O B;  1DTQ A;  1OYD A;  4ZCL A;  2X3D A;  1FTC A;  3VHQ A;  2Y0B B;  4X4N A;  1CJK A;  3BYR A;  5CQG A;  5KOX A;  3QT7 A;  3M1V A;  5KG7 A;  2RAQ A;  3FQL A;  1YX2 A;  4O44 A;  5CZX A;  1WEZ A;  1IR2 A;  4PYD A;  2JEI A;  1IQT A;  1VQ6 S;  4RUA A;  1FJC A;  4OLO A;  2BYC A;  3TW0 A;  3MR3 A;  1WC1 A;  5K8M A;  4DF4 A;  3IBC B;  1QAJ A;  3GJR B;  2XY7 A;  3KLG A;  3OV7 A;  2XS2 A;  1H2T Z;  4P10 A;  2JC1 A;  3RU0 A;  1KVJ A;  3HUL A;  3UR0 A;  1H73 A;  2FHM A;  4J90 A;  3QWU A;  1FDD A;  4LF8 F;  1SC4 B;  5J2Q B;  1XWL A;  5KG2 A;  1EHW A;  2C28 A;  1FRM A;  1LOU A;  1UP1 A;  2DGV A;  2QSF A;  3LWM A;  4ES3 A;  2GS8 A;  4X64 J;  2Q6B A;  3HSJ A;  4J9P A;  1YI2 S;  4NXN F;  3D3B J;  4CLZ A;  2IMO A;  1ACM B;  3G6E S;  3B4M A;  2GMJ A;  3OQ2 A;  4DL5 A;  1IBM F;  3SSR A;  1VRT B;  3TVZ A;  4F25 A;  2CNL B;  2HK3 A;  5DQI A;  3HPO A;  1M5O C;  4PEO A;  3BSO A;  1IN0 A;  3KLE A;  3TZW A;  1SL0 A;  1NRK A;  3QJJ A;  2V6A A;  3CDU A;  3HF5 A;  1FXL A;  2YKQ A;  4C7Q A;  3J7Y U;  4KY3 A;  2CJX B;  2NXE A;  4LFC F;  3KDO A;  4ZLJ A;  3NMA A;  2ZH4 A;  4JI7 F;  2D3Z A;  5C25 B;  2DK2 A;  2WW4 A;  4GC7 A;  4NML A;  3PFO A;  3VAK A;  4ELV A;  5E3Q A;  1VFJ A;  2MZQ A;  3LGH A;  3RJM B;  1TUW A;  4EO8 A;  2QA4 G;  4LQ9 A;  1N34 J;  3OTD A;  4UTG A;  3R2C J;  2FC9 A;  4UOC A;  4QQB A;  3TUI C;  4I2Q B;  2AF6 A;  4CLS A;  2LA6 A;  3FCV A;  3T6J A;  3MFI A;  1Y10 A;  3BH7 B;  2UUC F;  2V8V A;  3Q8P B;  2N82 B;  2CQD A;  3ZZ0 A;  1MRO B;  2DRB A;  2JJ4 D;  1FXD A;  2WON B;  2RD5 C;  4G1I A;  3JXO A;  4U6P A;  4CO0 A;  2VPY B;  3O3L A;  1EZZ B;  3FQK A;  1CJT B;  3LGN A;  1RT6 B;  1QVF R;  3MR2 A;  1OJ4 A;  2ZBP A;  3CUL A;  2I9S A;  2AJ2 A;  2CPZ A;  1O51 A;  5D3G A;  3HSD A;  1N4L A;  5IWA J;  4DV7 J;  2QEX S;  1VQS A;  4F36 A;  4HKQ A;  1TTH B;  4WU3 A;  1KFD A;  1HWI A;  4RUB A;  2E1A A;  1JLB A;  2E5J A;  5BYR A;  3DLH A;  1RAD B;  1HKA A;  4YR0 A;  3MUM P;  4Z2X A;  4DL4 A;  3EVW A;  4YP3 A;  5JJB A;  1S1V A;  3W9J A;  3MMC A;  2ZM6 F;  2HYI B;  4JI3 J;  2G13 A;  5JUM A;  3D68 A;  2RF2 B;  3ITH B;  2OEJ A;  4W4M A;  1VQM S;  1XC9 A;  2LU2 A;  5I3P A;  1R0B G;  2IAJ B;  3HSG A;  2MZ1 A;  4OX9 F;  4EU0 A;  1PIE A;  2GIR A;  4EEY