2ZZTA

Crystal structure of the cytosolic domain of the cation diffusion facilitator family protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
83
Chain Sequence
b'MKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTYFIEMDIEVDGKMSVKDAHELTVKIRKEMLKRRDDIEDVTIHVEPLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein
publication title Crystal structure of the cytosolic domain of the cation diffusion facilitator family protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 18
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16916 ZT_dimer Dimerisation domain of Zinc Transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 2zztA00
3H90A 2QFIA 3W8GA 3W63A 3W5XA 3W62A 3W64A 3W60A 3W65A 3BYPA 3W8PA 3W5YA 3W61A 3W66A 2ZZTA 5HSPA 3BYRA 3W5ZA
chains in the Genus database with same CATH superfamily
3IR5B 1K1SA 1X7VA 5KFUA 2FY1A 1UETA 3MAHA 3ITHA 1GMWA 4R25A 3H8YA 3I56S 3M6UA 1GXUA 2NZCA 2XSJA 1I1GA 4NZ7A 4D3HA 4NXNJ 1S49A 2FJWA 3AHPA 1HBNB 3G6VA 4LSLA 2HK2A 4DX7A 1TUWA 3UDLA 3KNGA 4NI2B 4FYXB 4P7TA 4URQU 3VAGA 2AJ4A 2QLBB 3DLLQ 2DVIA 2ZZMA 1P6TA 1U2FA 1LWFB 1CLFA 2HRUA 3ZZRA 1FX2A 4ZVFA 4ZS6A 1IQTA 3UO0A 1BQXA 3NAHA 1RT5B 1FRLA 1RKJA 2QGFB 1HW9A 2OEMA 4I6YA 5CD4H 3KMSA 3MR7A 5HO4A 2RU3A 3DHWC 1KFDA 3FNNA 2HNZA 4L75A 2RIJA 3CNQP 2CPDA 4F4YA 4KJIA 4JI8F 3V5RA 3JTPA 1H7XA 2HZVA 4ECVA 4LFAF 2OD4A 4FYWB 2Q1LA 2B5JA 3K57A 5KFIA 4LF5F 2IHR1 1CC7A 1VOMA 1ZM4A 3TZXA 3IRXA 3PG9A 5KFFA 5E33A 3PJXA 4M63A 2MYFA 4KO0B 3LP2A 4QIWD 4DSIA 2B4OA 1N36F 2NSCA 3AQPA 2RUSA 2D9PA 3TI0A 3GQCA 1PBAA 1UFLA 2JWNA 3SIPB 2G0CA 1SBRA 1HNWF 4BLGA 3GIJA 4KFBA 4TQRA 2YH1A 1VRQC 2FY8A 3HVRA 1CPZA 2QMXA 3JQJA 2VBXA 3QRRA 2K7KA 2MMYA 3O44A 2AF6A 3IMQJ 1HNXF 2AHOB 4ZVEA 1HLWA 1YLXA 4DV5J 2ZH4A 4KIAA 2KYZA 4PG6A 4NLQA 4RPFA 2LEAA 3CJ4A 3OXLA 1LKZA 4Y34A 3KXDA 2CWKA 3BBFA 4YY3F 1KHVA 1S76D 1VR6A 1S1XB 1BGXT 1FFWB 2FZGB 2CQDA 3FK4A 2EXUA 3EZ5A 4DV4F 1RABB 2YWKA 4EYIB 5A76A 4TLRA 1C1BB 1LW2A 1JLQA 4YDXA 5AXMA 5DLGA 3D66A 2CVEA 1XIQA 2I5JB 1TL3A 2Y1LB 3K17A 1VBYA 4NLSA 1NSPA 4KQZA 2JFDA 4FXDA 2VJUA 3T5HA 3HULA 4Y2KA 2X1AA 2FTRA 4DFPA 3M7VA 1NBEB 1PBUA 2DGQA 1VDHA 5IS2A 3CCMS 2EBEA 1S59A 2JVOA 4CTAA 4WE1A 1RSCA 5U47A 4MKYA 3AD9C 4QZVB 1M1HA 2R8GA 1N52B 2ZHOA 2H4WB 3WX4A 4HYKA 2HQ3A 4G1IA 2MKSA 1X9MA 3KJVA 3NS7B 2BOAA 1WC5A 1SKWA 3GYGA 4DU8A 4CO0A 3DM2B 4GMKA 3C16B 3M4XA 2ZWPA 2POKA 4W4MA 3BF4A 2PMHA 1FX4A 2E7WA 3PW2A 2XI3A 2H65B 1JJ4A 1MN9A 1RHQB 3JTNA 4IH5A 3K89A 1W25A 5C25A 3QT6A 4C8YA 3M8PA 4PQAA 2F4VJ 3DMJB 3Q0AA 3IR7B 2QA4S 2XCAA 5F9NA 2HGNA 1C1CA 1HMVB 3DOLA 3GG0A 5E3PA 5B0EA 5BR8F 3BO3A 3BBCA 3OBIA 1B4SA 1D3WA 4EUVA 4NE9C 4BWJA 1VISA 3VF0B 4RW4B 2GQCA 2OI2A 3GIRA 2FZCB 2B3TB 1T3NA 1C2PA 3C15A 3U1NA 2KI2A 1U6ZA 3GPAA 4DV7F 2ZH6A 3AOBA 2ZZNA 3KJQB 5D4PA 2OJ3A 4A4JA 1TKXA 5KOXA 3KLEB 3EXYA 3OR2B 1FXRA 1LWEB 2UU9F 5T7LB 3GWCA 2UXCF 2XMTA 3C8YA 5HATA 4ER8A 1C0UA 2VF3A 5H1SV 1FKOB 4J37A 2FZKB 5RUBA 4Y2AA 3BKTA 1PJ6A 4DSKA 1RT7B 3TVZA 1PAUB 2ZM6F 2PSZA 2DNMA 1S1WA 3LPEA 3CCSS 3OSNA 1WHXA 2HURA 2GV1A 1S1TB 2CQCA 3EGWB 3BDPA 3LP0B 4O44B 3A3NB 4EMDA 3S8SA 2F1FA 5LMUF 2NYIA 2DB1A 4H4KC 4O4RA 2ZNYA 2LU1A 2DNLA 4LSZB 4JP8A 1HW8A 4B08A 2PMWA 2VPZB 3OJUA 4DDFA 1IKXA 1GMWD 3K5LA 4WWSA 5K14B 4IDKB 4ZCKA 3JYTA 5C42A 4EFAC 5HBMA 1HHQA 2GCFA 1ZZNA 4PCQA 3HFVA 3ZXWA 2CQHA 3I87A 3GIIA 5L1KA 1D8ZA 1AFJA 4GVBA 2DISA 4B3TJ 4G1QA 2NXNA 2HFSA 5G0RB 3ZZUA 2E9TA 4IRKA 2UUCF 2P8IA 1B0VA 4M5DA 2XMUA 3M2UB 1LFPA 2Q66A 3KWMA 4W92B 4CYUA 3K7RA 3Q2TC 1TKZA 1QUPA 2VA2A 2FIUA 2W1BA 3I5AA 3I4PA 2MXYA 4DN9A 2CVIA 4LVNP 3MMCB 2EC2A 3TAQA 3BQ0A 2C3YA 1PJ5A 3KLIA 3CCQS 3Q8YA 4MIWA 4PXEA 3QBCA 2V2KA 2ZH1A 3AJ2A 1UFKA 4KHMA 3PHEA 2MZ1A 4F4ZA 3UE2A 1SC4B 3O6QA 5D4LA 4HDGA 3TZZA 5HJXA 4ETZA 1HPZA 2BX6A 4OHXA 3DC2A 3P45B 3PNIA 3RRGA 1XR5A 4M95A 2MKCA 3G9CA 2VPXB 3N4WA 4WK3A 3M1VB 2X1GA 2YQ1A 2HWTA 4M94A 2L9DA 3HI9A 4LF6J 2LLZA 4NPOA 2HNYB 4OYAA 1B0TA 1NM2A 3QGHA 3T9NA 1SKSA 3EDQB 3UVJB 4DS5A 2RT3A 1NK0A 2OO4A 4C9DA 1NSKL 4F0HA 1K8AT 3CVKA 3Q8SB 1KSPA 3RBXA 2NUHA 2VFUA 3OTCA 5KG2A 5HQ8A 2YX7A 2IAJA 4RX6A 4N76A 2V8DA 4NLUA 4NCGA 2G1HA 1MN7A 3HXMA 2DK2A 3BS9A 5KFOA 1JLGB 4CLLA 1Y4ZB 5D3GB 4USKA 1S4EA 1FF2A 3TUZC 5IT4A 1E6VA 5KTQA 3M30B 1U8WA 2LYVA 2DR8A 4OL8A 5EUHA 3G6XA 1NH8A 1UVMA 1NNDA 3CW2C 4PYDA 3KK1A 2LXUA 1WG1A 3Q83A 2D69A 2QYGA 1TAQA 3Q8UA 2CWXA 2M3DA 1PCAA 3M6XA 3M8ZA 4FPIA 1B64A 1JLBB 3RB3A 1VBKA 1TV6B 4JV0A 3SQGB 2N3LA 3KLGB 2L48A 2E5GA 2WW4A 3M32A 2VBZA 4EO8A 1HWKA 1HBMB 2DHSA 4LBPA 3BYPA 4V19J 1VS3A 2HHUA 4C11B 5IWAF 3U1MA 3KG0A 2FC9A 3DLKA 3OFEA 1QSSA 1T9WA 1N5QA 4HLBA 1UEKA 2F40A 3HVTB 2AEFA 4DBQA 5IT9U 2WBMA 5IT0A 3AODA 2YQ0A 3CJRA 2IRYA 3FGVA 4MTPA 1H3DA 3MTKA 2QA4G 3UDCA 3CCUS 3P49B 3AJDA 1AYEA 3MM7A 4ZJOA 2V9WA 3R5JB 4L76A 2DNGA 1U24A 1HBUA 4DN0A 1HA1A 2R2TA 2KH9A 3J7YU 4DR2F 2OPRA 3OL8A 1ZOTA 2CUYA 3AXKA 1FE0A 4OHWA 2I1RA 3DYAB 1FNXH 2MQMA 3DRYA 2IJNA 2C2RA 4FXWA 2XYHB 3HSGA 3ICLA 1UEVA 1X5TA 3FEXB 3M2VB 2OGUA 3QAUA 3GU0A 3C14A 4ED8A 4DF4A 5G4DA 1BWVA 1NB7A 2KHDA 1RAFB 2CG8A 1ZA1B 1CG2A 1ZM3A 3R1LA 3M6VA 4K50A 5HVFA 3OW2R 2MQOA 2CPFA 3K2YA 2LU2A 8RUCA 4CO3A 4DR3F 1VJQA 3MUMP 2ZJRQ 2HBQB 1OY6A 5KFLA 2YX4A 4FPRA 4O4GA 3EICA 1DHMA 4NEYA 1EAYC 2WSEC 2HFOA 1QAJA 5KFVA 4PWDB 4DI6A 1H6KX 3I9ZA 4DV0J 4EBEA 4P2SA 5KFMA 4E0DA 3CB4A 4NZ0A 5E3QA 2DGWA 3OVBA 3SQOP 1SJ4P 3B54A 1B70B 3DLEA 4U95A 4AXJA 2VDIA 2ADCA 1NU4A 2HZAA 4G3IA 4C4WA 2ALZA 4OI4A 4ZA1A 3JSBA 4DQQA 1FVQA 1FERA 3FQKA 5CCLA 1KDNA 2CQIA 2VL1A 2W4CA 4B9MA 1WC0A 4WU3A 3EJMA 2C3OA 1QSYA 4QIFA 2GGPB 3I0SB 1WDTA 1F5AA 1HARA 2RILA 1T0TV 1H0HB 1VRTB 4RW6A 4RNMA 3PIPQ 2J9CA 3I0RB 1XNRF 1H2TZ 3DU6A 3D0HE 1HWIA 2ALYB 2D3ZA 3DKDA 4LF7J 5I42A 1LK7A 1S9GA 2LVWA 3NMAA 1J2VA 1CJTB 4GRSA 2ZH3A 4IH6A 3AOAA 3CJ3A 4ED6A 1C0TA 4CCHA 2QIFA 1JJHA 2K1RB 3K59A 1J5EF 4ZIVA 3EX7B 2EEYA 3K0JA 1WF2A 4ZN3A 3MECB 2OFGX 1TMJA 4HH0A 2MEWA 2V5HG 2NPIA 1P9QC 1NJZA 2OEKA 1X60A 1IM4A 2VPYB 3MM6B 2EW9A 4QYRA 2XI2A 3KK2B 1RGVA 1T02A 2EBGA 4FDFA 2YWGA 3NBPA 4DV2F 3NY0A 2ZNZA 1JLEB 3VAKA 1EARA 3H25A 5M2RA 1IJFB 1JQGA 2CPXA 4LRFA 2W9BA 3OUYB 5HMWA 4EBCA 3EPIA 5IM0B 2B7CB 4A8MP 1RWXB 2MDAA 3MM9B 5J2PA 2SXLA 2HBYB 4NYPA 4WYWA 1UCNA 1XMOJ 1HQEB 3TZYA 1W2BR 3EZUA 3SDEA 4ZPBA 1SUQA 1TMMA 5E5NA 3BV8A 1JKHA 3MEDB 3TEGA 1AZSA 1WC1A 4Q2LA 3ONQA 3L09A 4F2RA 1NSQA 1YVFA 3GR0A 3DXBA 4IG3B 3P3DA 1X5OA 1U1NA 4UOCA 1CS4A 1RTIA 3RRKA 2D7SA 3RU0A 5FDLB 1WKJA 1Y11A 1GMVA 3S1TA 2VG5B 2ACMA 4C48A 1K9MT 3CCZA 4X4OA 1N5YA 5DQGA 1UZDA 3V4IB 4DU7A 1FWKA 5LSOA 1Z2LA 2N82B 4DV6F 3DGPB 2QC3A 1BY9A 1NKCA 4DG1A 5K9FA 1XQIA 2DRDA 4YR2A 3J7YI 1TL1A 3CJ0A 1XNQF 4Y00A 3W62A 3CJ2A 2R7VA 3MCSA 4JI6J 1M5VC 2FQQB 4CLWA 4ZIWA 4JI7J 2RH3A 1JLFB 2RSQA 1S1UB 2PEHA 1RKIA 4B3OA 3DXSX 5KFWA 3POTB 1RDRA 3OTBA 5M2UA 1TUVA 5ETQA 3J81Y 3W9IA 1VBZA 4XIUA 2WB1D 5GVQA 1B99A 5IV4A 4O3NA 4MK7A 1PAEX 4ECXA 2AQ4A 4OZLA 4P6QA 5DS7A 3QT7A 4NXNF 4A48A 3PW7A 3QLHA 4JI3J 1RAJA 1UZHA 3CD7A 1WTBA 3CF5Q 3DLBA 2HWHA 3US5A 2E9RX 3KTQA 3TAMA 4M5HA 1S99A 1M5OC 5CYQB 4DQSA 3W2VB 4M5KA 1ZM2A 2VKZG 1SKUB 3PYDA 3SZ2A 4Y65A 4AYBD 1M1KT 4ZVHA 5C24B 4X4NA 3W3SA 1VGYA 3FBEA 1TFWA 5F3ZA 2QA1A 2WVBA 2EC0A 4NLWA 4AQYJ 5CYMB 2R8JA 1HWUA 4QIVA 4PXDA 4OLPA 3W61A 1XN9A 3PEHA 1FKPA 4IO1A 2GO8A 1NAQA 2NPFA 2C1EB 2MHEA 3CJKB 3TARA 3VZIA 3GP9A 1Q5YA 4LMZA 4Z7CA 2V9KA 5KFKA 3J7Z5 3QWUA 3BJYA 1RI7A 2VC1A 3L7PA 3MMAB 1RT6A 4GO5X 1LW0A 3NLCA 2ZKUA 4FN5A 2MKIA 4DPYA 3KK3A 4KSEB 1YJTA 3EE3A 2AW0A 3G71S 4KC5A 4OX8A 3MWBA 1U0HB 2ATCB 2HGLA 4K8RA 1TR0A 1X4EA 1WSRA 2YBVA 3N5BA 4CQ1A 1U1MA 2DJWA 4M1KA 1WI6A 1H73A 3NGTA 3TA1A 2XS5A 4KR0B 5ETRA 3BYRA 3N5FA 4DV5F 2ZOGA 2LQBA 2Y8WA 5HLFB 1DQ9A 3KUHA 2RDIA 2Z0GA 3FCWA 3WZ0A 4B02A 2AX1A 4JI0J 1U02A 4YHHJ 2YKAA 4P52A 2ZBCA 3D0IE 5LT5A 4F4WA 3VGSA 3UN5A 5H9FK 1VQNS 1R8CA 4EO6A 4DF8A 2BEFA 4IOCQ 3OTOJ 1IKVB 3NGKA 3HO1A 4RBVA 4X66J 4OYIA 3OLAA 4LF1A 3A12A 2KVIA 3MEGB 1RAIB 2M0GB 1R8AA 4A8XA 1PC4A 2GFFA 4HR2A 4TNOA 5KG4A 3E8OA 1TTHB 3V6JA 1M5KC 4NCAA 3IN5A 2IDEA 2J8AA 2YNGB 4MH8A 1L3KA 3P4UB 3DLGA 4TQSA 2DNNA 1Y5IB 3PJWA 4FS2A 1U7LA 2RKIA 4Y0FA 3MAQA 3HX9A 5HVGA 4NXMJ 4RW7A 1FRKA 1F9FA 2HIYA 4NLYA 3O5TB 2KXNB 2CJYB 3PYFA 2BE2B 2DGSA 4WYLA 4OI1A 5CZVA 2GMJA 5BYSA 3BR8A 3BGFA 1RHUB 2O01C 7FD1A 3UFCX 5GMKa 4HI2A 2QJ3A 1RAHB 5C7PA 4CWBA 8ATCB 2UUTA 2LA4A 4M5IA 2BW2A 2Y9HA 4F4AA 3W5YA 3FZ2A 1K47A 1S4FA 5A8KB 2HVZA 2HLUA 4FYYB 2KFYA 1EP4B 2F4VF 5KT3A 5D4NA 3O2IA 4ANDA 2XM3A 4RR5A 2PN6A 5KT6A 4TLQA 3VGVA 2H51B 3B78A 2QA2A 4QWAA 1HQUB 1U47A 2GAHC 4DZDA 3MMBA 5CQGA 3D3CJ 4IFYA 3M2RB 2IBKA 2FHJA 5DJBA 3R5CA 3ADAC 1FEEA 2AWZA 4E8UA 3LP1B 3FFIB 4LFBJ 1HI1A 3W64A 4EWTA 4X4QA 2ZUGA 1FE4A 3MPDA 3OT9A 2V2ZA 3F73A 3H5SA 5GADU 2JC0A 5AXNA 3LWLA 1X0PA 4DHVA 3NG8A 5B09A 4USUA 1VYAA 2VBWA 3NS5A 3BN4A 2KG1A 4Q0BB 2WONA 4N77A 4KHPJ 1X4BA 3L9ZA 1S10A 2A1BA 4ZVTB 5LJ5Y 3VQTA 3BDEA 4PWUA 4DSLA 2OP5A 5KT4A 2DCLA 1YSJA 5KG3A 5AE3A 3FEYB 1Y3KA 4B3RJ 3RBDA 1OO0B 1RCXB 2W24A 2VA3A 2K2PA 4QIGA 5FLXU 3BREA 2P9GA 4Q5VA 1DZ5A 4PPDA 5FLXY 2HEKA 1DTTA 3V6DA 3PX4A 1VQLS 3FC9A 4Q7AA 2BE9B 4R8UB 3CJTA 4IR1A 4HKQA 1Q53A 1RHJB 4LIWA 1FK9B 2WBRA 1OY9A 5F8NA 1IKYA 1FHTA 2KT3A 5KG7A 1XBWA 4I2PB 3D3BJ 4DQPA 3CJQA 4KGKA 4DFJA 3M8QA 2KT5A 4C8MA 1WC3A 2BKPA 1CVJA 3LPYA 3PO4A 4IRCA 3TUPA 4ZPVR 5J2MB 3KNAA 2DNHA 3IBWA 1YGYA 3D9BA 5KFHA 4MKVA 2HK3A 2CXEA 4ZJLA 3TOQA 4NYZA 3I9V9 3W8GA 4B3TF 3C6UA 1FI4A 4QWCA 3K5PA 2XY6A 4BDPA 5FD1A 3R5DA 2VG7B 5AXKA 5HROA 3OTEA 2ZDPA 2CRLA 2ZE2B 1ITPA 2VDHA 2XYPB 4XPCA 2JLFA 3SMZA 4USMA 2CZ4A 4LR7A 3KHGA 2RS8A 3BO4A 2RUGA 1WACA 5IZHA 2GX8A 4X84A 4AT1B 2HQIA 4LFCJ 2NXEA 5JMNA 2VB6A 1KP6A 3M9OB 1P1LA 5KT5A 2XB2D 1DTQB 4Z7YA 3G6YA 1WDDA 2RNEA 2OPQA 2QEXS 1D0EA 2G0JA 1BQMA 4ED0A 3KOAA 2OMLA 2MKKA 2KT2A 2ADBA 4KV8A 1SIZA 4EBDA 2M7SA 1FNMA 3CDBA 1KTQA 2H48B 4NLVA 1RWNB 4OZJA 3RZAA 4L72B 1LXJA 1NXIA 1VFJA 2AJ1A 4NI2A 5EWGA 3GJRB 2V68A 3UD5A 2FHMA 4DPUA 3EXCX 4J9SA 1LWFA 1TAUA 2AGPA 4J9LA 2YNFA 1RT4A 3ITHB 4CNYA 1VK8A 2AZ3A 3CE8A 2Q3PA 4LF6F 1T11A 1IBCB 1VMBA 1RT5A 2KTQA 2CPHA 2AP6A 3T19A 3MM5B 3BO2A 2B9EA 4AL6A 2IM0A 3UCUP 4U9RA 5A8RB 3NWGA 1K0TA 4ETXA 3QO9B 2JHEA 5GAHU 3R2DJ 3LW5C 4DUYJ 3HMJG 3EZOA 5F8LA 3JS9A 3HHNB 5JJBA 2Z2MA 4R0EA 1FD8A 1CQNA 2XMWA 2IA0A 2BBEA 2K3KA 5E41A 3VV2B 3KDNA 4TY9A 4RO0A 5A2QU 2MZSA 2KYXA 3HLUA 1FJCA 4DL7A 3MEEB 1EKRA 3GE9A 4CM2A 2H5IB 2B5JB 1V5VA 1VQMS 1RT1A 2EG2A 4IOAQ 1UA0A 4YFUA 4FF2A 5L1JA 5IC6B 2VASA 3IAS9 1RTZA 3IRXB 5DM6Q 4WFAQ 2MPUA 1TUGB 1BXNA 1AUSL 5D8HB 1I51B 2XEXA 1UKUA 4KFBB 2AJQA 2ILYA 1NK5A 2AX0A 3H5XA 3G8TA 4DR1J 1X4GA 4RNFA 1OSDA 2R7RA 3M8WA 3SCKE 3T9ZA 4QYZK 1S1XA 3GTYX 3HHLD 1G4CA 2C2NA 5ETVA 2V8PA 2MY7A 1ZA2B 1HNZJ 4WBFA 3LTOA 2OTJS 1OPIA 2KL8A 2DGOA 5K8OA 3ENVA 4XAKA 2O1PA 4A8OA 3B82A 1URRA 4F3OA 2YPZA 2GHWA 5J1EB 5DETA 3FSIA 2I5JA 4MFBA 1NK8A 5CABA 4B9TA 4KKOB 1ELOA 2BVZA 1CJVB 3G96A 4O3OA 2J8SA 1XERA 2RRBA 2P2CB 3PYGA 2JNJA 1NJWA 1LW2B 1JXVA 2CNOB 4O0NA 1KLMB 3R7BB 1YIJS 4FVCA 3PO5A 3GIKA 5DDPC 2QFJA 4C8ZA 2MQQA 2YNIB 4C0HA 3C19A 3ISZA 3VZHA 3R97A 1WNEA 1QVFR 3A4TA 2YWWA 4TVAB 3CCJS 2CPZA 4CTAB 1MMNA 2DKOB 4WE1B 1FVSA 4HT7A 1PYOB 3R3TA 4HACA 1S97A 4CLPA 1V3SA 1TL5A 1FJ7A 5EHHA 2FUG9 4WP3A 3CTRA 2AYMA 4I1TA 1PKUA 2D41A 5E2QA 4DV0F 3OFGA 1M5PC 2YNHA 3H98A 3QGIA 2NXJA 4LIRA 2A10A 3I96A 1T95A 1N33J 2QV6A 1K44A 4K4XA 1HMVA 2KJWA 4DPOA 3C46A 1SV5A 2LA6A 1E6YA 2BQRA 3IAM9 3MURP 1UPPA 5M2PA 3BPSP 1QTNB 2OFHX 3IR6B 4OZ0A 4CO2A 4KT0C 1VQPS 1VHIA 5C25B 2DTJA 1RCOB 3T1HF 1Z2ZA 4RW4A 1X5SA 4TYBA 4QU7A 3GZ7A 4ZVOB 1KC8T 2ATLA 4BHQA 4DL3A 1C1CB 5AE2A 3BH7B 3DOLB 4ZLNA 4WP8A 2NUUG 3VGTA 4NLPA 1YJVA 2DNYA 3CMAS 2HAIA 2ZVSA 1X4AA 2YQ3A 2DGTA 2UV8A 2P9EA 5HQLA 1F3VA 5F8GA 3CO9A 3KLEA 1LWEA 3F41A 2UXDJ 5T7LA 1WKLA 1QAYA 5LXRA 1P27B 2W2QP 4LF7F 1FEHA 4I69A 2DRBA 1T05B 3S7RA 1FKOA 2JVRA 4O23A 4DZ6A 3W8PA 1JJCB 1OIAA 1V9OA 5KG5A 2KFZA 2R8KA 1FD2A 3UDEA 1FESA 2HRYA 3RG6A 2CFXA 4NASA 2HYIB 1RT7A 4ZCMA 1HFEL 2EK1A 1ZH5A 4J9NA 4A8QA 4ES3A 3QSIA 5GAHI 3CDAA 4MAKA 3PRBA 1C0UB 4A47A 1M0SA 2C2OB 2FDNA 3HFKA 2QE5A 3NWRA 2Q6CA 3H4BA 5K5MA 3H90A 3LP0A 2XLKA 2CQ0A 3NNAA 3R7SB 3I6PA 3GCXP 3A1YG 2AYGA 2ZVIA 1KOHA 3ZTOA 4EI2A 2BM0A 4DX8H 3V2UC 2R7TA 5HL7Q 2GZOA 3GILA 2CQGA 3MOZA 2IC3B 2FHKA 1S1WB 3DOKA 2LQ8A 3LAMA 5CXTA 1U09A 4QJVA 2IFXA 3P96A 4KRWA 3SV3A 2IDLA 1R43A 1NH7A 2D9OA 4DJBA 4NYOA 2V0NA 3O8WA 1XMOF 3BKUA 4OZ1A 1AROP 3LUYA 4OYBA 4ATNA 3MFHA 3QRQA 4IRDA 2LXIA 2HFNA 1Y9OA 1O5JA 1GEHA 3OSPA 2XTJP 1HBOB 4ED1A 4JV2A 5KG6A 3MGJA 3KJFB 4B9LA 5HBMB 1RYRA 3D0GE 2JZ5A 1S0OA 2W4PA 2U2FA 3NXZA 2DGUA 1MWQA 1LNQA 5HK4A 1RTHA 4FNIA 4NLRA 5KFBA 1VQYA 5F8IA 4CO5A 3KMQA 3I4HX 4M5DB 1KONA 2X3GA 1IR1A 1U1KA 2RF2B 3LF0A 4URGA 4CYUB 2ROEA 1Z4UA 1AUDA 1TKZB 4URSA 3DRSA 2Z8QA 2ZH9A 4LJMA 4FZVA 4N8NA 1GTEA 2XMMA 3FKBA 4YQWA 1UPMB 4WTYA 5L9XA 1TU0B 4GO7X 3DRRA 3KLIB 4OJ3A 2D1CA 2UVWA 1ZPVA 2ZWOA 4JI6F 4PG8A 5EX3A 4O3RA 3SCLE 4TXSA 2DNPA 4CO1A 1GX6A 4CLTA 5DDQC 2RHSB 4JI7F 3FSYA 4LRDA 3M1VA 3GCWP 4C7QA 2D3UA 4ECZA 4USJC 2I2YA 2W7AA 5K8PA 1SB6A 3IP0A 2AV5A 1Y00A 2E66A 2DNKA 2NCKL 5IQ6A 4V19X 4FBUA 2GQQA 2BYCA 4PG7A 3PRVA 2NR0A 4ZCLA 2BQ3A 2BOPA 1NZ8A 4JI3F 1TKTB 3A8EA 3TJ9A 3OFHA 2NLWA 2VJVA 2BZ2A 1SC6A 4PXCA 3ISNC 2JC1A 2HNDA 2YX1A 2D74B 2R7QA 4NLDA 1ZZFA 1JLGA 4DLGA 3EPGA 1S7IA 2G1DA 2GAGC 3M30A 3MR3A 4EEYA 3OPKA 1IBKJ 2W2NP 2XNQA 1I94J 2XCPA 2E5LJ 3NKYA 2D3OR 3D5MA 2EFOA 4K4SA 5LJ3Y 4NOHA 2GNKA 5H9FJ 3W63A 3ZZOA 1BHNA 3BGOP 1JLBA 4AQYF 1F1BB 4WTOB 2PI5A 2NZ4A 2O3DA 1EJ7L 3KLGA 3N6MA 2HKEA 2Z30B 4I56A 3R1HA 2KO1A 2GJFA 4ED4A 1WJ9A 3A8IA 1TKDA 4F4XA 1RHKB 2W01A 3PXGa 2QMWA 1IBMJ 3J7A1 1S0MA 5LSLA 2NYHA 4RBUA 3J7AN 5BJRA 4JYAJ 3PJ9A 4MK9A 2C2EA 4TU9A 2VFSA 1YX2A 5IV3A 2UXBJ 1UA1A 2V63A 3D1HA 2MQNA 3NCQA 5J2QA 3H5UA 2B4UA 3IBFB 4TY8B 3Q89A 5ETNA 5HP1A 1CEZA 2MKYA 1UW9A 2FVSA 4F7VA 1RT2A 1JLAB 4EU0A 4CT9A 2DEIA 5DRKA 4I4BA 4LF4J 4WJBA 1WG4A 2V8GA 3CC2S 1T8EA 4X65J 1L3TA 2Z2ZA 3WIUA 4NWBA 3RW6A 2I38A 4BCAA 4ZLPA 2RRAA 2F9DA 4JI0F 1LWXA 2KHCA 5ETSA 4YHHF 2W2MP 3U7JA 4UOGA 1T03B 3OLBA 2AU0A 3IWXA 3K5OA 3MM7B 1RP5A 3U1LA 2LDIA 1HBUB 1RWUA 4NA3A 1DAXA 1X31C 2MY8A 3QJLA 1APSA 2OPRB 3TYTA 3OTOF 3NEKA 3UI3A 4X66F 3HVWA 1NK6A 2XZTB 4JOUA 3CXCR 4U7UK 4DR4J 3H5YA 2QMUB 2XGQA 2P9CA 5DM7Q 3GYXB 1U8SA 1RBAA 4IR9A 2V2QA 2HQCA 4RKUC 3QT5A 2A3JA 2W7PA 3JAMU 2F7VA 1HL6A 1SJFA 3TAPA 2W8LA 2VD3A 1N8RT 5F8HA 4BBYA 1SH3A 2CJXB 4C6AA 1NKEA 1UMJA 3MPUB 3T5KA 4NXMF 1NJIT 4NLTA 1HIYA 3AQOA 3T3FA 2CAJA 4Q45A 3ETMA 4PKDB 3CDUA 2XMAA 5GMDA 4N41A 5JXSA 1BQNA 2M4MA 1OQ3A 2OUGA 2QL5B 2BJ1A 5L8RC 1HNIA 3M8RA 5B0GA 2VOOA 1NPKA 3T1YJ 3FMWA 4FF1A 1VRTA 1D9AA 2F8MA 3FRZA 1T9XA 1GH8A 2QRRA 4NCBA 4ZCIA 3I0RA 2ERRA 2PI4A 1S0NA 4ALZA 1U1QA 2UP1A 3DOMA 3ULHA 4CZCA 3SSSA 2ZH8A 1PSDA 2EFPA 4LFBF 4ED7A 1CJTA 1R7IA 4IFVB 4M5LA 5I3PA 3D6TB 2K1RA 4G6VB 4CH1A 2XBPA 3MECA 3DI6A 5I42B 1X9WA 3MM6A 4DUZJ 4BS2A 2YWFA 3P6YC 4KHPF 1NPRA 4ZVUB 2HQDA 3KK2A 3THPA 2A0FB 3ENAA 3NNCA 3JSRA 1ZPWX 5J1PA 2FGCA 4P9SA 2ZOFA 3G8SA 3HZGA 2RAQA 4B3RF 1MROB 3FDSA 2B8PA 1WEZA 4XDCA 5IM0A 4OYXA 2K3IA 3IA0A 2YPYA 3HVAA 2XZDB 2F65A 3DDIA 1U1PA 1YK9A 3W9HA 3E01B 1S79A 2Y3YA 1IKWA 1M1GA 4C3LA 4RBTA 4P7VA 2XS2A 2V6AA 2X3DA 3NGUA 4OX9J 3N6LA 3TJ8A 4ERDA 4RW9B 2QN6B 1IQZA 3BGUA 4IG3A 2P6TA 4CLFA 2VBYA 4LQ9A 3MPWA 2BKOA 1SUQB 4N7TA 4Y2CA 5FDLA 2YKNB 1R8PA 1GAOA 2VG5A 3QZ8A 2J0QD 4NRUA 1YBAA 2ROGA 1YJ7A 4J91A 5EWEA 2CJKA 4UUXA 3V81A 5D6GA 1P8GA 1SQEA 3PZPA 1IVZA 2VG6B 1CS4B 3DGPA 5IXUA 2XO6A 5HJYA 2EFGA 4ANCA 3ZTSA 2JEJA 5HSPA 1S6QB 4I2QA 5E0OA 3B4MA 1UAWA 1EQ0A 4ZKAA 3AT1B 2EG1A 1N5YB 2EK6A 3N9UC 4USHA 5F0WA 5LMNJ 4DR5J 4LFCF 4H4KA 4DQIA 4ZP8A 1FDAA 2A2DA 1JLFA 4DG1B 1S1UA 3HHKA 4H4MB 3PFOA 3POTA 4M5GA 1KQSR 3UNGC 2R9LA 1JMTA 1QE1B 5IOLA 2E1RA 5CH7B 2HMIA 1R0CB 1Y10A 3WDOA 1RQ0A 4IQXA 3G2XA 1SJRA 2UVVA 1TVRB 1LXNA 3UPFA 1T9YA 4DV3J 1DARA 4B3OB 1VQ5S 3ZTQA 1EETB 2OMOA 4H4OA 4USTA 2IYIA 3THTA 2CZVC 3W2VA 3CWJA 3ILOA 4DX6A 5KFXA 4DEZA 3QLHB 5C24A 2CJBA 3QZ7A 3DDKA 1G1XA 5K8NA 1HKAA 1HNVA 4LF2A 4R0JA 1WF1A 2QLXA 2E7VA 1D9DA 1Q79A 4QYZJ 4I6WA 3ZC4A 1X5PA 1S6UA 3KHLA 1RLCL 1K0VA 3DNCA 2WSCC 4QW8A 4IO9Q 2BQUA 4DUYF 4I64A 1LOUA 3PR5B 4DS4A 1Q78A 3HFZB 2ZH5A 4KGXB 4WK1A 4CLSA 4XPEA 4B9SA 1Q4RA 3CJKA 1TFYA 3QJJA 1NK7A 1DY3A 1M5HA 4MT1A 2JDJA 3H0PA 6FD1A 2J9DA 3KKFA 4ELVA 2HVIA 4Q8EA 2IM3A 4R5PB 2N7YA 4MIAA 3UN3A 2BANB 2F9JA 3MMAA 4X4RA 2VONA 3GONA 1RHRB 3HK2A 3R7NB 4J9VA 1QJHA 4YR3A 1LWCB 4ICLA 1U0SA 2H9ZA 4OZ5A 5EN1A 1RT3B 3F56A 4F04B 2CJAA 3IGVA 3Q8VA 2VPWB 1RAGB 1PG5B 4F25A 4LR9A 3QRPA 3KUEA 2DEJA 1YDLA 3B6BA 1A0OB 4CT8A 4FNHA 1RT6B 2AZ1A 1LW0B 2DPIA 3W2WB 2YWEA 2G13A 4J9KA 5CA5A 4PXBA 4FVMA 1U49A 1YRTA 4QPTA 4FYDA 1MU2A 3LQVA 4C3MA 4WFYA 3PTWA 4KGMA 4DR1F 4FS1A 1QY7A 1IWAA 4AE5A 4J90A 4ZHRB 1UVLA 1DLOA 4WFXA 2CJQA 2HFZA 3OL6A 4FYVB 2V4RA 2IYGA 1HNZF 5ETLA 2V67A 3VQSA 3PDNA 1JLCB 1I3OB 2L41A 2B9XA 1IKVA 8AT1B 2G2ZA 4QR0A 3G4SS 2APOA 4F0MA 1GMUA 1WC6A 3NGSA 4ECUA 1XMQJ 2FJVA 3GFYA 1UL3A 4OLOA 3EGNA 1NUEA 4EYHB 1W26A 1LV5A 4QQBA 2OPSB 3KLFA 5C5JA 2Q6BA 1GQEA 2FLOA 2FVRA 2MGZB 2C2MB 2PA8D 3R2CJ 1ZYQA 4LBIA 4LR8A 3ZZYA 3KLVA 3KJNB 3CCES 3VAJA 4KPCA 4HHJA 2XMKA 1FCAA 4NEZA 1KBRA 3CC4S 1VQSA 2KU7A 2PEBA 4ES1A 3PIOQ 2F8HA 1N34J 4QR2A 2BE2A 3FRYA 1VCTA 4OQJA 5IC4B 1X4CA 3NMRA 5KFEA 2Z56B 4DSJA 1RWVB 2W2OP 2ZBQA 3Q8PB 1N6QB 2XQCA 3I5BA 4QPXA 2E1PA 1XTZA 2FGOA 2BACA 4IUFA 3ELHA 3FQLA 4HEA9 3IWNC 5I3QA 3KHRA 4BC7A 1N33F 2E7XA 2R7UA 1PILA 3MR5A 1TQLA 3GB0A 3EDRB 4Q2MA 2W7OA 3L7OA 1I6JA 1VI7A 5DLFA 1CJKB 1UWBA 1HQUA 1RZMA 1RTDB 4ANEA 1EKSA 4J9OA 3MR2A 3QPIA 2WSFC 2IMOA 1HR0J 1OJ4A 3PFEA 1IWGA 1YI2S 4FKYA 5IT9Y 5AXLA 1OYDA 3LP1A 9ATCB 4F36A 3MXHP 1F6TA 2EKNA 2ZHAA 2B43A 3CSKA 3CGIA 2Y1RI 2J7WA 2E44A 2H54B 2YWHA 4CRJA 3KLHB 2CQBA 3BSCA 3F44A 1KOOA 3TX0A 4IFYB 4YS2A 4M5MA 4PQUA 2A6OA 2UXDF 2G2YA 2HGMA 4JV5J 1V5IB 3ET6A 2J9DE 1N5TA 3KHHA 3HDSA 1F5CA 1MNEA 3RAQA 4RLEA 1ZTWA 2IBOA 1UEUA 1R3NA 2AD9A 2DH8A 2GJ2A 2WONB 4RL1A 4ILRA 2KRBA 2XSFA 1MG7A 4ED3A 2WVCA 2HAFA 1UP1A 5KFNA 2HIQA 2MHNA 4M5NA 4ID5B 4RNNA 4UZCA 1GT8A 2L9WA 2C3UA 3WX8A 2ZFHA 4R8UA 3J80U 2ZH2A 4B9NA 3PX0A 2A2CA 3TNVA 1JNRB 5E3AA 4MMOA 1FK9A 2IVYA 1DTTB 2GVDB 3PCOB 4DMZA 1VQ7S 5ETMA 1NDLA 4LQ3A 4K5RA 5HI7A 2BMBA 2R4FA 2MLXA 4OJ1A 2OELA 5J2MA 3SSRA 3LGMA 1Q82T 3MAAA 2LMIA 1R0BG 3GFXA 2HS4A 2WAQD 2IA6A 1U6FA 1YHQS 4LRCA 3OXGA 2WW8A 4O3QA 1Y5LB 1SQGA 2F8EX 4F26A 1RA7A 2JL9A 2VG7A 2W9CA 3H2LA 2BJ9A 1QAXA 1FXLA 5GAGU 2ZE2A 3EWGA 3JSMB 3IRWP 3WBZA 2DHAA 1PC5A 1RXOB 3N0VA 2B56A 1ZAWA 4UUWA 7FDRA 4DV6J 1VQ4S 4LF9J 3V6KA 2KFNA 3WIVA 3LO3A 3VGUA 4YR0A 4C3KA 3U27A 4QU6A 5F3TA 1VRUB 1OPZA 4F67A 4DSEA 2PC6A 2CQ2A 2GIQA 1IN0A 2WB4A 3HPOA 5A0YB 2CQ1A 2XWXA 1OSCA 2WVFA 4TU7A 1VQOS 4OHVA 3AD7C 3CJ5A 1F0XA 3DFEA 3B4DA 3D6MB 1WWHA 5AJ3J 1KQFB 3OD2A 5F8JA 5FJ4A 2X1BA 4F50A 1AT1B 1N56A 4MYUA 4DL4A 2OPQB 1A6LA 3G82A 2ROPA 3MZIA 1BQMB 3BBBA 1VQ6S 1CULA 2XULA 1XR6A 5DGBA 2YTCA 4KV8B 4FKXA 4V1Ak 3D68A 2CG4A 1RAEB 1LK5A 3CIMA 3OHBA 1NJYA 4MK8A 2O5DA 3MCOA 2LDYA 3MM5A 3L3CA 1KVKA 2HQGA 1H7WA 4J5OA 4GC7A 5A8RA 4JI4J 2YNFB 1RT4B 3QO9A 2J0XA 2YY3A 3DLJA 4KH1B 2J7KA 2KB2A 5D0GA 4IG0B 3SEOA 2ZC4A 4TKTA 3MFIA 1N32J 4G1PA 1KLNA 2RVJA 3E3XA 2V4JB 1SL2A 2XY7A 2BRKA 4NMLA 2MKHA 4DR7J 1WELA 4PUOB 2CKWA 4WZQA 2G2OA 1PO6A 1IBKF 1TK5A 1J5OB 4J9PA 1I94F 4NL5A 1NK9A 3RUBL 1G6BA 3OR1B 2E5LF 4FF4A 4ZITA 2ZC3A 4UZBA 4PWWA 4N8OA 1R27B 4ECSA 2FVCA 1WEXA 3MEEA 2DR6A 4WFBQ 1VC5A 1TL7A 2RQKA 2DCUB 2C22A 2E5IA 1FA0A 3ZZPA 1CJUB 4ZPTR 1RWMB 3QGPA 3VR1A 2CDQA 1N4LA 2L9NA 3IS9A 6FDRA 5I3UA 1T3OA 4YOEA 4I68A 5CAAA 2ILZA 1IBMF 2XY5A 1JNZB 2FVQA 2RJZA 4Y6IA 2R7SA 4JYAF 3LALA 1RT1B 3KDOA 1VC6A 3HD2A 1LFWA 2VH7A 1QDUB 1V3ZA 3AA9A 5EDWA 1EHWA 2UXBF 2C2KB 1FJGJ 2XG8A 4P10A 4CH7A 