A;  1HYS B;  3C6U A;  1HR0 F;  2DXF A;  3AD9 C;  1F5B A;  3AOA A;  2BDP A;  3NOG A;  3T19 A;  2CDQ A;  4WTO B;  3HFZ B;  4I6A A;  4MYU A;  3AT1 B;  5J2M B;  2NPI A;  3POT B;  1S9E A;  1SUQ B;  3S1T A;  2AX1 A;  1GQE A;  2HBZ B;  4JI1 J;  3KK1 A;  4CLT A;  5AE2 A;  2E1P A;  1V5I B;  2ACM A;  3LWL A;  1U1O A;  2ZH2 A;  3GYN A;  3SFU A;  3W8G A;  3L09 A;  2VHG A;  2MQL A;  1APS A;  4USK A;  1RWX B;  3HHD A;  5DDR C;  1N6Q B;  5CYM B;  2YKA A;  2OSR A;  4FN5 A;  4F7V A;  3DHX A;  4IO9 Q;  1BXN A;  4MK9 A;  3PYF A;  5RUB A;  2R8H A;  4WK3 A;  5KFE A;  2FLL A;  4JI4 J;  1M5S A;  1WWH A;  5B0D A;  5H1S V;  1UEV A;  3DNC A;  2ZUG A;  2F4V J;  2KJV A;  2CA9 A;  2HZA A;  2C2M B;  4PAA A;  2R2U A;  2O1P A;  4R25 A;  1H6K X;  2R7O A;  1TKZ B;  3QSI A;  3AXM A;  3H5X A;  2GQC A;  4B3R F;  3DOM B;  2AZ3 A;  3JYT A;  4C6A A;  1YK9 A;  2JZ5 A;  1I94 J;  2L9N A;  3L95 X;  1T9U A;  2WW8 A;  3TAQ A;  5HRO B;  3N5F A;  2DY9 A;  3R27 A;  1L3S A;  2MLZ A;  5D6G A;  3H2L A;  1FKO A;  3DRR B;  2CPY A;  3J7Y I;  2M70 A;  2MSS A;  2DNR A;  2HBR B;  2N3L A;  5HN0 A;  2LXI A;  4ED0 A;  4LRC A;  1F1B B;  4F4A A;  2CUY A;  3T5H A;  2AW0 A;  2CQC A;  3OTB A;  4DR1 F;  2R8J A;  4WXW A;  2WSE C;  2DHG A;  5CHC B;  3SCL E;  3VQS A;  1Z2Z A;  4MIW A;  2FDN A;  1U49 A;  1SC3 B;  4QYZ K;  2BAB A;  2BMB A;  2HWT A;  2YKP A;  4NYP A;  2HHV A;  2VG5 A;  2VBY A;  4KO0 A;  4PPZ A;  2V69 A;  2VBZ A;  4QIG A;  3W5X A;  1UAW A;  3B8H A;  2AYM A;  3DI6 A;  3KUG A;  1WHX A;  1B70 B;  1KLN A;  1N48 A;  1X0F A;  3W63 A;  3ENW A;  4EUV A;  4NA2 A;  3ZZZ A;  4FS1 A;  3OTC A;  3MM6 A;  3K59 A;  3I0R B;  3ZTQ A;  3VVT A;  1MSW D;  1RTJ A;  2MQM A;  2WBM A;  2GJ2 A;  2W2M P;  4Z7Y A;  2J76 E;  2LLZ A;  4O4G B;  4RX6 A;  3CF5 Q;  2LXU A;  2ZFH A;  2F7V A;  4QIE A;  2ZC3 A;  3LPE A;  4C0O C;  3O44 A;  2I2Y A;  1KWM A;  5KFY A;  4WCE Q;  4Y28 C;  1NND A;  2D1C A;  1VQ5 S;  3ICL A;  5IC4 B;  4KGX B;  2CJK A;  2DNY A;  4RO0 A;  3MAA A;  4NLU A;  1YSJ A;  4BS2 A;  1U02 A;  1TL3 B;  4X62 F;  5HQ8 A;  2UXD J;  1TVR A;  2MLX A;  4ELT A;  3Q22 A;  4NPO A;  1Q78 A;  4Y2A A;  1E6Y A;  3R9L A;  4OFZ A;  1SVD A;  2RU3 A;  2XHW A;  3OTO J;  3IGN A;  2G2O A;  2HND B;  3DOK A;  2HG4 