3MUTP 4JV1A 2DGVA 3PR4A 1KQGB 4K4VA 3NCPA 2AYBA 1FT8A 3EVWA 2GO9A 4QBUA 3LAKA 4K5SA 2CQ4A 3UN2A 5KFTA 4LF4F 3IXQA 3RBZA 5ADZA 1IXKA 3QIPB 4X65F 2AKWB 3CUNA 3DGVA 3RR7A 5KFGA 3O3LA 3TVYA 4ES2A 5J1EA 1UJ4A 5KG0A 4KKOA 1RTJA 3DLHA 1NZAA 2PD1A 1U1LA 1CJVA 4K4TA 1H2VZ 3CEDA 1JWWA 3IG1A 4CI0B 3CMQA 4QR1A 3DRPA 3OQ2A 4FP9A 2M9KA 2MLYA 1KLMA 5DDOC 1L3VA 3M6WA 2HHSA 3GV5B 1UVNA 2Z2LA 1RB0A 1Q86T 4WIQA 2YNIA 4MFBB 3RBEA 3SSQA 5ETOA 4DR4F 3JXOA 1JXLA 1HD0A 1PJ7A 5F9LA 1JK9B 3P8BB 2YKMB 2FJBB 1EX8A 1ZETA 4U96A 5A6PA 4UY8T 2N4DA 3HF5A 2ABYA 1IM6A 2WOMA 4ZJQA 2U1AA 3G86A 2AT1B 2E1AA 4AL7A 2DHHA 3CD0A 2Z4PA 1SJ3P 1XWLA 4YMEA 2V8VA 1UWAA 3JB9k 2FD2A 5GAGI 3CULA 4D3GA 4ZP7A 2RQMA 3UD3P 2WVEA 4Q43A 4DL6A 5SUHA 3MF5A 4HACB 1S7HA 3R8YA 5F0UA 4DPWA 1YZ7A 2G9OA 3UWTA 2E5JA 2KM8C 1N5SA 1MLAA 5DO2A 1U48A 1BMQB 4PG4A 4F3MA 4XK8C 5LXYA 2YNHB 2ZBIA 3PX6A 4DCOB 4K2JA 3CCLS 4ZLLA 5BYQA 2QLFB 2Y0SD 3TJAA 4WU2A 3ZZ0A 2OPPB 1SV5B 4F0KA 1E6YB 2Z2YB 3SI8A 3GG1A 2DXDA 3T1YF 1HI0P 4JB8B 5B0DA 4C8KA 1WHYA 3OL9A 2PIIA 1SC1B 3S6EA 3NCRA 4DL2A 1MWZA 3Q22A 4KHRA 4I6AA 4N5SA 4HDHA 2QL7B 4ZVPB 1WG5A 2DGXA 1S9FA 2RRNA 2H1YA 4OV1A 4BC9A 1T05A 1ZAXA 2RU9A 5J1NA 2DH9A 1S1VA 2GHVC 2ASLA 4WPAA 4GKKJ 4WFNQ 1NDKA 1VQ8S 1NB2A 4UOFA 2XHWA 2Z58B 5HANA 2KZMA 3QGGA 2KRRA 3D6FB 3O1LA 3R5BA 5EWFA 3L95X 1Q8BA 4DUZF 3Q24A 4OJHA 1KWMA 1Q81T 1S6PB 5AT1B 2FLLA 1VQKS 1ZS6A 2M8HA 1U1RA 2DY1A 2K7JA 3RAMA 1NMEB 3BEGB 3H40A 5J2NA 2QLWA 2IC3A 2OAUA 1WTFA 4JI2J 3SXLA 2CDRB 3SBMA 4X4UA 1ZTTA 4ZPDA 1NDPA 4OYMA 1VHFA 4KE5A 1NRKA 5ITHA 3WHIA 1W2IA 3Q23A 4B3SJ 2V2VA 1NEEA 3ENQA 1DQAA 1FO1A 5A8WB 1RADB 4PRFA 2CIMA 3AFGA 1UTAA 2PO4A 3HHLA 1QTMA 2ZEJA 3X1LB 3QFWA 3Q8QB 1N88A 3DOKB 1HBOA 2B9YA 4DLEA 2AGOA 2ZD1B 2MKJA 2J6SA 4L6V3 4OX9F 2B6AA 1M90T 2NS1B 1VK3A 3FVYA 1H72C 2XS7A 1ACMB 2VKRA 2L3MA 5L1IA 3H20A 4JUZA 4IYQA 4OYWA 4DXLA 1R0AA 2J0SD 3AXMA 4OI3A 2HBRB 2GVZB 3CDEA 2RF2A 3LWMA 5CHCB 1HHTP 4HHUA 5JUMA 4TYAA 4C8LA 1F60B 1RTHB 1ROFA 3QT8A 2R42A 1RHMB 1LQ9A 5LSRA 3JQKA 4ILLA 4I7FB 3MPVA 4OYOA 2DXEA 5GAEU 1H2UX 3BGRA 2GIFA 2IJRA 2C2DA 5LMNF 4JI1J 4LBHA 4DR5F 4WXOA 3CT9A 1OS5A 1PYSB 3DRSB 3C6TA 3T1AA 5JVHQ 3QYYA 1F5BA 3MM8B 3PRDA 3CJSA 3K58A 4LSNA 3NS6A 2QYCA 5LL6d 3DRRB 3TX8A 4UW2A 5B0CA 4RW8A 1C4CA 4YEAA 3ILIA 1FDBA 1SQFA 1TK0A 3VTIA 3HT3A 2QZ8A 4WP9A 4EZ6A 4X62J 1RK8A 3UR0A 2HWIA 1NPPA 1TKTA 1WKKA 4DFKA 2PGCA 4DV3F 2V34A 4AXIA 2M8DB 1HWLA 2MTLA 2BJ7A 3TQ1A 2LFVA 4OHZA 3R9LA 2W9AA 2UUAJ 3TUJC 2CA9A 5DG8A 3W7BA 1SC3B 2V8HA 3TVKA 2UUBJ 2AMCB 3DU5A 3MMJA 2R8IA 1IR2A 2G4BA 3GJSB 4A8WA 2AJ0A 2HHHJ 2HNDB 1SCJB 3D28A 3T5LA 3W9JA 3OV7A 4ID8A 1WOPA 2KN4A 1RE1B 3IFEA 2ZHBA 1HYSB 4WKYA 4J9RA 2OHDA 4KGZB 4YDDB 1B7FA 4YB7A 1S9EB 4P72A 2PA3A 3PKMA 2IVMA 3Q2SC 3OVAA 1BC6A 5DQHA 3DN9A 1FWPA 3P5TL 2Y0BB 2JRSA 7AT1B 2VUGA 1X0FA 1VIXA 1QSLA 3A3OB 1R6VA 2I0XA 2MJUA 5EGYA 3F0NA 2VHGA 1IUJA 2QSWA 4GC6A 2PFDA 1OWXA 3GYNA 5KFSA 3LA0A 4XDDA 4P75A 5JVGQ 1GK8A 3VWSA 4TY8A 3MEKA 2VV5A 2QTWA 1PIEA 2CPYA 5DG7A 2CPJA 1KHWA 1G2EA 1JLAA 3W5ZA 1REVB 4ILMA 3BSAA 5K20B 3TA0A 2QSFA 4Q8FA 2DT9A 2EWHA 4ZP6A 5H9EJ 5J2QB 1URNA 1S6OA 2GMLA 1WORA 3BPDA 2EI5A 5HP1B 3TA2A 2DXFA 1U26A 3GSIA 1OQ6A 3GFHA 3CC7S 1RT2B 1HBNA 5KFPA 2VC0A 1T03A 5T14A 2YXLA 2BJ8A 2CZ9A 4EK2A 3CJ8A 1V6HA 4A8YA 1HHSA 3FCHA 3UCGA 2RD5C 4NA2A 2B0GA 1XK8A 2HHWA 5LOQA 2XSJB 1KRPA 4K0KJ 2FHOB 1EIYB 3V6HA 3RTVA 2DY9A 6AT1B 4LSLB 4X64J 1Y7PA 1XMQF 4ELUA 5ETKA 4WKRA 3HKWA 1HWJA 2P5VA 4AUKA 3D2WA 2AEJA 1Q8IA 5BYRA 4C0BA 3C2PA 1YKWA 2KXFA 3GFZA 3HT0A 2FVPA 2BRLA 3BSNA 3W5XA 2HRTA 4DFMA 2R2SA 4IQMA 2HVHA 1RBOB 1S77D 1XEZA 2XLIA 2WRMA 4B17A 1NCLA 4OJGA 2B7BB 2K06A 4OZ3A 4QWEA 4IOBA 3GV7B 2HNZB 3QJPA 2B4PA 2OKQA 4ZP9A 2MZRA 1NHKL 2WHOA 9RUBA 2HZCA 3MPYA 5THWA 4ZVGA 1N34F 1SH0A 4KO0A 1YJNS 5A2QY 1T9UA 2HHPA 3GMGA 4K2XA 4DSFA 3HKZD 4ZK7M 2C2ZB 4QOTA 3QWPA 3NGRA 4CM0A 1F2GA 1AFIA 2J6UA 5KOWA 1T7PA 2NREA 4O0IA 4LF8J 4P2FA 2CJ9A 2W4DA 3HSZA 1L5UA 3LP2B 5GAEI 4OFZA 1NDCA 2GC8A 5D78A 2VFTA 2DRAA 4OI6A 2PE8A 5CCMA 1BQNB 4ELTA 1FRXA 4OV6A 1P9YA 5D0EA 1KR4A 1IJEB 3T1HJ 3BM7A 1FFGB 1RLDA 1HNIB 2FJEB 2JSXA 2ASDA 2EKYA 1HR0F 1MMDA 1F9EB 5MLCV 1YRXA 2M70A 1RA6A 1DFDA 3R6GB 1SJ1A 4OI2A 1S57A 1SVDA 1SL1A 4IFVA 4MIBA 3J81j 4WF9Q 2WCXA 1FRMA 2BW7A 3FCVA 3CD6S 4KPYA 4OX6A 2XWYA 1C1BA 3DOMB 4F4KA 4RNHA 3ZNUA 2JEIA 5B0FA 4JV5F 3EVMA 1U2CA 2CADA 4TU8A 4DCPB 4K4ZA 2CYYA 4EZ9A 4DV1J 4GVLA 3CIZA 4RU9A 4UQGA 3VHQA 4HH1A 2K8GA 5KFAA 2VQFJ 2ZDOA 4NLGA 1WUUA 3DI6B 4K59A 2X51A 2N7CA 1MROA 4UQTA 2LKZA 3VALA 3EMTA 1JLQB 4XO0A 3SCIE 2KM8B 2M5YA 2HBZB 4K4YA 5KFCA 5LM7E 4QWBA 2M52A 1KN6A 1TL3B 2DNRA 3FBBA 3OTDA 1TK8A 4BWMA 4HTIA 5AE1A 2BE7D 3E01A 3SCJE 1WD6A 3H42A 3FZBA 2BR0A 4NLOA 2C42A 2XHCA 2A18A 3NL0A 3VAFA 2JLEA 2JEFA 3DM2A 2KVQE 3C16A 3K8WA 2RHQB 3R27A 2GW8A 4RW9A 1D9FA 5C2CA 2R2UA 2R3VA 3KJVB 1OY8A 3ILJA 4NX9A 1TP7A 4ZVQB 3TZWA 4UT4A 1IKWB 4ED2A 3FUYA 3PM9A 2B4VA 2YKNA 2IVFB 3DMJA 3RGIA 4JI5J 2W2PP 2M88A 5KFDA 3AH6A 3MCMA 1P1TA 4HHHA 2C3PA 2XO7A 3BQ2A 2RDJA 1RJJA 2I8EA 4RWXA 1Q8KA 3QFHA 2N4CA 2VG6A 2CPEA 4PABA 1IBLJ 4I0WA 5KFJA 3M8PB 1S6QA 1EZZB 2HQFA 3RB4A 4DR6J 3BZQA 4XTTA 1R31A 4DWIA 1RUSA 2BKNA 2BJ3A 3AB4B 4CO4A 3AD8C 2VQEJ 1L3SA 2F4FA 3CCVS 1YTYA 3V81B 4LVOP 2XGPA 3JTOA 3DRXA 4DOZA 1WC4A 1GNKA 2ASJA 3NOGA 1VC0A 5B08A 4LF9F 4GKJJ 5KFZA 5CZXA 3HJFA 4B3MJ 1X4DA 3OR2A 2WZ1A 4H4MA 2ZITA 3KUGA 1XJWB 4I2QB 2AGQA 4RJVA 1QE1A 4CLZA 4KBIA 3CPWR 3C15B 1QLNA 2YKQA 3MUVP 3S01A 1NLKL 2DBBA 1U2RA 1TVRA 2V50A 2ZZTA 1GXLA 1TKXB 5ETPA 3J81U 1U6BA 4Z2XA 2PT0A 5AJ3F 3IM8A 4LT6A 2BV3A 3PYEA 1EETA 1U1OA 4HTJA 2HMIB 2DHXA 1NO8A 3QQCD 4UOHA 3AA8A 4K7QA 1S5ZA 4CLYA 4HVZA 1U45A 2FLPA 1S1TA 4ZVSB 1H74A 4O44A 4C97A 3H2VE 2DIUA 5KFRA 2AJFE 3WQPA 1ZAVA 2DPJA 1YZ6A 4H4OB 4S0MA 4JI4F 1N0UA 5IFMA 4ECQA 1Q0NA 4K4UA 4OIXA 3TANA 4KY3A 4NZ6A 3CCWA 1HD1A 2DNOA 2J6TA 1Y5NB 2KKHA 3T6BA 5HMZA 5GMEA 5K14A 4IDKA 1N32F 3OHAA 1Q8LA 1HNVB 4DR7F 3RB0A 1B3TA 3GV8B 3NNHA 1Q1KA 3NP5A 2ZOMA 5G0RA 3MDFA 2MZJA 1IKXB 4CP5A 4R5PA 3M2UA 2RS2A 3JYTB 2BANA 5C42B 2Y8YA 4P73A 1JJ2R 3BKFA 2MJNA 4NA1A 3M8SA 2N3OA 1LWCA 1YWXA 4GVBB 1RU1A 3MMCA 4G1QB 1RT3A 2RDDA 5KT7A 3TWZA 1T9TA 1XMBA 1V3RA 5B7WA 1ZBTA 4YN3B 3I82A 1DURA 3W2WA 4YB1P 3W60A 4U7CA 1Q5VA 3N79A 2I9SA 1DJ0A 5D15A 4ICLB 1G7CB 3FSXA 1FJGF 4ECTA 2HW3A 4U8VA 1X8DA 4ZHRA 3IWLA 2MQLA 3VVUA 1SPBP 3DCAA 3ZZZA 3ZZTA 3BR9A 2GQ2A 1JLCA 1MU2B 2AJ2A 2BM1A 2J5AA 2A6MA 2MLZA 1KVJA 1MSWD 2M2BA 1B7YB 2HNYA 1HPZB 4OYZA 3KG1A 1S48A 3UVJA 4KB7A 2W8KA 1DLOB 4YB5A 2KXHA 2OPSA 4KTQA 2KZZA 3C66A 3X3UA 1Q7LB 1WHWA 3H4DA 3HD1A 1TL4A 2MGZA 1YBTA 3GJQB 2OH2A 1FTCA 3D6HB 4DX5A 4C0OC 5D77A 3PV8A 5D3GA 2OTLS 2DO0A 3SFGA 2PMZD 2B8QA 2JEGA 3I55S 3M05A 4FF3A 2F5GA 3KLFB 3I31A 4Q44A 4L74A 3FJ2A 1KEKA 3CO0P 1RWPB 2IAJB 3B8HA 4WZMA 4A8SA 3QMQA 4YB6A 4JI8J 1KQKA 4Y2MA 2LQ9A 1RACB 1SIWB 4NCGB 4K4WA 4LFAJ 5BXIA 1N6QA 1E6VB 3R6LB 1N5VA 3ENWA 1TV6A 2FJDB 4LF5J 1YJ9S 3SQGA 3VAHA 3DHXA 4F8RA 2MB0B 1WEYA 1BLUA 3KK1B 4J9UE 3PVXA 2HFUA 1HBMA 1KKHA 1KVIA 1N36J 4ZPAA 4DL0C 1O0PA 2BUNA 4USVA 4C11A 3D7SB 4Z37A 2PFFB 5EX0A 1CJKA 1R6YA 5D4OA 1HNWJ 1SXLA 2IM2A 3ILLA 1RTDA 1AA1B 3HVTA 1REGX 3M32B 1KS2A 3MCNA 3E51A 2R2RA 2AIRB 1Q95G 2GJIA 3MD1A 5D0HA 5B0BA 1HNXJ 3HM9A 3VVTA 4KGVB 2XLJA 1CBKA 1UWBB 5E3CA 3KLHA 3DLKB 3FBFA 1R89A 3MOJB 1JB0C 3FBCA 2UZAA 2EFQA 2VICA 2DR9A 1A7GE 3IGNA 4YY3J 3HHLC 1YJRA 3NAIA 4E2FB 2YVSA 3MHYA 3ZTPA 4A8FA 3DYAA 2J9EA 3E2EA 1B0PA 2XZWA 1RISA 4DV4J 4CNZA 4WCEQ 1YITS 5L39A 4GKKF 3T6JA 4X4VA 4PQUB 3M2VA 4NLXA 2C3MA 3GR1A 2E1CA 4PR6A 4F3QA 5IQQA 3ET6B 3NGDA 3KYLA 1XR7A 4ID5A 4A46A 4NMXA 5SZTA 4L3NA 3UCZP 3UW1A 1JX4A 3C14B 3Q86A 1UVIA 3H7HB 2HVEA 2GVDA 4JI2F 2GIRA 3KFWX 3JAMY 4PWDA 3M8YA 4KYZA 1QAIA 4WXWA 4B3SF 4OI0A 3GSDA 4RNOA 2H5EA 4PEOA 4U7UD 1DRZA 3TQEA 5E3RA 2FJXA 4TN2A 3MI7X 1H98A 2R7XA 3QAEA 3HP6A 4YUDA 4O4GB 2MSTA 5DGAA 4X2BA 3D67A 1I5OB 2EVZA 4FBTA 1FFSB 2XMJA 3J7ZT 2F63A 3K8VA 3MAAB 1NSAA 3JSMA 2DR5A 3DLEB 4P71A 2GGPA 2IY5B 4F02A 3I0SA 1VJWA 2EFNA 1R8BA 5BR8J 1ICEB 3C3LA 1F3FA 3PACA 1PGZA 2W9CB 2J76E 3SFUA 2JOQA 1VRUA 2NXUA 4P2MA 3NRBA 1D1UA 4ZLJA 5A0YA 2MQ8A 2COLA 1JIHA 1J27A 2DHGA 4DV7J 1Q16B 1WHVA 2Q43A 4OZNA 1O6XA 4ENOA 2DR7A 2DYAA 4RW6B 3CMES 5ETTA 2HHXA 1YQHA 4JI1F 1CC8A 3UDVA 4QWDA 2UU9J 3PEJA 1D8YA 3V4MA 2RQ4A 2UXCJ 1SI9A 2Q79A 1FXDA 2JH3A 4FXVA 3PKYA 2EPIA 3ZTRA 3QSYB 3A3PB 2O66A 3AAWB 2DO4A 2XNRA 2DH7A 1PYTA 2BA9A 1S9GB 4IKAA 4C8NA 3ETOA 3L7UA 1GX5A 2XYGB 4MJKA 3MTJA 1GTHA 4RWWA 1C0TB 4KAIA 1FRJA 4O3PA 4X62F 1Q7YT 3AY0A 4ITSA 5L46A 4IH7A 2DNZA 1JLEA 2BJEA 3PY8A 1DBDA 2W25A 1FDNA 2ZM6J 3G82B 1CULB 3RRHA 2R7OA 3OUYA 1SJQA 2X1FA 3GIMA 3MM9A 3ISND 3OXFA 4IG0A 1H38A 2UUAF 3ZO7A 3NBPB 2V4JA 2JFKA 5LMUJ 1HQEA 2J0WA 1TELA 4N56A 4PUOA 2UUBF 1J5OA 2QT7A 5HMYA 1UFWA 2QL9B 4USWA 2W9BB 3OR1A 2OD6A 1BE4A 3MEDA 3NOCA 2HHHF 3RJMB 4QW9A 5J2PB 2DD8S 1S72S 3D1QA 1L3UA 1CJUA 3PHTA 1TZ0A 3SDEB 4RUAA 2ZJPQ 4M8LA 1A9NB 4DPTA 4DUTA 4MKAA 1JKHB 1XC9A 1NKBA 3I32A 2UUCJ 2MZQA 1AZSB 5F8MA 2B51A 4RU2A 3V4IA 3MR6A 1T9VA 1N54B 2RB7A 1TL7B 4M5JA 3VCDA 2BDPA 3OJSA 5CYJA 1RTIB 3THVA 1U4BA 4AFFA 3IM9A 2LCWA 3VAMA 1YJUA 5DDRC 3CCTA 1SL0A 4U8YA 5KG1A 3IS9B 5I3UB 2LXFA 3WC0A 5MAOA 2CNLB 2YKPA 4P2XA 2QO3A 5GADI 3R5AA 4AD6A 3FEZA 3N01A 2CNKB 2FB0A 4CDIA 5DZ6A 4NRTA 2C28A 1NHUA 1F9HA 2ZBRA 2V4QA 3QATA 3QIPA 3FMBA 1TL1B 3PW4A 2QLJB 1D09B 1AW0A 4ED5A 2AYEA 1GXTA 3EGZA 4WIIA 2VOPA 3HSJA 4YP3A 2BXJA 4J7CA 2IIHA 2IPOB 4OMFG 1OYEA 4JBCA 4A8KA 5L38A 4RUCA 2ZUAA 4N47A 1OMSA 2MQPA 4LUBA 1FJEB 2HHQA 5CYQA 2E1MC 5K8MA 3W65A 1QVGR 3BH6B 4RUBA 3D4JA 4K0KF 1RTJB 3ZNJ1 1FRIA 4X64F 3IG1B 2FYXA 4CLUA 3DRPB 3RB6A 1W7WA 2YKMA 1T94A 2Y1JA 1FWLA 3TAMB 1BUXA 4C98A 2FHJD 2LQ5A 5CYMA 5L9NA 2UVRA 3LH2S 1MWYA 3G8QA 1VIOA 3L4BC 3LGHA 2IMWP 3HZEA 3IC1A 1G3OA 3OVSA 3QNWB 5DQIA 5HAOA 3BSOA 1S0VA 4UF4A 3W66A 2HLTA 2WOMB 3HJVA 2OSRA 2G0IA 3CDWA 2ASYA 2NSBA 4UTGA 4X4SA 1QM9A 3SYZA 1CQMA 5DZ7A 2RQCA 3T41A 2FLNA 4W98A 1FKPB 2H3EB 2QX0A 3EGVA 2GMHA 4ZVRB 1NJXA 1X9SA 2MZTA 2ZJQQ 3H2UB 2BABA 4OYPA 3EVOA 3DDNA 4LF8F 3P5BP 3SV4A 2UVUA 2OPPA 1U0HA 1FKAF 2OIHA 3G6ES 5L1LA 2YKOA 2CNNB 5IWAJ 1K1QA 2DITA 1QD1A 1DQ8A 4ZPCA 3CD5A 1BD6A 2HSEB 3I5CA 1X4FA 5B0AA 2KJVA 3A8JA 2XC9A 4U67Q 4I67A 5HLFA 3KK3B 4L73A 2XMVA 3IO1A 3EM1A 4H54A 4DQRA 2R8HA 2WVDA 3GLJA 1FRHA 1VBXA 1RWOB 1NHVA 1Y0HA 2HS3A 3G87A 4OHYA 2R7WA 1RWWB 2RMLA 3LOUA 3TO8A 4DR2J 1K73T 1WI8A 4PYAA 2RE1A 2KG0A 3JQMA 2JLGA 2HHVA 2HS0A 4C2MA 1LEOA 1EB0A 3MEGA 2ACYA 1JXEA 5HVHA 1MW7A 1S1VB 1S6PA 3W1YC 4DV1F 3D1OA 2VQFF 4LRBA 4DCJB 2HVDA 2VIHA 4USIA 2YNGA 1VLYA 4B9VA 1MMLA 1X4HA 3QIDA 1FNOA 3RR8A 1SKRA 4PZVA 2FPHX 3BB5A 2CPIA 3OFFA 3HHEA 3CCRS 1GFWB 4DR3J 2FC8A 2IJFA 4CIOA 1HI8A 1RYSA 2L08A 5A8WA 4MKBA 2NQPA 4P74A 5J2NB 5KFQA 2YH0A 2NXCA 2P6SA 2X7IA 2V69A 2E29A 3DLGB 4L3KA 3M9MB 2ZD1A 2D3O1 2RKIB 3OL7A 4ECYA 5H9EK 2IRXA 3A13A 4ZPWR 2QG9B 2LP4A 2ZBPA 4RUHA 2IRUA 3UD4P 3TW0A 1N48A 5HMXA 1NK4A 4PG5A 1FTRA 4RW7B 1O8BA 3Q8RB 3IBCB 2AEMA 2VODA 2UV8G 5A8KA 1N0VC 3HHLB 1KTVA 1EP4A 1ULRA 1IR0A 4JI5F 1HQ2A 3D54A 2OLWA 2ZH7A 2EFVA 4ZOSA 1S12A 1UVKA 1O51A 3WC2A 4ZDNA 4QCLA 5T41A 1Z1ZA 1CSJA 4ECRA 2GVZA 4J9QA 1F2HA 2B6AB 2ZKTA 2KDOA 2IM1A 4X4TA 4LREA 4B9UA 4OX7A 4PPZA 2LQJA 3M2RA 5HQMA 1IBLF 2I6WA 1RBLA 2CQPA 5CD4A 2GHPA 4DR6F 3A8KA 1KD1T 3FFIA 3ZFVA 4I7FA 1WOOA 3UR3C 1R0AB 3N6NA 3HSDA 3VAIA 2VQEF 1XNRJ 2GA7A 2H4YB 5DG9A 2LEPA 2HG4A 1YG0A 3BN7A 3MMBB 4GKJF 3EYZA 2H5JB 3MM8A 2DNQA 4Q0BA 4G65A 4B3MF 4CH0S 4ZN1A 4X4PA 2QFIA 4AL5A 4HT5A 3JSYA 2Y1IA 4WFZA 3BGRB 2VZ9A 5C2GA 1J5EJ 2MSSA 4W90B 2HHTA 5F41A 5HN0A 1U25A 1WSVA 3C6TB 1YBUA 5KFYA 4LSNB 5FIIA 2B9WA 4Y2IA 2WTFA 3LGNA 2E9ZA 4RW8B 5I4MA 1ZM9A 2V94A 2PDAA 5D0RA 4MYTA 4HI1A 3M9NB 2LEBA 2VFVA 4DV2J 1AXQA 5E7OB 2CQ3A 2Z57B 3BGLA 4O3SA 4DL5A 1M5SA 3K5MA 5A6WA 4Y3CA 1FDDA 3J80Y 1UW4A 2VFRA 3TUIC 4HL9A 3AJ1A 1YJWS 3TEHB 4EGLA 3LANA 4C8OA 4OZ2A 3RW7A 2O67A 3HCXA 3V6DB 4I2PA 3RAXA 4ZMMA 3AOCA 1RAOA 2JJ4D 1HYSA 3R5GA 1UVJA 3H59A 4UY85 2VU5A 2HPUA 4J9MA 1VQ9S 2JX2A 2FJAB 1S9EA 3UNYA 4RZRA 3EUNA 3RYLA 2OSQA 1IKYB 4PAAA 3UQSA 3TRGA 1VLOA 2E5HA 1KNZA 4LRAA 4E98A 3KG4A 3GJTB 3M8QB 1BWEA 1C4AA 3K5NA 1UJ6A 3U02A 2J7UA 4ECWA 1UJ5A 3TP2A 3T5JA 2HFVA 4QIEA 1KFSA 3C6UB 3N28A 1RAAB 5KT2A 4U6PA 1SH2A 4DPXA 2DIVA 4CLKA 1Y3JA 1REVA 2GS8A 1WOSA 1RU2A 2OEJA 1EQMA 3BQ1A 1DTQA 5HROB 2F3JA 1WF0A 3MD3A 4Y28C 1XNQJ 3AB2B 4F2SA 2UUWA 5KAKA 2LECA 3TR5A 3PW5A 2BJDA 1AB8A 1YRUA 4KH0B 3PW0A 2WK4A 1QUVA 1R8HA 1RWKB 3HHDA
chains in the Genus database with same CATH topology
3H90A 2QFIA 3W8GA 3W63A 3W5XA 3W62A 3W64A 3W60A 3W65A 3BYPA 3W8PA 3W5YA 3W61A 3W66A 2ZZTA 5HSPA 3BYRA 3W5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H90 A;  2QFI A;  3W8G A;  3W63 A;  3W5X A;  3W62 A;  3W64 A;  3W60 A;  3W65 A;  3BYP A;  3W8P A;  3W5Y A;  3W61 A;  3W66 A;  2ZZT A;  5HSP A;  3BYR A;  3W5Z A; 
#chains in the Genus database with same CATH topology
 3IR5 B;  1K1S A;  1X7V A;  5KFU A;  2FY1 A;  1UET A;  3MAH A;  3ITH A;  1GMW A;  4R25 A;  3H8Y A;  3I56 S;  3M6U A;  1GXU A;  2NZC A;  2XSJ A;  1I1G A;  4NZ7 A;  4D3H A;  4NXN J;  1S49 A;  2FJW A;  3AHP A;  1HBN B;  3G6V A;  4LSL A;  2HK2 A;  4DX7 A;  1TUW A;  3UDL A;  3KNG A;  4NI2 B;  4FYX B;  4P7T A;  4URQ U;  3VAG A;  2AJ4 A;  2QLB B;  3DLL Q;  2DVI A;  2ZZM A;  1P6T A;  1U2F A;  1LWF B;  1CLF A;  2HRU A;  3ZZR A;  1FX2 A;  4ZVF A;  4ZS6 A;  1IQT A;  3UO0 A;  1BQX A;  3NAH A;  1RT5 B;  1FRL A;  1RKJ A;  2QGF B;  1HW9 A;  2OEM A;  4I6Y A;  5CD4 H;  3KMS A;  3MR7 A;  5HO4 A;  2RU3 A;  3DHW C;  1KFD A;  3FNN A;  2HNZ A;  4L75 A;  2RIJ A;  3CNQ P;  2CPD A;  4F4Y A;  4KJI A;  4JI8 F;  3V5R A;  3JTP A;  1H7X A;  2HZV A;  4ECV A;  4LFA F;  2OD4 A;  4FYW B;  2Q1L A;  2B5J A;  3K57 A;  5KFI A;  4LF5 F;  2IHR 1;  1CC7 A;  1VOM A;  1ZM4 A;  3TZX A;  3IRX A;  3PG9 A;  5KFF A;  5E33 A;  3PJX A;  4M63 A;  2MYF A;  4KO0 B;  3LP2 A;  4QIW D;  4DSI A;  2B4O A;  1N36 F;  2NSC A;  3AQP A;  2RUS A;  2D9P A;  3TI0 A;  3GQC A;  1PBA A;  1UFL A;  2JWN A;  3SIP B;  2G0C A;  1SBR A;  1HNW F;  4BLG A;  3GIJ A;  4KFB A;  4TQR A;  2YH1 A;  1VRQ C;  2FY8 A;  3HVR A;  1CPZ A;  2QMX A;  3JQJ A;  2VBX A;  3QRR A;  2K7K A;  2MMY A;  3O44 A;  2AF6 A;  3IMQ J;  1HNX F;  2AHO B;  4ZVE A;  1HLW A;  1YLX A;  4DV5 J;  2ZH4 A;  4KIA A;  2KYZ A;  4PG6 A;  4NLQ A;  4RPF A;  2LEA A;  3CJ4 A;  3OXL A;  1LKZ A;  4Y34 A;  3KXD A;  2CWK A;  3BBF A;  4YY3 F;  1KHV A;  1S76 D;  1VR6 A;  1S1X B;  1BGX T;  1FFW B;  2FZG B;  2CQD A;  3FK4 A;  2EXU A;  3EZ5 A;  4DV4 F;  1RAB B;  2YWK A;  4EYI B;  5A76 A;  4TLR A;  1C1B B;  1LW2 A;  1JLQ A;  4YDX A;  5AXM A;  5DLG A;  3D66 A;  2CVE A;  1XIQ A;  2I5J B;  1TL3 A;  2Y1L B;  3K17 A;  1VBY A;  4NLS A;  1NSP A;  4KQZ A;  2JFD A;  4FXD A;  2VJU A;  3T5H A;  3HUL A;  4Y2K A;  2X1A A;  2FTR A;  4DFP A;  3M7V A;  1NBE B;  1PBU A;  2DGQ A;  1VDH A;  5IS2 A;  3CCM S;  2EBE A;  1S59 A;  2JVO A;  4CTA A;  4WE1 A;  1RSC A;  5U47 A;  4MKY A;  3AD9 C;  4QZV B;  1M1H A;  2R8G A;  1N52 B;  2ZHO A;  2H4W B;  3WX4 A;  4HYK A;  2HQ3 A;  4G1I A;  2MKS A;  1X9M A;  3KJV A;  3NS7 B;  2BOA A;  1WC5 A;  1SKW A;  3GYG A;  4DU8 A;  4CO0 A;  3DM2 B;  4GMK A;  3C16 B;  3M4X A;  2ZWP A;  2POK A;  4W4M A;  3BF4 A;  2PMH A;  1FX4 A;  2E7W A;  3PW2 A;  2XI3 A;  2H65 B;  1JJ4 A;  1MN9 A;  1RHQ B;  3JTN A;  4IH5 A;  3K89 A;  1W25 A;  5C25 A;  3QT6 A;  4C8Y A;  3M8P A;  4PQA A;  2F4V J;  3DMJ B;  3Q0A A;  3IR7 B;  2QA4 S;  2XCA A;  5F9N A;  2HGN A;  1C1C A;  1HMV B;  3DOL A;  3GG0 A;  5E3P A;  5B0E A;  5BR8 F;  3BO3 A;  3BBC A;  3OBI A;  1B4S A;  1D3W A;  4EUV A;  4NE9 C;  4BWJ A;  1VIS A;  3VF0 B;  4RW4 B;  2GQC A;  2OI2 A;  3GIR A;  2FZC B;  2B3T B;  1T3N A;  1C2P A;  3C15 A;  3U1N A;  2KI2 A;  1U6Z A;  3GPA A;  4DV7 F;  2ZH6 A;  3AOB A;  2ZZN A;  3KJQ B;  5D4P A;  2OJ3 A;  4A4J A;  1TKX A;  5KOX A;  3KLE B;  3EXY A;  3OR2 B;  1FXR A;  1LWE B;  2UU9 F;  5T7L B;  3GWC A;  2UXC F;  2XMT A;  3C8Y A;  5HAT A;  4ER8 A;  1C0U A;  2VF3 A;  5H1S V;  1FKO B;  4J37 A;  2FZK B;  5RUB A;  4Y2A A;  3BKT A;  1PJ6 A;  4DSK A;  1RT7 B;  3TVZ A;  1PAU B;  2ZM6 F;  2PSZ A;  2DNM A;  1S1W A;  3LPE A;  3CCS S;  3OSN A;  1WHX A;  2HUR A;  2GV1 A;  1S1T B;  2CQC A;  3EGW B;  3BDP A;  3LP0 B;  4O44 B;  3A3N B;  4EMD A;  3S8S A;  2F1F A;  5LMU F;  2NYI A;  2DB1 A;  4H4K C;  4O4R A;  2ZNY A;  2LU1 A;  2DNL A;  4LSZ B;  4JP8 A;  1HW8 A;  4B08 A;  2PMW A;  2VPZ B;  3OJU A;  4DDF A;  1IKX A;  1GMW D;  3K5L A;  4WWS A;  5K14 B;  4IDK B;  4ZCK A;  3JYT A;  5C42 A;  4EFA C;  5HBM A;  1HHQ A;  2GCF A;  1ZZN A;  4PCQ A;  3HFV A;  3ZXW A;  2CQH A;  3I87 A;  3GII A;  5L1K A;  1D8Z A;  1AFJ A;  4GVB A;  2DIS A;  4B3T J;  4G1Q A;  2NXN A;  2HFS A;  5G0R B;  3ZZU A;  2E9T A;  4IRK A;  2UUC F;  2P8I A;  1B0V A;  4M5D A;  2XMU A;  3M2U B;  1LFP A;  2Q66 A;  3KWM A;  4W92 B;  4CYU A;  3K7R A;  3Q2T C;  1TKZ A;  1QUP A;  2VA2 A;  2FIU A;  2W1B A;  3I5A A;  3I4P A;  2MXY A;  4DN9 A;  2CVI A;  4LVN P;  3MMC B;  2EC2 A;  3TAQ A;  3BQ0 A;  2C3Y A;  1PJ5 A;  3KLI A;  3CCQ S;  3Q8Y A;  4MIW A;  4PXE A;  3QBC A;  2V2K A;  2ZH1 A;  3AJ2 A;  1UFK A;  4KHM A;  3PHE A;  2MZ1 A;  4F4Z A;  3UE2 A;  1SC4 B;  3O6Q A;  5D4L A;  4HDG A;  3TZZ A;  5HJX A;  4ETZ A;  1HPZ A;  2BX6 A;  4OHX A;  3DC2 A;  3P45 B;  3PNI A;  3RRG A;  1XR5 A;  4M95 A;  2MKC A;  3G9C A;  2VPX B;  3N4W A;  4WK3 A;  3M1V B;  2X1G A;  2YQ1 A;  2HWT A;  4M94 A;  2L9D A;  3HI9 A;  4LF6 J;  2LLZ A;  4NPO A;  2HNY B;  4OYA A;  1B0T A;  1NM2 A;  3QGH A;  3T9N A;  1SKS A;  3EDQ B;  3UVJ B;  4DS5 A;  2RT3 A;  1NK0 A;  2OO4 A;  4C9D A;  1NSK L;  4F0H A;  1K8A T;  3CVK A;  3Q8S B;  1KSP A;  3RBX A;  2NUH A;  2VFU A;  3OTC A;  5KG2 A;  5HQ8 A;  2YX7 A;  2IAJ A;  4RX6 A;  4N76 A;  2V8D A;  4NLU A;  4NCG A;  2G1H A;  1MN7 A;  3HXM A;  2DK2 A;  3BS9 A;  5KFO A;  1JLG B;  4CLL A;  1Y4Z B;  5D3G B;  4USK A;  1S4E A;  1FF2 A;  3TUZ C;  5IT4 A;  1E6V A;  5KTQ A;  3M30 B;  1U8W A;  2LYV A;  2DR8 A;  4OL8 A;  5EUH A;  3G6X A;  1NH8 A;  1UVM A;  1NND A;  3CW2 C;  4PYD A;  3KK1 A;  2LXU A;  1WG1 A;  3Q83 A;  2D69 A;  2QYG A;  1TAQ A;  3Q8U A;  2CWX A;  2M3D A;  1PCA A;  3M6X A;  3M8Z A;  4FPI A;  1B64 A;  1JLB B;  3RB3 A;  1VBK A;  1TV6 B;  4JV0 A;  3SQG B;  2N3L A;  3KLG B;  2L48 A;  2E5G A;  2WW4 A;  3M32 A;  2VBZ A;  4EO8 A;  1HWK A;  1HBM B;  2DHS A;  4LBP A;  3BYP A;  4V19 J;  1VS3 A;  2HHU A;  4C11 B;  5IWA F;  3U1M A;  3KG0 A;  2FC9 A;  3DLK A;  3OFE A;  1QSS A;  1T9W A;  1N5Q A;  4HLB A;  1UEK A;  2F40 A;  3HVT B;  2AEF A;  4DBQ A;  5IT9 U;  2WBM A;  5IT0 A;  3AOD A;  2YQ0 A;  3CJR A;  2IRY A;  3FGV A;  4MTP A;  1H3D A;  3MTK A;  2QA4 G;  3UDC A;  3CCU S;  3P49 B;  3AJD A;  1AYE A;  3MM7 A;  4ZJO A;  2V9W A;  3R5J B;  4L76 A;  2DNG A;  1U24 A;  1HBU A;  4DN0 A;  1HA1 A;  2R2T A;  2KH9 A;  3J7Y U;  4DR2 F;  2OPR A;  3OL8 A;  1ZOT A;  2CUY A;  3AXK A;  1FE0 A;  4OHW A;  2I1R A;  3DYA B;  1FNX H;  2MQM A;  3DRY A;  2IJN A;  2C2R A;  4FXW A;  2XYH B;  3HSG A;  3ICL A;  1UEV A;  1X5T A;  3FEX B;  3M2V B;  2OGU A;  3QAU A;  3GU0 A;  3C14 A;  4ED8 A;  4DF4 A;  5G4D A;  1BWV A;  1NB7 A;  2KHD A;  1RAF B;  2CG8 A;  1ZA1 B;  1CG2 A;  1ZM3 A;  3R1L A;  3M6V A;  4K50 A;  5HVF A;  3OW2 R;  2MQO A;  2CPF A;  3K2Y A;  2LU2 A;  8RUC A;  4CO3 A;  4DR3 F;  1VJQ A;  3MUM P;  2ZJR Q;  2HBQ B;  1OY6 A;  5KFL A;  2YX4 A;  4FPR A;  4O4G A;  3EIC A;  1DHM A;  4NEY A;  1EAY C;  2WSE C;  2HFO A;  1QAJ A;  5KFV A;  4PWD B;  4DI6 A;  1H6K X;  3I9Z A;  4DV0 J;  4EBE A;  4P2S A;  5KFM A;  4E0D A;  3CB4 A;  4NZ0 A;  5E3Q A;  2DGW A;  3OVB A;  3SQO P;  1SJ4 P;  3B54 A;  1B70 B;  3DLE A;  4U95 A;  4AXJ A;  2VDI A;  