A;  5LT5 A;  3MR7 A;  5IM0 B;  2ZBQ A;  3GCX P;  1SC1 B;  3U27 A;  4AD6 A;  2PEB A;  5ETM A;  2V2Q A;  1NHK L;  3LAL A;  4PQU B;  2B5J B;  3A3O B;  1V9O A;  1R43 A;  3KJV A;  2I38 A;  2GIQ A;  4LF6 F;  2DIV A;  3G86 A;  3HZG A;  5HVG A;  2UZA A;  4M5J A;  5KG3 A;  2XMW A;  1RXO B;  4DR5 J;  4A48 A;  1WI6 A;  4IG3 A;  3WZ0 A;  4Y2K A;  4ZLP A;  3QJL A;  2L48 A;  2LYV A;  1KRP A;  1PBU A;  2QMW A;  4M5H A;  2KM8 C;  1A9N B;  4YEA A;  5BR8 J;  1M1K T;  1T8E A;  3CED A;  4WIQ A;  1S72 S;  5HLF A;  1SXL A;  4DUZ J;  3TRG A;  2NXC A;  3K8V A;  5F8L A;  1CJV A;  2ZHB A;  2VQF J;  4FF3 A;  3SZ2 A;  3RW7 A;  6FDR A;  2KZM A;  4OYW A;  3VAH A;  3WIU A;  3K89 A;  2POK A;  3CIM A;  4FNI A;  4DJB A;  1Q53 A;  2FD2 A;  2IDE A;  4A4J A;  4C11 B;  3GYG A;  2XMM A;  3QZ7 A;  3C16 A;  3FBC A;  3ILJ A;  4K4V A;  2V94 A;  3AOC A;  3QPI A;  4R0J A;  4XPE A;  3HFV A;  2I5J A;  4L3N A;  4I67 A;  4IOA Q;  3PR4 A;  1IWG A;  4ATN A;  4DL3 A;  4OYO A;  2F8M A;  1IBK J;  3FKB A;  3IS9 A;  2U1A A;  3CGI A;  3MMA B;  2NZ4 A;  4KHP J;  3FSI A;  3PJ9 A;  4LQ3 A;  1R89 A;  3CJK A;  4LRB A;  4UY8 5;  3M8Q B;  1UZD A;  2VIH A;  4M95 A;  1CC8 A;  3ISZ A;  4B3O B;  4Q8E A;  1JXE A;  3WX8 A;  4QCL A;  2QRR A;  2VAS A;  3AB2 B;  3EGZ A;  4KC5 A;  2KFY A;  4ECR A;  5A76 A;  2Q43 A;  4ID8 A;  1FX2 A;  1NJI T;  1PSD A;  2W9C B;  1FDB A;  1RWO B;  2AYB A;  3MDF A;  1JNZ B;  4CQ1 A;  1ZBT A;  3D4J A;  3IG1 A;  3I5A A;  1XBW A;  4DX8 H;  3MM5 A;  3MM7 B;  3KLF B;  3O5T B;  1DLO A;  2VOP A;  3ZNJ 1;  3RRH A;  2HQI A;  3A8J A;  2EK1 A;  1V3Z A;  2M4M A;  5U47 A;  4I2P B;  5DG7 A;  2O01 C;  2DTJ A;  5EHH A;  4W92 B;  1FKA F;  1S7I A;  1YJR A;  4LF5 F;  1D1U A;  1UFL A;  3TX0 A;  3C15 B;  5BYS A;  5F8M A;  4L76 A;  1SV5 A;  3GR0 A;  1K44 A;  1YJU A;  4XK8 C;  5DDP C;  1S12 A;  3D1O A;  4DI6 A;  1LK7 A;  3PW7 A;  4M5D B;  4ZVT B;  1Y11 A;  3QID A;  4X66 F;  4HI2 A;  1HBU B;  1TAQ A;  3H42 A;  3T1H F;  4OI4 A;  4HHJ A;  1RBA A;  3MPD A;  2SXL A;  2M9K A;  1T9Y A;  3M6U A;  5HK4 A;  2YX7 A;  4LRA A;  4IQX A;  1BQM A;  2D41 A;  3LGM A;  3LF0 A;  4CT9 A;  2AEF A;  1HQE B;  2HNZ A;  3ZTO A;  4F0H A;  2V5H G;  3DOL B;  4YME A;  2YNH B;  3PO4 A;  1C4A A;  3QRP A;  1S97 A;  