2ADC A;  1NU4 A;  2HZA A;  4G3I A;  4C4W A;  2ALZ A;  4OI4 A;  4ZA1 A;  3JSB A;  4DQQ A;  1FVQ A;  1FER A;  3FQK A;  5CCL A;  1KDN A;  2CQI A;  2VL1 A;  2W4C A;  4B9M A;  1WC0 A;  4WU3 A;  3EJM A;  2C3O A;  1QSY A;  4QIF A;  2GGP B;  3I0S B;  1WDT A;  1F5A A;  1HAR A;  2RIL A;  1T0T V;  1H0H B;  1VRT B;  4RW6 A;  4RNM A;  3PIP Q;  2J9C A;  3I0R B;  1XNR F;  1H2T Z;  3DU6 A;  3D0H E;  1HWI A;  2ALY B;  2D3Z A;  3DKD A;  4LF7 J;  5I42 A;  1LK7 A;  1S9G A;  2LVW A;  3NMA A;  1J2V A;  1CJT B;  4GRS A;  2ZH3 A;  4IH6 A;  3AOA A;  3CJ3 A;  4ED6 A;  1C0T A;  4CCH A;  2QIF A;  1JJH A;  2K1R B;  3K59 A;  1J5E F;  4ZIV A;  3EX7 B;  2EEY A;  3K0J A;  1WF2 A;  4ZN3 A;  3MEC B;  2OFG X;  1TMJ A;  4HH0 A;  2MEW A;  2V5H G;  2NPI A;  1P9Q C;  1NJZ A;  2OEK A;  1X60 A;  1IM4 A;  2VPY B;  3MM6 B;  2EW9 A;  4QYR A;  2XI2 A;  3KK2 B;  1RGV A;  1T02 A;  2EBG A;  4FDF A;  2YWG A;  3NBP A;  4DV2 F;  3NY0 A;  2ZNZ A;  1JLE B;  3VAK A;  1EAR A;  3H25 A;  5M2R A;  1IJF B;  1JQG A;  2CPX A;  4LRF A;  2W9B A;  3OUY B;  5HMW A;  4EBC A;  3EPI A;  5IM0 B;  2B7C B;  4A8M P;  1RWX B;  2MDA A;  3MM9 B;  5J2P A;  2SXL A;  2HBY B;  4NYP A;  4WYW A;  1UCN A;  1XMO J;  1HQE B;  3TZY A;  1W2B R;  3EZU A;  3SDE A;  4ZPB A;  1SUQ A;  1TMM A;  5E5N A;  3BV8 A;  1JKH A;  3MED B;  3TEG A;  1AZS A;  1WC1 A;  4Q2L A;  3ONQ A;  3L09 A;  4F2R A;  1NSQ A;  1YVF A;  3GR0 A;  3DXB A;  4IG3 B;  3P3D A;  1X5O A;  1U1N A;  4UOC A;  1CS4 A;  1RTI A;  3RRK A;  2D7S A;  3RU0 A;  5FDL B;  1WKJ A;  1Y11 A;  1GMV A;  3S1T A;  2VG5 B;  2ACM A;  4C48 A;  1K9M T;  3CCZ A;  4X4O A;  1N5Y A;  5DQG A;  1UZD A;  3V4I B;  4DU7 A;  1FWK A;  5LSO A;  1Z2L A;  2N82 B;  4DV6 F;  3DGP B;  2QC3 A;  1BY9 A;  1NKC A;  4DG1 A;  5K9F A;  1XQI A;  2DRD A;  4YR2 A;  3J7Y I;  1TL1 A;  3CJ0 A;  1XNQ F;  4Y00 A;  3W62 A;  3CJ2 A;  2R7V A;  3MCS A;  4JI6 J;  1M5V C;  2FQQ B;  4CLW A;  4ZIW A;  4JI7 J;  2RH3 A;  1JLF B;  2RSQ A;  1S1U B;  2PEH A;  1RKI A;  4B3O A;  3DXS X;  5KFW A;  3POT B;  1RDR A;  3OTB A;  5M2U A;  1TUV A;  5ETQ A;  3J81 Y;  3W9I A;  1VBZ A;  4XIU A;  2WB1 D;  5GVQ A;  1B99 A;  5IV4 A;  4O3N A;  4MK7 A;  1PAE X;  4ECX A;  2AQ4 A;  4OZL A;  4P6Q A;  5DS7 A;  3QT7 A;  4NXN F;  4A48 A;  3PW7 A;  3QLH A;  4JI3 J;  1RAJ A;  1UZH A;  3CD7 A;  1WTB A;  3CF5 Q;  3DLB A;  2HWH A;  3US5 A;  2E9R X;  3KTQ A;  3TAM A;  4M5H A;  1S99 A;  1M5O C;  5CYQ B;  4DQS A;  3W2V B;  4M5K A;  1ZM2 A;  2VKZ G;  1SKU B;  3PYD A;  3SZ2 A;  4Y65 A;  4AYB D;  1M1K T;  4ZVH A;  5C24 B;  4X4N A;  3W3S A;  1VGY A;  3FBE A;  1TFW A;  5F3Z A;  2QA1 A;  2WVB A;  2EC0 A;  4NLW A;  4AQY J;  5CYM B;  2R8J A;  1HWU A;  4QIV A;  4PXD A;  4OLP A;  3W61 A;  1XN9 A;  3PEH A;  1FKP A;  4IO1 A;  2GO8 A;  1NAQ A;  2NPF A;  2C1E B;  2MHE A;  3CJK B;  3TAR A;  3VZI A;  3GP9 A;  1Q5Y A;  4LMZ A;  4Z7C A;  2V9K A;  5KFK A;  3J7Z 5;  3QWU A;  3BJY A;  1RI7 A;  2VC1 A;  3L7P A;  3MMA B;  1RT6 A;  4GO5 X;  1LW0 A;  3NLC A;  2ZKU A;  4FN5 A;  2MKI A;  4DPY A;  3KK3 A;  4KSE B;  1YJT A;  3EE3 A;  2AW0 A;  3G71 S;  4KC5 A;  4OX8 A;  3MWB A;  1U0H B;  2ATC B;  2HGL A;  4K8R A;  1TR0 A;  1X4E A;  1WSR A;  2YBV A;  3N5B A;  4CQ1 A;  1U1M A;  2DJW A;  4M1K A;  1WI6 A;  1H73 A;  3NGT A;  3TA1 A;  2XS5 A;  4KR0 B;  5ETR A;  3BYR A;  3N5F A;  4DV5 F;  2ZOG A;  2LQB A;  2Y8W A;  5HLF B;  1DQ9 A;  3KUH A;  2RDI A;  2Z0G A;  3FCW A;  3WZ0 A;  4B02 A;  2AX1 A;  4JI0 J;  1U02 A;  4YHH J;  2YKA A;  4P52 A;  2ZBC A;  3D0I E;  5LT5 A;  4F4W A;  3VGS A;  3UN5 A;  5H9F K;  1VQN S;  1R8C A;  4EO6 A;  4DF8 A;  2BEF A;  4IOC Q;  3OTO J;  1IKV B;  3NGK A;  3HO1 A;  4RBV A;  4X66 J;  4OYI A;  3OLA A;  4LF1 A;  3A12 A;  2KVI A;  3MEG B;  1RAI B;  2M0G B;  1R8A A;  4A8X A;  1PC4 A;  2GFF A;  4HR2 A;  4TNO A;  5KG4 A;  3E8O A;  1TTH B;  3V6J A;  1M5K C;  4NCA A;  3IN5 A;  2IDE A;  2J8A A;  2YNG B;  4MH8 A;  1L3K A;  3P4U B;  3DLG A;  4TQS A;  2DNN A;  1Y5I B;  3PJW A;  4FS2 A;  1U7L A;  2RKI A;  4Y0F A;  3MAQ A;  3HX9 A;  5HVG A;  4NXM J;  4RW7 A;  1FRK A;  1F9F A;  2HIY A;  4NLY A;  3O5T B;  2KXN B;  2CJY B;  3PYF A;  2BE2 B;  2DGS A;  4WYL A;  4OI1 A;  5CZV A;  2GMJ A;  5BYS A;  3BR8 A;  3BGF A;  1RHU B;  2O01 C;  7FD1 A;  3UFC X;  5GMK a;  4HI2 A;  2QJ3 A;  1RAH B;  5C7P A;  4CWB A;  8ATC B;  2UUT A;  2LA4 A;  4M5I A;  2BW2 A;  2Y9H A;  4F4A A;  3W5Y A;  3FZ2 A;  1K47 A;  1S4F A;  5A8K B;  2HVZ A;  2HLU A;  4FYY B;  2KFY A;  1EP4 B;  2F4V F;  5KT3 A;  5D4N A;  3O2I A;  4AND A;  2XM3 A;  4RR5 A;  2PN6 A;  5KT6 A;  4TLQ A;  3VGV A;  2H51 B;  3B78 A;  2QA2 A;  4QWA A;  1HQU B;  1U47 A;  2GAH C;  4DZD A;  3MMB A;  5CQG A;  3D3C J;  4IFY A;  3M2R B;  2IBK A;  2FHJ A;  5DJB A;  3R5C A;  3ADA C;  1FEE A;  2AWZ A;  4E8U A;  3LP1 B;  3FFI B;  4LFB J;  1HI1 A;  3W64 A;  4EWT A;  4X4Q A;  2ZUG A;  1FE4 A;  3MPD A;  3OT9 A;  2V2Z A;  3F73 A;  3H5S A;  5GAD U;  2JC0 A;  5AXN A;  3LWL A;  1X0P A;  4DHV A;  3NG8 A;  5B09 A;  4USU A;  1VYA A;  2VBW A;  3NS5 A;  3BN4 A;  2KG1 A;  4Q0B B;  2WON A;  4N77 A;  4KHP J;  1X4B A;  3L9Z A;  1S10 A;  2A1B A;  4ZVT B;  5LJ5 Y;  3VQT A;  3BDE A;  4PWU A;  4DSL A;  2OP5 A;  5KT4 A;  2DCL A;  1YSJ A;  5KG3 A;  5AE3 A;  3FEY B;  1Y3K A;  4B3R J;  3RBD A;  1OO0 B;  1RCX B;  2W24 A;  2VA3 A;  2K2P A;  4QIG A;  5FLX U;  3BRE A;  2P9G A;  4Q5V A;  1DZ5 A;  4PPD A;  5FLX Y;  2HEK A;  1DTT A;  3V6D A;  3PX4 A;  1VQL S;  3FC9 A;  4Q7A A;  2BE9 B;  4R8U B;  3CJT A;  4IR1 A;  4HKQ A;  1Q53 A;  1RHJ B;  4LIW A;  1FK9 B;  2WBR A;  1OY9 A;  5F8N A;  1IKY A;  1FHT A;  2KT3 A;  5KG7 A;  1XBW A;  4I2P B;  3D3B J;  4DQP A;  3CJQ A;  4KGK A;  4DFJ A;  3M8Q A;  2KT5 A;  4C8M A;  1WC3 A;  2BKP A;  1CVJ A;  3LPY A;  3PO4 A;  4IRC A;  3TUP A;  4ZPV R;  5J2M B;  3KNA A;  2DNH A;  3IBW A;  1YGY A;  3D9B A;  5KFH A;  4MKV A;  2HK3 A;  2CXE A;  4ZJL A;  3TOQ A;  4NYZ A;  3I9V 9;  3W8G A;  4B3T F;  3C6U A;  1FI4 A;  4QWC A;  3K5P A;  2XY6 A;  4BDP A;  5FD1 A;  3R5D A;  2VG7 B;  5AXK A;  5HRO A;  3OTE A;  2ZDP A;  2CRL A;  2ZE2 B;  1ITP A;  2VDH A;  2XYP B;  4XPC A;  2JLF A;  3SMZ A;  4USM A;  2CZ4 A;  4LR7 A;  3KHG A;  2RS8 A;  3BO4 A;  2RUG A;  1WAC A;  5IZH A;  2GX8 A;  4X84 A;  4AT1 B;  2HQI A;  4LFC J;  2NXE A;  5JMN A;  2VB6 A;  1KP6 A;  3M9O B;  1P1L A;  5KT5 A;  2XB2 D;  1DTQ B;  4Z7Y A;  3G6Y A;  1WDD A;  2RNE A;  2OPQ A;  2QEX S;  1D0E A;  2G0J A;  1BQM A;  4ED0 A;  3KOA A;  2OML A;  2MKK A;  2KT2 A;  2ADB A;  4KV8 A;  1SIZ A;  4EBD A;  2M7S A;  1FNM A;  3CDB A;  1KTQ A;  2H48 B;  4NLV A;  1RWN B;  4OZJ A;  3RZA A;  4L72 B;  1LXJ A;  1NXI A;  1VFJ A;  2AJ1 A;  4NI2 A;  5EWG A;  3GJR B;  2V68 A;  3UD5 A;  2FHM A;  4DPU A;  3EXC X;  4J9S A;  1LWF A;  1TAU A;  2AGP A;  4J9L A;  2YNF A;  1RT4 A;  3ITH B;  4CNY A;  1VK8 A;  2AZ3 A;  3CE8 A;  2Q3P A;  4LF6 F;  1T11 A;  1IBC B;  1VMB A;  1RT5 A;  2KTQ A;  2CPH A;  2AP6 A;  3T19 A;  3MM5 B;  3BO2 A;  2B9E A;  4AL6 A;  2IM0 A;  3UCU P;  4U9R A;  5A8R B;  3NWG A;  1K0T A;  4ETX A;  3QO9 B;  2JHE A;  5GAH U;  3R2D J;  3LW5 C;  4DUY J;  3HMJ G;  3EZO A;  5F8L A;  3JS9 A;  3HHN B;  5JJB A;  2Z2M A;  4R0E A;  1FD8 A;  1CQN A;  2XMW A;  2IA0 A;  2BBE A;  2K3K A;  5E41 A;  3VV2 B;  3KDN A;  4TY9 A;  4RO0 A;  5A2Q U;  2MZS A;  2KYX A;  3HLU A;  1FJC A;  4DL7 A;  3MEE B;  1EKR A;  3GE9 A;  4CM2 A;  2H5I B;  2B5J B;  1V5V A;  1VQM S;  1RT1 A;  2EG2 A;  4IOA Q;  1UA0 A;  4YFU A;  4FF2 A;  5L1J A;  5IC6 B;  2VAS A;  3IAS 9;  1RTZ A;  3IRX B;  5DM6 Q;  4WFA Q;  2MPU A;  1TUG B;  1BXN A;  1AUS L;  5D8H B;  1I51 B;  2XEX A;  1UKU A;  4KFB B;  2AJQ A;  2ILY A;  1NK5 A;  2AX0 A;  3H5X A;  3G8T A;  4DR1 J;  1X4G A;  4RNF A;  1OSD A;  2R7R A;  3M8W A;  3SCK E;  3T9Z A;  4QYZ K;  1S1X A;  3GTY X;  3HHL D;  1G4C A;  2C2N A;  5ETV A;  2V8P A;  2MY7 A;  1ZA2 B;  1HNZ J;  4WBF A;  3LTO A;  2OTJ S;  1OPI A;  2KL8 A;  2DGO A;  5K8O A;  3ENV A;  4XAK A;  2O1P A;  4A8O A;  3B82 A;  1URR A;  4F3O A;  2YPZ A;  2GHW A;  5J1E B;  5DET A;  3FSI A;  2I5J A;  4MFB A;  1NK8 A;  5CAB A;  4B9T A;  4KKO B;  1ELO A;  2BVZ A;  1CJV B;  3G96 A;  4O3O A;  2J8S A;  1XER A;  2RRB A;  2P2C B;  3PYG A;  2JNJ A;  1NJW A;  1LW2 B;  1JXV A;  2CNO B;  4O0N A;  1KLM B;  3R7B B;  1YIJ S;  4FVC A;  3PO5 A;  3GIK A;  5DDP C;  2QFJ A;  4C8Z A;  2MQQ A;  2YNI B;  4C0H A;  3C19 A;  3ISZ A;  3VZH A;  3R97 A;  1WNE A;  1QVF R;  3A4T A;  2YWW A;  4TVA B;  3CCJ S;  2CPZ A;  4CTA B;  1MMN A;  2DKO B;  4WE1 B;  1FVS A;  4HT7 A;  1PYO B;  3R3T A;  4HAC A;  1S97 A;  4CLP A;  1V3S A;  1TL5 A;  1FJ7 A;  5EHH A;  2FUG 9;  4WP3 A;  3CTR A;  2AYM A;  4I1T A;  1PKU A;  2D41 A;  5E2Q A;  4DV0 F;  3OFG A;  1M5P C;  2YNH A;  3H98 A;  3QGI A;  2NXJ A;  4LIR A;  2A10 A;  3I96 A;  1T95 A;  1N33 J;  2QV6 A;  1K44 A;  4K4X A;  1HMV A;  2KJW A;  4DPO A;  3C46 A;  1SV5 A;  2LA6 A;  1E6Y A;  2BQR A;  3IAM 9;  3MUR P;  1UPP A;  5M2P A;  3BPS P;  1QTN B;  2OFH X;  3IR6 B;  4OZ0 A;  4CO2 A;  4KT0 C;  1VQP S;  1VHI A;  5C25 B;  2DTJ A;  1RCO B;  3T1H F;  1Z2Z A;  4RW4 A;  1X5S A;  4TYB A;  4QU7 A;  3GZ7 A;  4ZVO B;  1KC8 T;  2ATL A;  4BHQ A;  4DL3 A;  1C1C B;  5AE2 A;  3BH7 B;  3DOL B;  4ZLN A;  4WP8 A;  2NUU G;  3VGT A;  4NLP A;  1YJV A;  2DNY A;  3CMA S;  2HAI A;  2ZVS A;  1X4A A;  2YQ3 A;  2DGT A;  2UV8 A;  2P9E A;  5HQL A;  1F3V A;  5F8G A;  3CO9 A;  3KLE A;  1LWE A;  3F41 A;  2UXD J;  5T7L A;  1WKL A;  1QAY A;  5LXR A;  1P27 B;  2W2Q P;  4LF7 F;  1FEH A;  4I69 A;  2DRB A;  1T05 B;  3S7R A;  1FKO A;  2JVR A;  4O23 A;  4DZ6 A;  3W8P A;  1JJC B;  1OIA A;  1V9O A;  5KG5 A;  2KFZ A;  2R8K A;  1FD2 A;  3UDE A;  1FES A;  2HRY A;  3RG6 A;  2CFX A;  4NAS A;  2HYI B;  1RT7 A;  4ZCM A;  1HFE L;  2EK1 A;  1ZH5 A;  4J9N A;  4A8Q A;  4ES3 A;  3QSI A;  5GAH I;  3CDA A;  4MAK A;  3PRB A;  1C0U B;  4A47 A;  1M0S A;  2C2O B;  2FDN A;  3HFK A;  2QE5 A;  3NWR A;  2Q6C A;  3H4B A;  5K5M A;  3H90 A;  3LP0 A;  2XLK A;  2CQ0 A;  3NNA A;  3R7S B;  3I6P A;  3GCX P;  3A1Y G;  2AYG A;  2ZVI A;  1KOH A;  3ZTO A;  4EI2 A;  2BM0 A;  4DX8 H;  3V2U C;  2R7T A;  5HL7 Q;  2GZO A;  3GIL A;  2CQG A;  3MOZ A;  2IC3 B;  2FHK A;  1S1W B;  3DOK A;  2LQ8 A;  3LAM A;  5CXT A;  1U09 A;  4QJV A;  2IFX A;  3P96 A;  4KRW A;  3SV3 A;  2IDL A;  1R43 A;  1NH7 A;  2D9O A;  4DJB A;  4NYO A;  2V0N A;  3O8W A;  1XMO F;  3BKU A;  4OZ1 A;  1ARO P;  3LUY A;  4OYB A;  4ATN A;  3MFH A;  3QRQ A;  4IRD A;  2LXI A;  2HFN A;  1Y9O A;  1O5J A;  1GEH A;  3OSP A;  2XTJ P;  1HBO B;  4ED1 A;  4JV2 A;  5KG6 A;  3MGJ A;  3KJF B;  4B9L A;  5HBM B;  1RYR A;  3D0G E;  2JZ5 A;  1S0O A;  2W4P A;  2U2F A;  3NXZ A;  2DGU A;  1MWQ A;  1LNQ A;  5HK4 A;  1RTH A;  4FNI A;  4NLR A;  5KFB A;  1VQY A;  5F8I A;  4CO5 A;  3KMQ A;  3I4H X;  4M5D B;  1KON A;  2X3G A;  1IR1 A;  1U1K A;  2RF2 B;  3LF0 A;  4URG A;  4CYU B;  2ROE A;  1Z4U A;  1AUD A;  1TKZ B;  4URS A;  3DRS A;  2Z8Q A;  2ZH9 A;  4LJM A;  4FZV A;  4N8N A;  1GTE A;  2XMM A;  3FKB A;  4YQW A;  1UPM B;  4WTY A;  5L9X A;  1TU0 B;  4GO7 X;  3DRR A;  3KLI B;  4OJ3 A;  2D1C A;  2UVW A;  1ZPV A;  2ZWO A;  4JI6 F;  4PG8 A;  5EX3 A;  4O3R A;  3SCL E;  4TXS A;  2DNP A;  4CO1 A;  1GX6 A;  4CLT A;  5DDQ C;  2RHS B;  4JI7 F;  3FSY A;  4LRD A;  3M1V A;  3GCW P;  4C7Q A;  2D3U A;  4ECZ A;  4USJ C;  2I2Y A;  2W7A A;  5K8P A;  1SB6 A;  3IP0 A;  2AV5 A;  1Y00 A;  2E66 A;  2DNK A;  2NCK L;  5IQ6 A;  4V19 X;  4FBU A;  2GQQ A;  2BYC A;  4PG7 A;  3PRV A;  2NR0 A;  4ZCL A;  2BQ3 A;  2BOP A;  1NZ8 A;  4JI3 F;  1TKT B;  3A8E A;  3TJ9 A;  3OFH A;  2NLW A;  2VJV A;  2BZ2 A;  1SC6 A;  4PXC A;  3ISN C;  2JC1 A;  2HND A;  2YX1 A;  2D74 B;  2R7Q A;  4NLD A;  1ZZF A;  1JLG A;  4DLG A;  3EPG A;  1S7I A;  2G1D A;  2GAG C;  3M30 A;  3MR3 A;  4EEY A;  3OPK A;  1IBK J;  2W2N P;  2XNQ A;  1I94 J;  2XCP A;  2E5L J;  3NKY A;  2D3O R;  3D5M A;  2EFO A;  4K4S A;  5LJ3 Y;  4NOH A;  2GNK A;  5H9F J;  3W63 A;  3ZZO A;  1BHN A;  3BGO P;  1JLB A;  4AQY F;  1F1B B;  4WTO B;  2PI5 A;  2NZ4 A;  2O3D A;  1EJ7 L;  3KLG A;  3N6M A;  2HKE A;  2Z30 B;  4I56 A;  3R1H A;  2KO1 A;  2GJF A;  4ED4 A;  1WJ9 A;  3A8I A;  1TKD A;  4F4X A;  1RHK B;  2W01 A;  3PXG a;  2QMW A;  1IBM J;  3J7A 1;  1S0M A;  5LSL A;  2NYH A;  4RBU A;  3J7A N;  5BJR A;  4JYA J;  3PJ9 A;  4MK9 A;  2C2E A;  4TU9 A;  2VFS A;  1YX2 A;  5IV3 A;  2UXB J;  1UA1 A;  2V63 A;  3D1H A;  2MQN A;  3NCQ A;  5J2Q A;  3H5U A;  2B4U A;  3IBF B;  4TY8 B;  3Q89 A;  5ETN A;  5HP1 A;  1CEZ A;  2MKY A;  1UW9 A;  2FVS A;  4F7V A;  1RT2 A;  1JLA B;  4EU0 A;  4CT9 A;  2DEI A;  5DRK A;  4I4B A;  4LF4 J;  4WJB A;  1WG4 A;  2V8G A;  3CC2 S;  1T8E A;  4X65 J;  1L3T A;  2Z2Z A;  3WIU A;  4NWB A;  3RW6 A;  2I38 A;  4BCA A;  4ZLP A;  2RRA A;  2F9D A;  4JI0 F;  1LWX A;  2KHC A;  5ETS A;  4YHH F;  2W2M P;  3U7J A;  4UOG A;  1T03 B;  3OLB A;  2AU0 A;  3IWX A;  3K5O A;  3MM7 B;  1RP5 A;  3U1L A;  2LDI A;  1HBU B;  1RWU A;  4NA3 A;  1DAX A;  1X31 C;  2MY8 A;  3QJL A;  1APS A;  2OPR B;  3TYT A;  3OTO F;  3NEK A;  3UI3 A;  4X66 F;  3HVW A;  1NK6 A;  2XZT B;  4JOU A;  3CXC R;  4U7U K;  4DR4 J;  3H5Y A;  2QMU B;  2XGQ A;  2P9C A;  5DM7 Q;  3GYX B;  1U8S A;  1RBA A;  4IR9 A;  2V2Q A;  2HQC A;  4RKU C;  3QT5 A;  2A3J A;  2W7P A;  3JAM U;  2F7V A;  1HL6 A;  1SJF A;  3TAP A;  2W8L A;  2VD3 A;  1N8R T;  5F8H A;  4BBY A;  1SH3 A;  2CJX B;  4C6A A;  1NKE A;  1UMJ A;  3MPU B;  3T5K A;  4NXM F;  1NJI T;  4NLT A;  1HIY A;  3AQO A;  3T3F A;  2CAJ A;  4Q45 A;  3ETM A;  4PKD B;  3CDU A;  2XMA A;  5GMD A;  4N41 A;  5JXS A;  1BQN A;  2M4M A;  1OQ3 A;  2OUG A;  2QL5 B;  2BJ1 A;  5L8R C;  1HNI A;  3M8R A;  5B0G A;  2VOO A;  1NPK A;  3T1Y J;  3FMW A;  4FF1 A;  1VRT A;  1D9A A;  2F8M A;  3FRZ A;  1T9X A;  1GH8 A;  2QRR A;  4NCB A;  4ZCI A;  3I0R A;  2ERR A;  2PI4 A;  1S0N A;  4ALZ A;  1U1Q A;  2UP1 A;  3DOM A;  3ULH A;  4CZC A;  3SSS A;  2ZH8 A;  1PSD A;  2EFP A;  4LFB F;  4ED7 A;  1CJT A;  1R7I A;  4IFV B;  4M5L A;  5I3P A;  3D6T B;  2K1R A;  4G6V B;  4CH1 A;  2XBP A;  3MEC A;  3DI6 A;  5I42 B;  1X9W A;  3MM6 A;  4DUZ J;  4BS2 A;  2YWF A;  3P6Y C;  4KHP F;  1NPR A;  4ZVU B;  2HQD A;  3KK2 A;  3THP A;  2A0F B;  3ENA A;  3NNC A;  3JSR A;  1ZPW X;  5J1P A;  2FGC A;  4P9S A;  2ZOF A;  3G8S A;  3HZG A;  2RAQ A;  4B3R F;  1MRO B;  3FDS A;  2B8P A;  1WEZ A;  4XDC A;  5IM0 A;  4OYX A;  2K3I A;  3IA0 A;  2YPY A;  3HVA A;  2XZD B;  2F65 A;  3DDI A;  1U1P A;  1YK9 A;  3W9H A;  3E01 B;  1S79 A;  2Y3Y A;  1IKW A;  1M1G A;  4C3L A;  4RBT A;  4P7V A;  2XS2 A;  2V6A A;  2X3D A;  3NGU A;  4OX9 J;  3N6L A;  3TJ8 A;  4ERD A;  4RW9 B;  2QN6 B;  1IQZ A;  3BGU A;  4IG3 A;  2P6T A;  4CLF A;  2VBY A;  4LQ9 A;  3MPW A;  2BKO A;  1SUQ B;  4N7T A;  4Y2C A;  5FDL A;  2YKN B;  1R8P A;  1GAO A;  2VG5 A;  3QZ8 A;  2J0Q D;  4NRU A;  1YBA A;  2ROG A;  1YJ7 A;  4J91 A;  5EWE A;  2CJK A;  4UUX A;  3V81 A;  5D6G A;  1P8G A;  1SQE A;  3PZP A;  1IVZ A;  2VG6 B;  1CS4 B;  3DGP A;  5IXU A;  2XO6 A;  5HJY A;  2EFG A;  4ANC A;  3ZTS A;  2JEJ A;  5HSP A;  1S6Q B;  4I2Q A;  5E0O A;  3B4M A;  1UAW A;  1EQ0 A;  4ZKA A;  3AT1 B;  2EG1 A;  1N5Y B;  2EK6 A;  3N9U C;  4USH A;  5F0W A;  5LMN J;  4DR5 J;  4LFC F;  4H4K A;  4DQI A;  4ZP8 A;  1FDA A;  2A2D A;  1JLF A;  4DG1 B;  1S1U A;  3HHK A;  4H4M B;  3PFO A;  3POT A;  4M5G A;  1KQS R;  3UNG C;  2R9L A;  1JMT A;  1QE1 B;  5IOL A;  2E1R A;  5CH7 B;  2HMI A;  1R0C B;  1Y10 A;  3WDO A;  1RQ0 A;  4IQX A;  3G2X A;  1SJR A;  2UVV A;  1TVR B;  1LXN A;  3UPF A;  1T9Y A;  4DV3 J;  1DAR A;  4B3O B;  1VQ5 S;  3ZTQ A;  1EET B;  2OMO A;  4H4O A;  4UST A;  2IYI A;  3THT A;  2CZV C;  3W2V A;  3CWJ A;  3ILO A;  4DX6 A;  5KFX A;  4DEZ A;  3QLH B;  5C24 A;  2CJB A;  3QZ7 A;  3DDK A;  1G1X A;  5K8N A;  1HKA A;  1HNV A;  4LF2 A;  4R0J A;  1WF1 A;  2QLX A;  2E7V A;  1D9D A;  1Q79 A;  4QYZ J;  4I6W A;  3ZC4 A;  1X5P A;  1S6U A;  3KHL A;  1RLC L;  1K0V A;  3DNC A;  2WSC C;  4QW8 A;  4IO9 Q;  2BQU A;  4DUY F;  4I64 A;  1LOU A;  3PR5 B;  4DS4 A;  1Q78 A;  3HFZ B;  2ZH5 A;  4KGX B;  4WK1 A;  4CLS A;  4XPE A;  4B9S A;  1Q4R A;  3CJK A;  1TFY A;  3QJJ A;  1NK7 A;  1DY3 A;  1M5H A;  4MT1 A;  2JDJ A;  3H0P A;  6FD1 A;  2J9D A;  3KKF A;  4ELV A;  2HVI A;  4Q8E A;  2IM3 A;  4R5P B;  2N7Y A;  4MIA A;  3UN3 A;  2BAN B;  2F9J A;  3MMA A;  4X4R A;  2VON A;  3GON A;  1RHR B;  3HK2 A;  3R7N B;  4J9V A;  1QJH A;  4YR3 A;  1LWC B;  4ICL A;  1U0S A;  2H9Z A;  4OZ5 A;  5EN1 A;  1RT3 B;  3F56 A;  4F04 B;  2CJA A;  3IGV A;  3Q8V A;  2VPW B;  1RAG B;  1PG5 B;  4F25 A;  4LR9 A;  3QRP A;  3KUE A;  2DEJ A;  1YDL A;  3B6B A;  1A0O B;  4CT8 A;  4FNH A;  1RT6 B;  2AZ1 A;  1LW0 B;  2DPI A;  3W2W B;  2YWE A;  2G13 A;  4J9K A;  5CA5 A;  4PXB A;  4FVM A;  1U49 A;  1YRT A;  4QPT A;  4FYD A;  1MU2 A;  3LQV A;  4C3M A;  4WFY A;  3PTW A;  4KGM A;  4DR1 F;  4FS1 A;  1QY7 A;  1IWA A;  4AE5 A;  4J90 A;  4ZHR B;  1UVL A;  1DLO A;  4WFX A;  2CJQ A;  2HFZ A;  3OL6 A;  4FYV B;  2V4R A;  2IYG A;  1HNZ F;  5ETL A;  2V67 A;  3VQS A;  3PDN A;  1JLC B;  1I3O B;  2L41 A;  2B9X A;  1IKV A;  8AT1 B;  2G2Z A;  4QR0 A;  3G4S S;  2APO A;  4F0M A;  1GMU A;  1WC6 A;  3NGS A;  4ECU A;  1XMQ J;  2FJV A;  3GFY A;  1UL3 A;  4OLO A;  3EGN A;  1NUE A;  4EYH B;  1W26 A;  1LV5 A;  4QQB A;  2OPS B;  3KLF A;  5C5J A;  2Q6B A;  1GQE A;  2FLO A;  2FVR A;  2MGZ B;  2C2M B;  2PA8 D;  3R2C J;  1ZYQ A;  4LBI A;  4LR8 A;  3ZZY A;  3KLV A;  3KJN B;  3CCE S;  3VAJ A;  4KPC A;  4HHJ A;  2XMK A;  1FCA A;  4NEZ A;  1KBR A;  3CC4 S;  1VQS A;  2KU7 A;  2PEB A;  4ES1 A;  3PIO Q;  2F8H A;  1N34 J;  4QR2 A;  2BE2 A;  3FRY A;  1VCT A;  4OQJ A;  5IC4 B;  1X4C A;  3NMR A;  5KFE A;  2Z56 B;  4DSJ A;  1RWV B;  2W2O P;  2ZBQ A;  3Q8P B;  1N6Q B;  2XQC A;  3I5B A;  4QPX A;  2E1P A;  1XTZ A;  2FGO A;  2BAC A;  4IUF A;  3ELH A;  3FQL A;  4HEA 9;  3IWN C;  5I3Q A;  3KHR A;  4BC7 A;  1N33 F;  2E7X A;  2R7U A;  1PIL A;  3MR5 A;  1TQL A;  3GB0 A;  3EDR B;  4Q2M A;  2W7O A;  3L7O A;  1I6J A;  1VI7 A;  5DLF A;  1CJK B;  1UWB A;  1HQU A;  1RZM A;  1RTD B;  4ANE A;  1EKS A;  4J9O A;  3MR2 A;  3QPI A;  2WSF C;  2IMO A;  1HR0 J;  1OJ4 A;  3PFE A;  1IWG A;  1YI2 S;  4FKY A;  5IT9 Y;  5AXL A;  1OYD A;  3LP1 A;  9ATC B;  4F36 A;  3MXH P;  1F6T A;  2EKN A;  2ZHA A;  2B43 A;  3CSK A;  3CGI A;  2Y1R I;  2J7W A;  2E44 A;  2H54 B;  2YWH A;  4CRJ A;  3KLH B;  2CQB A;  3BSC A;  3F44 A;  1KOO A;  3TX0 A;  4IFY B;  4YS2 A;  4M5M A;  4PQU A;  2A6O A;  2UXD F;  2G2Y A;  2HGM A;  4JV5 J;  1V5I B;  3ET6 A;  2J9D E;  1N5T A;  3KHH A;  3HDS A;  1F5C A;  1MNE A;  3RAQ A;  4RLE A;  1ZTW A;  2IBO A;  1UEU A;  1R3N A;  2AD9 A;  2DH8 A;  2GJ2 A;  2WON B;  4RL1 A;  4ILR A;  2KRB A;  2XSF A;  1MG7 A;  4ED3 A;  2WVC A;  2HAF A;  1UP1 A;  5KFN A;  2HIQ A;  2MHN A;  4M5N A;  4ID5 B;  4RNN A;  4UZC A;  1GT8 A;  2L9W A;  2C3U A;  3WX8 A;  2ZFH A;  4R8U A;  3J80 U;  2ZH2 A;  4B9N A;  3PX0 A;  2A2C A;  3TNV A;  1JNR B;  5E3A A;  4MMO A;  1FK9 A;  2IVY A;  1DTT B;  2GVD B;  3PCO B;  4DMZ A;  1VQ7 S;  5ETM A;  1NDL A;  4LQ3 A;  4K5R A;  5HI7 A;  2BMB A;  2R4F A;  2MLX A;  4OJ1 A;  2OEL A;  5J2M A;  3SSR A;  3LGM A;  1Q82 T;  3MAA A;  2LMI A;  1R0B G;  3GFX A;  2HS4 A;  2WAQ D;  2IA6 A;  1U6F A;  1YHQ S;  4LRC A;  3OXG A;  2WW8 A;  4O3Q A;  1Y5L B;  1SQG A;  2F8E X;  4F26 A;  1RA7 A;  2JL9 A;  2VG7 A;  2W9C A;  3H2L A;  2BJ9 A;  1QAX A;  1FXL A;  5GAG U;  2ZE2 A;  3EWG A;  3JSM B;  3IRW P;  3WBZ A;  2DHA A;  1PC5 A;  1RXO B;  3N0V A;  2B56 A;  1ZAW A;  4UUW A;  7FDR A;  4DV6 J;  1VQ4 S;  4LF9 J;  3V6K A;  2KFN A;  3WIV A;  3LO3 A;  3VGU A;  4YR0 