4RZR A;  3R5A A;  3E01 A;  5FII A;  1WKJ A;  2WBR A;  1J5O A;  4F4X A;  2PD1 A;  4MFB B;  3NGK A;  3VAL A;  4HLB A;  2OGU A;  1XN9 A;  1RTH A;  2IM3 A;  3TO8 A;  2K8G A;  1QAY A;  2DO4 A;  3SQG A;  4ED1 A;  2ZKU A;  2K1R B;  8ATC B;  1RBL A;  5KFZ A;  4A8M P;  4BCA A;  4MT1 A;  2DVI A;  4LF7 F;  2JEG A;  3MM8 A;  1FCA A;  5D8H B;  2M0G B;  3IMQ J;  4AQY J;  5A8R A;  2EEY A;  2QX0 A;  1YVF A;  2QLJ B;  2YKN A;  4P2S A;  2C2R A;  3J7A N;  1T3N A;  4F50 A;  3RBZ A;  1HNI B;  4UY8 T;  3CDA A;  3DRX A;  3FZB A;  2D9O A;  3HP6 A;  4ZOS A;  2YWK A;  3AB4 B;  3CCM S;  2YNG A;  2YNF A;  3DGP B;  4DSI A;  4LFA F;  4LT6 A;  3IRX A;  2ATC B;  5K5M A;  4NXN J;  3SV4 A;  1YJN S;  3KK3 A;  3Q2T C;  5E7O B;  4ZPV R;  1G1X A;  3TYT A;  3OUY B;  1C4C A;  1N52 B;  5LXY A;  1IBM J;  3D6T B;  5KT5 A;  1TP7 A;  4C2M A;  3MAH A;  2BQU A;  1VBK A;  1R8B A;  3D67 A;  4CTA A;  1FWL A;  2CPD A;  2ROP A;  2XSJ A;  4U96 A;  2D74 B;  4QW9 A;  3UCU P;  4LFC J;  1WC6 A;  1ARO P;  2DCL A;  1O0P A;  3V4M A;  1XQI A;  2N7Y A;  1KTV A;  3G8T A;  2DBB A;  3J81 U;  2XLK A;  1NB2 A;  4MYT A;  1FRI A;  4O3S A;  1B7Y B;  3DKD A;  3H5S A;  3HXM A;  3V5R A;  1H2U X;  3MUV P;  3ENA A;  1K0V A;  4P52 A;  3TZZ A;  1U09 A;  4LJM A;  2HEK A;  2GO9 A;  3PXG a;  1S5Z A;  3W3S A;  4NLS A;  4PPD A;  1ZH5 A;  1IUJ A;  2YQ0 A;  1S9G A;  1XTZ A;  5L8R C;  3CIZ A;  1QAX A;  2V9W A;  3AQO A;  5E0O A;  1YDL A;  3SYZ A;  4AUK A;  3LP2 B;  1WDT A;  3GTY X;  4RW4 B;  2J8A A;  3CT9 A;  2ZKT A;  2UUC J;  3FEZ A;  3JSR A;  1O5J A;  4HL9 A;  2B9E A;  3MTK A;  1VI7 A;  4B08 A;  2O66 A;  3W1Y C;  1MN9 A;  4JI6 F;  1TMJ A;  2YWW A;  1SIZ A;  1T0T V;  3NNA A;  3R5J B;  1JMT A;  4QJV A;  3LP1 A;  4PZV A;  2FJX A;  4NLX A;  1FFG B;  3ZXW A;  2AQ4 A;  4YR3 A;  1RT7 A;  2B6A B;  4M94 A;  3SSQ A;  3PV8 A;  1CSJ A;  1RKI A;  2H1Y A;  2OML A;  4U7U D;  1TV6 A;  2ZBR A;  4FP9 A;  4M63 A;  2F9D A;  2I8E A;  4RKU C;  4PWD B;  2X1F A;  1VRU A;  2LQ5 A;  4Q44 A;  2CNN B;  3W61 A;  1MML A;  2UV8 A;  2UUT A;  2UUA J;  2ZE2 B;  3MED A;  5FD1 A;  4IDK A;  1VC6 A;  2MGZ A;  1UKU A;  2PFF B;  3KNG A;  4J9O A;  4NLR A;  3U1M A;  3C8Y A;  1TR0 A;  5C24 A;  2RU9 A;  2PT0 A;  1RT1 A;  4NEY A;  3JB9 k;  