A;  4C3K A;  3U27 A;  4QU6 A;  5F3T A;  1VRU B;  1OPZ A;  4F67 A;  4DSE A;  2PC6 A;  2CQ2 A;  2GIQ A;  1IN0 A;  2WB4 A;  3HPO A;  5A0Y B;  2CQ1 A;  2XWX A;  1OSC A;  2WVF A;  4TU7 A;  1VQO S;  4OHV A;  3AD7 C;  3CJ5 A;  1F0X A;  3DFE A;  3B4D A;  3D6M B;  1WWH A;  5AJ3 J;  1KQF B;  3OD2 A;  5F8J A;  5FJ4 A;  2X1B A;  4F50 A;  1AT1 B;  1N56 A;  4MYU A;  4DL4 A;  2OPQ B;  1A6L A;  3G82 A;  2ROP A;  3MZI A;  1BQM B;  3BBB A;  1VQ6 S;  1CUL A;  2XUL A;  1XR6 A;  5DGB A;  2YTC A;  4KV8 B;  4FKX A;  4V1A k;  3D68 A;  2CG4 A;  1RAE B;  1LK5 A;  3CIM A;  3OHB A;  1NJY A;  4MK8 A;  2O5D A;  3MCO A;  2LDY A;  3MM5 A;  3L3C A;  1KVK A;  2HQG A;  1H7W A;  4J5O A;  4GC7 A;  5A8R A;  4JI4 J;  2YNF B;  1RT4 B;  3QO9 A;  2J0X A;  2YY3 A;  3DLJ A;  4KH1 B;  2J7K A;  2KB2 A;  5D0G A;  4IG0 B;  3SEO A;  2ZC4 A;  4TKT A;  3MFI A;  1N32 J;  4G1P A;  1KLN A;  2RVJ A;  3E3X A;  2V4J B;  1SL2 A;  2XY7 A;  2BRK A;  4NML A;  2MKH A;  4DR7 J;  1WEL A;  4PUO B;  2CKW A;  4WZQ A;  2G2O A;  1PO6 A;  1IBK F;  1TK5 A;  1J5O B;  4J9P A;  1I94 F;  4NL5 A;  1NK9 A;  3RUB L;  1G6B A;  3OR1 B;  2E5L F;  4FF4 A;  4ZIT A;  2ZC3 A;  4UZB A;  4PWW A;  4N8O A;  1R27 B;  4ECS A;  2FVC A;  1WEX A;  3MEE A;  2DR6 A;  4WFB Q;  1VC5 A;  1TL7 A;  2RQK A;  2DCU B;  2C22 A;  2E5I A;  1FA0 A;  3ZZP A;  1CJU B;  4ZPT R;  1RWM B;  3QGP A;  3VR1 A;  2CDQ A;  1N4L A;  2L9N A;  3IS9 A;  6FDR A;  5I3U A;  1T3O A;  4YOE A;  4I68 A;  5CAA A;  2ILZ A;  1IBM F;  2XY5 A;  1JNZ B;  2FVQ A;  2RJZ A;  4Y6I A;  2R7S A;  4JYA F;  3LAL A;  1RT1 B;  3KDO A;  1VC6 A;  3HD2 A;  1LFW A;  2VH7 A;  1QDU B;  1V3Z A;  3AA9 A;  5EDW A;  1EHW A;  2UXB F;  2C2K B;  1FJG J;  2XG8 A;  4P10 A;  4CH7 A;  3MUT P;  4JV1 A;  2DGV A;  3PR4 A;  1KQG B;  4K4V A;  3NCP A;  2AYB A;  1FT8 A;  3EVW A;  2GO9 A;  4QBU A;  3LAK A;  4K5S A;  2CQ4 A;  3UN2 A;  5KFT A;  4LF4 F;  3IXQ A;  3RBZ A;  5ADZ A;  1IXK A;  3QIP B;  4X65 F;  2AKW B;  3CUN A;  3DGV A;  3RR7 A;  5KFG A;  3O3L A;  3TVY A;  4ES2 A;  5J1E A;  1UJ4 A;  5KG0 A;  4KKO A;  1RTJ A;  3DLH A;  1NZA A;  2PD1 A;  1U1L A;  1CJV A;  4K4T A;  1H2V Z;  3CED A;  1JWW A;  3IG1 A;  4CI0 B;  3CMQ A;  4QR1 A;  3DRP A;  3OQ2 A;  4FP9 A;  2M9K A;  2MLY A;  1KLM A;  5DDO C;  1L3V A;  3M6W A;  2HHS A;  3GV5 B;  1UVN A;  2Z2L A;  1RB0 A;  1Q86 T;  4WIQ A;  2YNI A;  4MFB B;  3RBE A;  3SSQ A;  5ETO A;  4DR4 F;  3JXO A;  1JXL A;  1HD0 A;  1PJ7 A;  5F9L A;  1JK9 B;  3P8B B;  2YKM B;  2FJB B;  1EX8 A;  1ZET A;  4U96 A;  5A6P A;  4UY8 T;  2N4D A;  3HF5 A;  2ABY A;  1IM6 A;  2WOM A;  4ZJQ A;  2U1A A;  3G86 A;  2AT1 B;  2E1A A;  4AL7 A;  2DHH A;  3CD0 A;  2Z4P A;  1SJ3 P;  1XWL A;  4YME A;  2V8V A;  1UWA A;  3JB9 k;  2FD2 A;  5GAG I;  3CUL A;  4D3G A;  4ZP7 A;  2RQM A;  3UD3 P;  2WVE A;  4Q43 A;  4DL6 A;  5SUH A;  3MF5 A;  4HAC B;  1S7H A;  3R8Y A;  5F0U A;  4DPW A;  1YZ7 A;  2G9O A;  3UWT A;  2E5J A;  2KM8 C;  1N5S A;  1MLA A;  5DO2 A;  1U48 A;  1BMQ B;  4PG4 A;  4F3M A;  4XK8 C;  5LXY A;  2YNH B;  2ZBI A;  3PX6 A;  4DCO B;  4K2J A;  3CCL S;  4ZLL A;  5BYQ A;  2QLF B;  2Y0S D;  3TJA A;  4WU2 A;  3ZZ0 A;  2OPP B;  1SV5 B;  4F0K A;  1E6Y B;  2Z2Y B;  3SI8 A;  3GG1 A;  2DXD A;  3T1Y F;  1HI0 P;  4JB8 B;  5B0D A;  4C8K A;  1WHY A;  3OL9 A;  2PII A;  1SC1 B;  3S6E A;  3NCR A;  4DL2 A;  1MWZ A;  3Q22 A;  4KHR A;  4I6A A;  4N5S A;  4HDH A;  2QL7 B;  4ZVP B;  1WG5 A;  2DGX A;  1S9F A;  2RRN A;  2H1Y A;  4OV1 A;  4BC9 A;  1T05 A;  1ZAX A;  2RU9 A;  5J1N A;  2DH9 A;  1S1V A;  2GHV C;  2ASL A;  4WPA A;  4GKK J;  4WFN Q;  1NDK A;  1VQ8 S;  1NB2 A;  4UOF A;  2XHW A;  2Z58 B;  5HAN A;  2KZM A;  3QGG A;  2KRR A;  3D6F B;  3O1L A;  3R5B A;  5EWF A;  3L95 X;  1Q8B A;  4DUZ F;  3Q24 A;  4OJH A;  1KWM A;  1Q81 T;  1S6P B;  5AT1 B;  2FLL A;  1VQK S;  1ZS6 A;  2M8H A;  1U1R A;  2DY1 A;  2K7J A;  3RAM A;  1NME B;  3BEG B;  3H40 A;  5J2N A;  2QLW A;  2IC3 A;  2OAU A;  1WTF A;  4JI2 J;  3SXL A;  2CDR B;  3SBM A;  4X4U A;  1ZTT A;  4ZPD A;  1NDP A;  4OYM A;  1VHF A;  4KE5 A;  1NRK A;  5ITH A;  3WHI A;  1W2I A;  3Q23 A;  4B3S J;  2V2V A;  1NEE A;  3ENQ A;  1DQA A;  1FO1 A;  5A8W B;  1RAD B;  4PRF A;  2CIM A;  3AFG A;  1UTA A;  2PO4 A;  3HHL A;  1QTM A;  2ZEJ A;  3X1L B;  3QFW A;  3Q8Q B;  1N88 A;  3DOK B;  1HBO A;  2B9Y A;  4DLE A;  2AGO A;  2ZD1 B;  2MKJ A;  2J6S A;  4L6V 3;  4OX9 F;  2B6A A;  1M90 T;  2NS1 B;  1VK3 A;  3FVY A;  1H72 C;  2XS7 A;  1ACM B;  2VKR A;  2L3M A;  5L1I A;  3H20 A;  4JUZ A;  4IYQ A;  4OYW A;  4DXL A;  1R0A A;  2J0S D;  3AXM A;  4OI3 A;  2HBR B;  2GVZ B;  3CDE A;  2RF2 A;  3LWM A;  5CHC B;  1HHT P;  4HHU A;  5JUM A;  4TYA A;  4C8L A;  1F60 B;  1RTH B;  1ROF A;  3QT8 A;  2R42 A;  1RHM B;  1LQ9 A;  5LSR A;  3JQK A;  4ILL A;  4I7F B;  3MPV A;  4OYO A;  2DXE A;  5GAE U;  1H2U X;  3BGR A;  2GIF A;  2IJR A;  2C2D A;  5LMN F;  4JI1 J;  4LBH A;  4DR5 F;  4WXO A;  3CT9 A;  1OS5 A;  1PYS B;  3DRS B;  3C6T A;  3T1A A;  5JVH Q;  3QYY A;  1F5B A;  3MM8 B;  3PRD A;  3CJS A;  3K58 A;  4LSN A;  3NS6 A;  2QYC A;  5LL6 d;  3DRR B;  3TX8 A;  4UW2 A;  5B0C A;  4RW8 A;  1C4C A;  4YEA A;  3ILI A;  1FDB A;  1SQF A;  1TK0 A;  3VTI A;  3HT3 A;  2QZ8 A;  4WP9 A;  4EZ6 A;  4X62 J;  1RK8 A;  3UR0 A;  2HWI A;  1NPP A;  1TKT A;  1WKK A;  4DFK A;  2PGC A;  4DV3 F;  2V34 A;  4AXI A;  2M8D B;  1HWL A;  2MTL A;  2BJ7 A;  3TQ1 A;  2LFV A;  4OHZ A;  3R9L A;  2W9A A;  2UUA J;  3TUJ C;  2CA9 A;  5DG8 A;  3W7B A;  1SC3 B;  2V8H A;  3TVK A;  2UUB J;  2AMC B;  3DU5 A;  3MMJ A;  2R8I A;  1IR2 A;  2G4B A;  3GJS B;  4A8W A;  2AJ0 A;  2HHH J;  2HND B;  1SCJ B;  3D28 A;  3T5L A;  3W9J A;  3OV7 A;  4ID8 A;  1WOP A;  2KN4 A;  1RE1 B;  3IFE A;  2ZHB A;  1HYS B;  4WKY A;  4J9R A;  2OHD A;  4KGZ B;  4YDD B;  1B7F A;  4YB7 A;  1S9E B;  4P72 A;  2PA3 A;  3PKM A;  2IVM A;  3Q2S C;  3OVA A;  1BC6 A;  5DQH A;  3DN9 A;  1FWP A;  3P5T L;  2Y0B B;  2JRS A;  7AT1 B;  2VUG A;  1X0F A;  1VIX A;  1QSL A;  3A3O B;  1R6V A;  2I0X A;  2MJU A;  5EGY A;  3F0N A;  2VHG A;  1IUJ A;  2QSW A;  4GC6 A;  2PFD A;  1OWX A;  3GYN A;  5KFS A;  3LA0 A;  4XDD A;  4P75 A;  5JVG Q;  1GK8 A;  3VWS A;  4TY8 A;  3MEK A;  2VV5 A;  2QTW A;  1PIE A;  2CPY A;  5DG7 A;  2CPJ A;  1KHW A;  1G2E A;  1JLA A;  3W5Z A;  1REV B;  4ILM A;  3BSA A;  5K20 B;  3TA0 A;  2QSF A;  4Q8F A;  2DT9 A;  2EWH A;  4ZP6 A;  5H9E J;  5J2Q B;  1URN A;  1S6O A;  2GML A;  1WOR A;  3BPD A;  2EI5 A;  5HP1 B;  3TA2 A;  2DXF A;  1U26 A;  3GSI A;  1OQ6 A;  3GFH A;  3CC7 S;  1RT2 B;  1HBN A;  5KFP A;  2VC0 A;  1T03 A;  5T14 A;  2YXL A;  2BJ8 A;  2CZ9 A;  4EK2 A;  3CJ8 A;  1V6H A;  4A8Y A;  1HHS A;  3FCH A;  3UCG A;  2RD5 C;  4NA2 A;  2B0G A;  1XK8 A;  2HHW A;  5LOQ A;  2XSJ B;  1KRP A;  4K0K J;  2FHO B;  1EIY B;  3V6H A;  3RTV A;  2DY9 A;  6AT1 B;  4LSL B;  4X64 J;  1Y7P A;  1XMQ F;  4ELU A;  5ETK A;  4WKR A;  3HKW A;  1HWJ A;  2P5V A;  4AUK A;  3D2W A;  2AEJ A;  1Q8I A;  5BYR A;  4C0B A;  3C2P A;  1YKW A;  2KXF A;  3GFZ A;  3HT0 A;  2FVP A;  2BRL A;  3BSN A;  3W5X A;  2HRT A;  4DFM A;  2R2S A;  4IQM A;  2HVH A;  1RBO B;  1S77 D;  1XEZ A;  2XLI A;  2WRM A;  4B17 A;  1NCL A;  4OJG A;  2B7B B;  2K06 A;  4OZ3 A;  4QWE A;  4IOB A;  3GV7 B;  2HNZ B;  3QJP A;  2B4P A;  2OKQ A;  4ZP9 A;  2MZR A;  1NHK L;  2WHO A;  9RUB A;  2HZC A;  3MPY A;  5THW A;  4ZVG A;  1N34 F;  1SH0 A;  4KO0 A;  1YJN S;  5A2Q Y;  1T9U A;  2HHP A;  3GMG A;  4K2X A;  4DSF A;  3HKZ D;  4ZK7 M;  2C2Z B;  4QOT A;  3QWP A;  3NGR A;  4CM0 A;  1F2G A;  1AFI A;  2J6U A;  5KOW A;  1T7P A;  2NRE A;  4O0I A;  4LF8 J;  4P2F A;  2CJ9 A;  2W4D A;  3HSZ A;  1L5U A;  3LP2 B;  5GAE I;  4OFZ A;  1NDC A;  2GC8 A;  5D78 A;  2VFT A;  2DRA A;  4OI6 A;  2PE8 A;  5CCM A;  1BQN B;  4ELT A;  1FRX A;  4OV6 A;  1P9Y A;  5D0E A;  1KR4 A;  1IJE B;  3T1H J;  3BM7 A;  1FFG B;  1RLD A;  1HNI B;  2FJE B;  2JSX A;  2ASD A;  2EKY A;  1HR0 F;  1MMD A;  1F9E B;  5MLC V;  1YRX A;  2M70 A;  1RA6 A;  1DFD A;  3R6G B;  1SJ1 A;  4OI2 A;  1S57 A;  1SVD A;  1SL1 A;  4IFV A;  4MIB A;  3J81 j;  4WF9 Q;  2WCX A;  1FRM A;  2BW7 A;  3FCV A;  3CD6 S;  4KPY A;  4OX6 A;  2XWY A;  1C1B A;  3DOM B;  4F4K A;  4RNH A;  3ZNU A;  2JEI A;  5B0F A;  4JV5 F;  3EVM A;  1U2C A;  2CAD A;  4TU8 A;  4DCP B;  4K4Z A;  2CYY A;  4EZ9 A;  4DV1 J;  4GVL A;  3CIZ A;  4RU9 A;  4UQG A;  3VHQ A;  4HH1 A;  2K8G A;  5KFA A;  2VQF J;  2ZDO A;  4NLG A;  1WUU A;  3DI6 B;  4K59 A;  2X51 A;  2N7C A;  1MRO A;  4UQT A;  2LKZ A;  3VAL A;  3EMT A;  1JLQ B;  4XO0 A;  3SCI E;  2KM8 B;  2M5Y A;  2HBZ B;  4K4Y A;  5KFC A;  5LM7 E;  4QWB A;  2M52 A;  1KN6 A;  1TL3 B;  2DNR A;  3FBB A;  3OTD A;  1TK8 A;  4BWM A;  4HTI A;  5AE1 A;  2BE7 D;  3E01 A;  3SCJ E;  1WD6 A;  3H42 A;  3FZB A;  2BR0 A;  4NLO A;  2C42 A;  2XHC A;  2A18 A;  3NL0 A;  3VAF A;  2JLE A;  2JEF A;  3DM2 A;  2KVQ E;  3C16 A;  3K8W A;  2RHQ B;  3R27 A;  2GW8 A;  4RW9 A;  1D9F A;  5C2C A;  2R2U A;  2R3V A;  3KJV B;  1OY8 A;  3ILJ A;  4NX9 A;  1TP7 A;  4ZVQ B;  3TZW A;  4UT4 A;  1IKW B;  4ED2 A;  3FUY A;  3PM9 A;  2B4V A;  2YKN A;  2IVF B;  3DMJ A;  3RGI A;  4JI5 J;  2W2P P;  2M88 A;  5KFD A;  3AH6 A;  3MCM A;  1P1T A;  4HHH A;  2C3P A;  2XO7 A;  3BQ2 A;  2RDJ A;  1RJJ A;  2I8E A;  4RWX A;  1Q8K A;  3QFH A;  2N4C A;  2VG6 A;  2CPE A;  4PAB A;  1IBL J;  4I0W A;  5KFJ A;  3M8P B;  1S6Q A;  1EZZ B;  2HQF A;  3RB4 A;  4DR6 J;  3BZQ A;  4XTT A;  1R31 A;  4DWI A;  1RUS A;  2BKN A;  2BJ3 A;  3AB4 B;  4CO4 A;  3AD8 C;  2VQE J;  1L3S A;  2F4F A;  3CCV S;  1YTY A;  3V81 B;  4LVO P;  2XGP A;  3JTO A;  3DRX A;  4DOZ A;  1WC4 A;  1GNK A;  2ASJ A;  3NOG A;  1VC0 A;  5B08 A;  4LF9 F;  4GKJ J;  5KFZ A;  5CZX A;  3HJF A;  4B3M J;  1X4D A;  3OR2 A;  2WZ1 A;  4H4M A;  2ZIT A;  3KUG A;  1XJW B;  4I2Q B;  2AGQ A;  4RJV A;  1QE1 A;  4CLZ A;  