1WUU A;  4QR2 A;  2XQC A;  4RW7 B;  2DGX A;  1R8P A;  1NSQ A;  1CJU A;  1YBU A;  3QAT A;  1SIW B;  5DG8 A;  3MMB A;  4WP8 A;  3DMJ B;  2MQQ A;  4LF4 F;  4RNF A;  4E0D A;  4OX9 J;  2HK2 A;  1UPP A;  1X4A A;  2PMZ D;  2R2R A;  1HLW A;  2JFD A;  2XMA A;  1T05 B;  1A0O B;  1WSV A;  3T1A A;  4MKA A;  4J9K A;  1QE1 B;  2OIH A;  5GAH U;  2ADC A;  3DHW C;  2LDY A;  3UNY A;  2HFO A;  4W90 B;  4JI0 J;  1S7H A;  3HKW A;  3PW5 A;  1JB0 C;  1OPI A;  4N8N A;  2ZVS A;  2ADB A;  3K5N A;  5J1E B;  2CPH A;  2CNO B;  3N9U C;  4ZVF A;  4H4O A;  3GJQ B;  2V50 A;  3MD1 A;  1RT5 A;  3TQE A;  1PAE X;  4DSJ A;  2JNJ A;  4NEZ A;  1XR6 A;  2C3Y A;  1WSR A;  2Z2Z A;  1U1Q A;  3QLH B;  3A13 A;  3AFG A;  3D54 A;  5GAG I;  1SL2 A;  4NLG A;  2OH2 A;  3LQV A;  3MR5 A;  3CMQ A;  3W66 A;  2YBV A;  3J7Z 5;  2L08 A;  2E5I A;  4I7F A;  4IO1 A;  2W7A A;  2BOA A;  1ULR A;  1QJH A;  2G1H A;  1Q95 G;  2AYE A;  4UT4 A;  2IJR A;  1JLC B;  3OVS A;  2HHH F;  1P9Y A;  3LA0 A;  5HMZ A;  1J27 A;  3PW4 A;  2ZOF A;  1X4H A;  1DTQ B;  1LW0 A;  5K8O A;  3VZH A;  4F8R A;  2GX8 A;  2MDA A;  1UMJ A;  4X4P A;  2HS3 A;  2M8D B;  5KFP A;  2HZV A;  1GEH A;  1CJK B;  4ILR A;  2MLY A;  4HTJ A;  1Z1Z A;  1VQ4 S;  1Y3J A;  3M1V B;  1S1T B;  3UN5 A;  3MI7 X;  4LFB F;  4Y6I A;  3H7H B;  2XZD B;  1N5S A;  4O44 B;  3MCS A;  1SQE A;  4HR2 A;  2WVF A;  2MZS A;  3PAC A;  4R0E A;  2APO A;  3D6M B;  2NS1 B;  5HVH A;  4RW6 A;  3R97 A;  4XDC A;  2YKM A;  3KLG B;  2E9T A;  1T9V A;  3GFH A;  3JSM B;  1VYA A;  2E5H A;  3UPF A;  3TR5 A;  2L9D A;  1U6F A;  1HMV A;  1GT8 A;  1U0S A;  3TJ9 A;  5BXI A;  2LEC A;  1SH0 A;  5F8G A;  3HJF A;  2M88 A;  3NLC A;  2AGQ A;  1YRT A;  1UPM B;  4O3N A;  4CIO A;  5IV4 A;  5KOW A;  3KUE A;  3NAI A;  4NCG B;  1NCL A;  5JMN A;  3OBI A;  3H4B A;  4DR1 J;  4KGZ B;  1H3D A;  3UI3 A;  3B78 A;  3FUY A;  2BJ3 A;  1KVK A;  3IAM 9;  2KH9 A;  3CD5 A;  3A12 A;  2Y1I A;  3DLL Q;  3EYZ A;  3EUN A;  3SCK E;  5AXL A;  2WHO A;  5KFC A;  2QZ8 A;  3G8S A;  2YH1 A;  3BDP A;  3KLE B;  4CP5 A;  1DY3 A;  4AL5 A;  4AYB D;  1YTY A;  1GXT A;  4DPW A;  4ZS6 A;  4NI2 A;  2XM3 A;  4ED2 A;  4WZM A;  4HAC A;  4I6Y A;  2W9A A;  4OV1 A;  4RL1 A;  3H90 A;  3I5C A;  1NSP A;  1LNQ A;  1VQN S;  3KLV A;  3R5G A;  2HMI A;  3C3L A;  1RSC A;  1PC4 A;  1VQ8 S;  3BQ0 A;  3PRV A;  3OFG A;  7AT1 B;  2ASY A;  3OD2 A;  1Y7P A;  3IWL A;  3PY8 A;  3SV3 A;  3C19 A;  4K59 A;  3OFE A;  5F8H A;  2XMV A;  3DLG A;  4QIW D;  3HT3 A;  2VFV A;  4OHZ A;  2B4O A;  5E41 A;  1T11 A;  3MPY A;  1WJ9 A;  3J7Z T;  2P9E A;  2JVO A;  2XB2 D;  3SI8 A;  4I1T A;  3K5L A;  5C2G A;  2G0I A;  2OFH X;  1VMB A;  5KAK A;  1QSL A;  1DTT A;  3E3X A;  4LVN P;  4OHW A;  3LUY A;  3US5 A;  2L41 A;  4X62 J;  1MG7 A;  1TL4 A;  3MPW A;  1K1Q A;  2YX1 A;  4RPF A;  2IAJ A;  3W2V A;  3NG8 A;  1RAC B;  2CXE A;  1ZZN A;  4IOB A;  2C22 A;  5GAH I;  5IOL A;  2FVS A;  2J7U A;  3GG0 A;  4OI3 A;  3UR3 C;  1JLB B;  2CNK B;  5KFI A;  3Q86 A;  1CVJ A;  4MH8 A;  5M2U A;  5J2M A;  4G1P A;  4IYQ A;  2X3G A;  3RRK A;  1S1V B;  2JX2 A;  3MMC B;  3EZU A;  3PX0 A;  4LF6 J;  4ZVH A;  5K8N A;  3DLE A;  4GO5 X;  4TVA B;  3TAM A;  4DX7 A;  1ZA1 B;  2ZDP A;  2VJV A;  3WBZ A;  4RBT A;  4WF9 Q;  4ES1 A;  2HFU A;  1N36 J;  2KG1 A;  4J9M A;  3L7O A;  2NUU G;  5F3T A;  3WC0 A;  1DAX A;  2JFK A;  2W8K A;  3KTQ A;  1KQF B;  2QLW A;  3C6U B;  4UOH A;  3PYD A;  2F3J A;  4BWM A;  3M9M B;  2YQ1 A;  4TYB A;  1S77 D;  3DDN A;  3T1Y F;  3HX9 A;  2XYH B;  5A8W A;  3ILO A;  2VPX B;  4DSE A;  2DNG A;  5KT3 A;  2FTR A;  3H5Y A;  1S9E B;  1KFS A;  9RUB A;  5EUH A;  3EGV A;  4DN0 A;  2GFF A;  3E8O A;  2M52 A;  2GGP A;  2QT7 A;  3KK1 B;  3WQP A;  4F4K A;  3JTN A;  2YVS A;  4D3G A;  4X4T A;  1X4E A;  2NUH A;  2X1B A;  4KHR A;  4OYX A;  1BD6 A;  4WPA A;  3ISN C;  4ETZ A;  3TAR A;  1O6X A;  5EX3 A;  2R7R A;  2AGP A;  3EDR B;  1R0A A;  3QT5 A;  1WOO A;  3H25 A;  3I32 A;  3IWX A;  3KLH A;  4MTP A;  1VDH A;  3UFC X;  3MUR P;  2BV3 A;  1LWC A;  2B7B B;  1PC5 A;  2XO7 A;  4GC6 A;  1BQX A;  3M05 A;  5GME A;  2DYA A;  3M2U A;  1NEE A;  3X1L B;  4DUY J;  1CQN A;  4QYR A;  2B9Y A;  1X60 A;  3OXF A;  1U45 A;  1S79 A;  1C0U A;  1U25 A;  5F8J A;  2HHQ A;  4CCH A;  3KG4 A;  3JYT B;  5A8K A;  3FCH A;  3BQ1 A;  4NL5 A;  4WFY A;  5KFV A;  1F60 B;  3OR1 A;  4PG5 A;  6FD1 A;  1ZTT A;  3VQT A;  4YDD B;  1MN7 A;  4MK8 A;  2HHS A;  5KFM A;  1X9W A;  2DT9 A;  2HRY A;  5EGY A;  4IR9 A;  4YN3 B;  1IQZ A;  2BUN A;  3MOJ B;  4GVB A;  2VFT A;  3DRP A;  2OHD A;  4AL6 A;  4LBP A;  4ZVR B;  3P3D A;  2CAJ A;  4WWS A;  5KFG A;  5HO4 A;  3S8S A;  1N5T A;  3CME S;  4OQJ A;  5M2P A;  1UVN A;  2XMT A;  2Z2Y B;  3TUZ C;  1B64 A;  4M5L A;  4IH7 A;  2J0Q D;  3TZX A;  3UDV A;  5AE1 A;  2VG5 B;  1JLA A;  2BKN A;  3D1H A;  4KO0 B;  1K9M T;  1N34 F;  1LWF A;  2UXC F;  1FWK A;  1QUP A;  2IJF A;  4X66 J;  3NS7 B;  4N56 A;  3SCI E;  3C2P A;  3FMW A;  3T1H J;  4YR2 A;  3DI6 B;  3KLI A;  4DS5 A;  4CO4 A;  1BWV A;  3LAN A;  4ZJL A;  2XS5 A;  2WSC C;  4WYW A;  1JLG A;  4CNZ A;  4ANC A;  1OS5 A;  2C2D A;  4RLE A;  3OHB A;  2KHC A;  3GJT B;  3MM6 B;  4DQI A;  3TAN A;  1RTJ B;  2H65 B;  2E1M C;  5KFN A;  2VUG A;  3CCU S;  3HD2 A;  4OX6 A;  2LFV A;  3MWB A;  1OSD A;  3UD4 P;  2OTL S;  2JHE A;  5IWA F;  2VIC A;  4DV7 F;  2BVZ A;  3WIV A;  2EI5 A;  3ZTP A;  2G0C A;  3T5L A;  1FF2 A;  1N0V C;  3UQS A;  4J9S A;  2XS7 A;  2AYG A;  2KHD A;  2HND A;  2DIU A;  1R0C B;  3MEG A;  1OPZ A;  4DU8 A;  4J37 A;  2CJ9 A;  2IM1 A;  2Y1R I;  1F3F A;  3EWG A;  3I6P A;  5I3U A;  2ERR A;  1FDA A;  1XK8 A;  1FEE A;  2ZOM A;  2RUG A;  2HGM A;  4OZJ A;  2IFX A;  2CWK A;  4LF7 J;  1XMB A;  5CCL A;  1P27 B;  1RT3 A;  4JI3 F;  3GMG A;  3NS6 A;  2ZBI A;  2R9L A;  1B7F A;  5B0G A;  1LFW A;  3MGJ A;  2RDI A;  2RML A;  3R1H A;  4ECT A;  4BC7 A;  1MWQ A;  1TVR B;  3K0J A;  4WP3 A;  2XWX A;  4RW9 A;  3O6Q A;  2DNK A;  1E6Y B;  2XC9 A;  1FJG F;  2DHA A;  3R7S B;  3D0H E;  4Q0B A;  1L3V A;  3DOK B;  2FJE B;  4QWD A;  4EWT A;  3QSY B;  5T41 A;  2R8K A;  1SKU B;  4ALZ A;  3J80 Y;  1EET A;  2EC0 A;  1NB7 A;  3KOA A;  3MEC A;  3KJV B;  3ISN D;  4FVC A;  1RUS A;  1ZM9 A;  4MIB A;  4TQS A;  4DR4 J;  3T9N A;  4JI1 F;  4FF4 A;  2LQB A;  2O67 A;  2HNY A;  1GXU A;  3IA0 A;  4ER8 A;  4IG3 B;  2RT3 A;  4DL0 C;  3FK4 A;  3GWC A;  2D9P A;  4K2J A;  5D0R A;  4ZN1 A;  3HI9 A;  1ZM3 A;  4ZVO B;  4N8O A;  2VL1 A;  1HHS A;  1WKK A;  3CDE A;  2C2O B;  1VC5 A; 
#chains in the Genus database with same CATH homology
 3W8P A;  2QFI A;  2ZZT A;  5HSP A;  3BYR A;  3BYP A;  3H90 A;  3W66 A;  3W65 A;  3W64 A;  3W60 A;  3W5Y A;  3W63 A;  3W5Z A;  3W8G A;  3W5X A;  3W62 A;  3W61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...