4KBI A;  3CPW R;  3C15 B;  1QLN A;  2YKQ A;  3MUV P;  3S01 A;  1NLK L;  2DBB A;  1U2R A;  1TVR A;  2V50 A;  2ZZT A;  1GXL A;  1TKX B;  5ETP A;  3J81 U;  1U6B A;  4Z2X A;  2PT0 A;  5AJ3 F;  3IM8 A;  4LT6 A;  2BV3 A;  3PYE A;  1EET A;  1U1O A;  4HTJ A;  2HMI B;  2DHX A;  1NO8 A;  3QQC D;  4UOH A;  3AA8 A;  4K7Q A;  1S5Z A;  4CLY A;  4HVZ A;  1U45 A;  2FLP A;  1S1T A;  4ZVS B;  1H74 A;  4O44 A;  4C97 A;  3H2V E;  2DIU A;  5KFR A;  2AJF E;  3WQP A;  1ZAV A;  2DPJ A;  1YZ6 A;  4H4O B;  4S0M A;  4JI4 F;  1N0U A;  5IFM A;  4ECQ A;  1Q0N A;  4K4U A;  4OIX A;  3TAN A;  4KY3 A;  4NZ6 A;  3CCW A;  1HD1 A;  2DNO A;  2J6T A;  1Y5N B;  2KKH A;  3T6B A;  5HMZ A;  5GME A;  5K14 A;  4IDK A;  1N32 F;  3OHA A;  1Q8L A;  1HNV B;  4DR7 F;  3RB0 A;  1B3T A;  3GV8 B;  3NNH A;  1Q1K A;  3NP5 A;  2ZOM A;  5G0R A;  3MDF A;  2MZJ A;  1IKX B;  4CP5 A;  4R5P A;  3M2U A;  2RS2 A;  3JYT B;  2BAN A;  5C42 B;  2Y8Y A;  4P73 A;  1JJ2 R;  3BKF A;  2MJN A;  4NA1 A;  3M8S A;  2N3O A;  1LWC A;  1YWX A;  4GVB B;  1RU1 A;  3MMC A;  4G1Q B;  1RT3 A;  2RDD A;  5KT7 A;  3TWZ A;  1T9T A;  1XMB A;  1V3R A;  5B7W A;  1ZBT A;  4YN3 B;  3I82 A;  1DUR A;  3W2W A;  4YB1 P;  3W60 A;  4U7C A;  1Q5V A;  3N79 A;  2I9S A;  1DJ0 A;  5D15 A;  4ICL B;  1G7C B;  3FSX A;  1FJG F;  4ECT A;  2HW3 A;  4U8V A;  1X8D A;  4ZHR A;  3IWL A;  2MQL A;  3VVU A;  1SPB P;  3DCA A;  3ZZZ A;  3ZZT A;  3BR9 A;  2GQ2 A;  1JLC A;  1MU2 B;  2AJ2 A;  2BM1 A;  2J5A A;  2A6M A;  2MLZ A;  1KVJ A;  1MSW D;  2M2B A;  1B7Y B;  2HNY A;  1HPZ B;  4OYZ A;  3KG1 A;  1S48 A;  3UVJ A;  4KB7 A;  2W8K A;  1DLO B;  4YB5 A;  2KXH A;  2OPS A;  4KTQ A;  2KZZ A;  3C66 A;  3X3U A;  1Q7L B;  1WHW A;  3H4D A;  3HD1 A;  1TL4 A;  2MGZ A;  1YBT A;  3GJQ B;  2OH2 A;  1FTC A;  3D6H B;  4DX5 A;  4C0O C;  5D77 A;  3PV8 A;  5D3G A;  2OTL S;  2DO0 A;  3SFG A;  2PMZ D;  2B8Q A;  2JEG A;  3I55 S;  3M05 A;  4FF3 A;  2F5G A;  3KLF B;  3I31 A;  4Q44 A;  4L74 A;  3FJ2 A;  1KEK A;  3CO0 P;  1RWP B;  2IAJ B;  3B8H A;  4WZM A;  4A8S A;  3QMQ A;  4YB6 A;  4JI8 J;  1KQK A;  4Y2M A;  2LQ9 A;  1RAC B;  1SIW B;  4NCG B;  4K4W A;  4LFA J;  5BXI A;  1N6Q A;  1E6V B;  3R6L B;  1N5V A;  3ENW A;  1TV6 A;  2FJD B;  4LF5 J;  1YJ9 S;  3SQG A;  3VAH A;  3DHX A;  4F8R A;  2MB0 B;  1WEY A;  1BLU A;  3KK1 B;  4J9U E;  3PVX A;  2HFU A;  1HBM A;  1KKH A;  1KVI A;  1N36 J;  4ZPA A;  4DL0 C;  1O0P A;  2BUN A;  4USV A;  4C11 A;  3D7S B;  4Z37 A;  2PFF B;  5EX0 A;  1CJK A;  1R6Y A;  5D4O A;  1HNW J;  1SXL A;  2IM2 A;  3ILL A;  1RTD A;  1AA1 B;  3HVT A;  1REG X;  3M32 B;  1KS2 A;  3MCN A;  3E51 A;  2R2R A;  2AIR B;  1Q95 G;  2GJI A;  3MD1 A;  5D0H A;  5B0B A;  1HNX J;  3HM9 A;  3VVT A;  4KGV B;  2XLJ A;  1CBK A;  1UWB B;  5E3C A;  3KLH A;  3DLK B;  3FBF A;  1R89 A;  3MOJ B;  1JB0 C;  3FBC A;  2UZA A;  2EFQ A;  2VIC A;  2DR9 A;  1A7G E;  3IGN A;  4YY3 J;  3HHL C;  1YJR A;  3NAI A;  4E2F B;  2YVS A;  3MHY A;  3ZTP A;  4A8F A;  3DYA A;  2J9E A;  3E2E A;  1B0P A;  2XZW A;  1RIS A;  4DV4 J;  4CNZ A;  4WCE Q;  1YIT S;  5L39 A;  4GKK F;  3T6J A;  4X4V A;  4PQU B;  3M2V A;  4NLX A;  2C3M A;  3GR1 A;  2E1C A;  4PR6 A;  4F3Q A;  5IQQ A;  3ET6 B;  3NGD A;  3KYL A;  1XR7 A;  4ID5 A;  4A46 A;  4NMX A;  5SZT A;  4L3N A;  3UCZ P;  3UW1 A;  1JX4 A;  3C14 B;  3Q86 A;  1UVI A;  3H7H B;  2HVE A;  2GVD A;  4JI2 F;  2GIR A;  3KFW X;  3JAM Y;  4PWD A;  3M8Y A;  4KYZ A;  1QAI A;  4WXW A;  4B3S F;  4OI0 A;  3GSD A;  4RNO A;  2H5E A;  4PEO A;  4U7U D;  1DRZ A;  3TQE A;  5E3R A;  2FJX A;  4TN2 A;  3MI7 X;  1H98 A;  2R7X A;  3QAE A;  3HP6 A;  4YUD A;  4O4G B;  2MST A;  5DGA A;  4X2B A;  3D67 A;  1I5O B;  2EVZ A;  4FBT A;  1FFS B;  2XMJ A;  3J7Z T;  2F63 A;  3K8V A;  3MAA B;  1NSA A;  3JSM A;  2DR5 A;  3DLE B;  4P71 A;  2GGP A;  2IY5 B;  4F02 A;  3I0S A;  1VJW A;  2EFN A;  1R8B A;  5BR8 J;  1ICE B;  3C3L A;  1F3F A;  3PAC A;  1PGZ A;  2W9C B;  2J76 E;  3SFU A;  2JOQ A;  1VRU A;  2NXU A;  4P2M A;  3NRB A;  1D1U A;  4ZLJ A;  5A0Y A;  2MQ8 A;  2COL A;  1JIH A;  1J27 A;  2DHG A;  4DV7 J;  1Q16 B;  1WHV A;  2Q43 A;  4OZN A;  1O6X A;  4ENO A;  2DR7 A;  2DYA A;  4RW6 B;  3CME S;  5ETT A;  2HHX A;  1YQH A;  4JI1 F;  1CC8 A;  3UDV A;  4QWD A;  2UU9 J;  3PEJ A;  1D8Y A;  3V4M A;  2RQ4 A;  2UXC J;  1SI9 A;  2Q79 A;  1FXD A;  2JH3 A;  4FXV A;  3PKY A;  2EPI A;  3ZTR A;  3QSY B;  3A3P B;  2O66 A;  3AAW B;  2DO4 A;  2XNR A;  2DH7 A;  1PYT A;  2BA9 A;  1S9G B;  4IKA A;  4C8N A;  3ETO A;  3L7U A;  1GX5 A;  2XYG B;  4MJK A;  3MTJ A;  1GTH A;  4RWW A;  1C0T B;  4KAI A;  1FRJ A;  4O3P A;  4X62 F;  1Q7Y T;  3AY0 A;  4ITS A;  5L46 A;  4IH7 A;  2DNZ A;  1JLE A;  2BJE A;  3PY8 A;  1DBD A;  2W25 A;  1FDN A;  2ZM6 J;  3G82 B;  1CUL B;  3RRH A;  2R7O A;  3OUY A;  1SJQ A;  2X1F A;  3GIM A;  3MM9 A;  3ISN D;  3OXF A;  4IG0 A;  1H38 A;  2UUA F;  3ZO7 A;  3NBP B;  2V4J A;  2JFK A;  5LMU J;  1HQE A;  2J0W A;  1TEL A;  4N56 A;  4PUO A;  2UUB F;  1J5O A;  2QT7 A;  5HMY A;  1UFW A;  2QL9 B;  4USW A;  2W9B B;  3OR1 A;  2OD6 A;  1BE4 A;  3MED A;  3NOC A;  2HHH F;  3RJM B;  4QW9 A;  5J2P B;  2DD8 S;  1S72 S;  3D1Q A;  1L3U A;  1CJU A;  3PHT A;  1TZ0 A;  3SDE B;  4RUA A;  2ZJP Q;  4M8L A;  1A9N B;  4DPT A;  4DUT A;  4MKA A;  1JKH B;  1XC9 A;  1NKB A;  3I32 A;  2UUC J;  2MZQ A;  1AZS B;  5F8M A;  2B51 A;  4RU2 A;  3V4I A;  3MR6 A;  1T9V A;  1N54 B;  2RB7 A;  1TL7 B;  4M5J A;  3VCD A;  2BDP A;  3OJS A;  5CYJ A;  1RTI B;  3THV A;  1U4B A;  4AFF A;  3IM9 A;  2LCW A;  3VAM A;  1YJU A;  5DDR C;  3CCT A;  1SL0 A;  4U8Y A;  5KG1 A;  3IS9 B;  5I3U B;  2LXF A;  3WC0 A;  5MAO A;  2CNL B;  2YKP A;  4P2X A;  2QO3 A;  5GAD I;  3R5A A;  4AD6 A;  3FEZ A;  3N01 A;  2CNK B;  2FB0 A;  4CDI A;  5DZ6 A;  4NRT A;  2C28 A;  1NHU A;  1F9H A;  2ZBR A;  2V4Q A;  3QAT A;  3QIP A;  3FMB A;  1TL1 B;  3PW4 A;  2QLJ B;  1D09 B;  1AW0 A;  4ED5 A;  2AYE A;  1GXT A;  3EGZ A;  4WII A;  2VOP A;  3HSJ A;  4YP3 A;  2BXJ A;  4J7C A;  2IIH A;  2IPO B;  4OMF G;  1OYE A;  4JBC A;  4A8K A;  5L38 A;  4RUC A;  2ZUA A;  4N47 A;  1OMS A;  2MQP A;  4LUB A;  1FJE B;  2HHQ A;  5CYQ A;  2E1M C;  5K8M A;  3W65 A;  1QVG R;  3BH6 B;  4RUB A;  3D4J A;  4K0K F;  1RTJ B;  3ZNJ 1;  1FRI A;  4X64 F;  3IG1 B;  2FYX A;  4CLU A;  3DRP B;  3RB6 A;  1W7W A;  2YKM A;  1T94 A;  2Y1J A;  1FWL A;  3TAM B;  1BUX A;  4C98 A;  2FHJ D;  2LQ5 A;  5CYM A;  5L9N A;  2UVR A;  3LH2 S;  1MWY A;  3G8Q A;  1VIO A;  3L4B C;  3LGH A;  2IMW P;  3HZE A;  3IC1 A;  1G3O A;  3OVS A;  3QNW B;  5DQI A;  5HAO A;  3BSO A;  1S0V A;  4UF4 A;  3W66 A;  2HLT A;  2WOM B;  3HJV A;  2OSR A;  2G0I A;  3CDW A;  2ASY A;  2NSB A;  4UTG A;  4X4S A;  1QM9 A;  3SYZ A;  1CQM A;  5DZ7 A;  2RQC A;  3T41 A;  2FLN A;  4W98 A;  1FKP B;  2H3E B;  2QX0 A;  3EGV A;  2GMH A;  4ZVR B;  1NJX A;  1X9S A;  2MZT A;  2ZJQ Q;  3H2U B;  2BAB A;  4OYP A;  3EVO A;  3DDN A;  4LF8 F;  3P5B P;  3SV4 A;  2UVU A;  2OPP A;  1U0H A;  1FKA F;  2OIH A;  3G6E S;  5L1L A;  2YKO A;  2CNN B;  5IWA J;  1K1Q A;  2DIT A;  1QD1 A;  1DQ8 A;  4ZPC A;  3CD5 A;  1BD6 A;  2HSE B;  3I5C A;  1X4F A;  5B0A A;  2KJV A;  3A8J A;  2XC9 A;  4U67 Q;  4I67 A;  5HLF A;  3KK3 B;  4L73 A;  2XMV A;  3IO1 A;  3EM1 A;  4H54 A;  4DQR A;  2R8H A;  2WVD A;  3GLJ A;  1FRH A;  1VBX A;  1RWO B;  1NHV A;  1Y0H A;  2HS3 A;  3G87 A;  4OHY A;  2R7W A;  1RWW B;  2RML A;  3LOU A;  3TO8 A;  4DR2 J;  1K73 T;  1WI8 A;  4PYA A;  2RE1 A;  2KG0 A;  3JQM A;  2JLG A;  2HHV A;  2HS0 A;  4C2M A;  1LEO A;  1EB0 A;  3MEG A;  2ACY A;  1JXE A;  5HVH A;  1MW7 A;  1S1V B;  1S6P A;  3W1Y C;  4DV1 F;  3D1O A;  2VQF F;  4LRB A;  4DCJ B;  2HVD A;  2VIH A;  4USI A;  2YNG A;  1VLY A;  4B9V A;  1MML A;  1X4H A;  3QID A;  1FNO A;  3RR8 A;  1SKR A;  4PZV A;  2FPH X;  3BB5 A;  2CPI A;  3OFF A;  3HHE A;  3CCR S;  1GFW B;  4DR3 J;  2FC8 A;  2IJF A;  4CIO A;  1HI8 A;  1RYS A;  2L08 A;  5A8W A;  4MKB A;  2NQP A;  4P74 A;  5J2N B;  5KFQ A;  2YH0 A;  2NXC A;  2P6S A;  2X7I A;  2V69 A;  2E29 A;  3DLG B;  4L3K A;  3M9M B;  2ZD1 A;  2D3O 1;  2RKI B;  3OL7 A;  4ECY A;  5H9E K;  2IRX A;  3A13 A;  4ZPW R;  2QG9 B;  2LP4 A;  2ZBP A;  4RUH A;  2IRU A;  3UD4 P;  3TW0 A;  1N48 A;  5HMX A;  1NK4 A;  4PG5 A;  1FTR A;  4RW7 B;  1O8B A;  3Q8R B;  3IBC B;  2AEM A;  2VOD A;  2UV8 G;  5A8K A;  1N0V C;  3HHL B;  1KTV A;  1EP4 A;  1ULR A;  1IR0 A;  4JI5 F;  1HQ2 A;  3D54 A;  2OLW A;  2ZH7 A;  2EFV A;  4ZOS A;  1S12 A;  1UVK A;  1O51 A;  3WC2 A;  4ZDN A;  4QCL A;  5T41 A;  1Z1Z A;  1CSJ A;  4ECR A;  2GVZ A;  4J9Q A;  1F2H A;  2B6A B;  2ZKT A;  2KDO A;  2IM1 A;  4X4T A;  4LRE A;  4B9U A;  4OX7 A;  4PPZ A;  2LQJ A;  3M2R A;  5HQM A;  1IBL F;  2I6W A;  1RBL A;  2CQP A;  5CD4 A;  2GHP A;  4DR6 F;  3A8K A;  1KD1 T;  3FFI A;  3ZFV A;  4I7F A;  1WOO A;  3UR3 C;  1R0A B;  3N6N A;  3HSD A;  3VAI A;  2VQE F;  1XNR J;  2GA7 A;  2H4Y B;  5DG9 A;  2LEP A;  2HG4 A;  1YG0 A;  3BN7 A;  3MMB B;  4GKJ F;  3EYZ A;  2H5J B;  3MM8 A;  2DNQ A;  4Q0B A;  4G65 A;  4B3M F;  4CH0 S;  4ZN1 A;  4X4P A;  2QFI A;  4AL5 A;  4HT5 A;  3JSY A;  2Y1I A;  4WFZ A;  3BGR B;  2VZ9 A;  5C2G A;  1J5E J;  2MSS A;  4W90 B;  2HHT A;  5F41 A;  5HN0 A;  1U25 A;  1WSV A;  3C6T B;  1YBU A;  5KFY A;  4LSN B;  5FII A;  2B9W A;  4Y2I A;  2WTF A;  3LGN A;  2E9Z A;  4RW8 B;  5I4M A;  1ZM9 A;  2V94 A;  2PDA A;  5D0R A;  4MYT A;  4HI1 A;  3M9N B;  2LEB A;  2VFV A;  4DV2 J;  1AXQ A;  5E7O B;  2CQ3 A;  2Z57 B;  3BGL A;  4O3S A;  4DL5 A;  1M5S A;  3K5M A;  5A6W A;  4Y3C A;  1FDD A;  3J80 Y;  1UW4 A;  2VFR A;  3TUI C;  4HL9 A;  3AJ1 A;  1YJW S;  3TEH B;  4EGL A;  3LAN A;  4C8O A;  4OZ2 A;  3RW7 A;  2O67 A;  3HCX A;  3V6D B;  4I2P A;  3RAX A;  4ZMM A;  3AOC A;  1RAO A;  2JJ4 D;  1HYS A;  3R5G A;  1UVJ A;  3H59 A;  4UY8 5;  2VU5 A;  2HPU A;  4J9M A;  1VQ9 S;  2JX2 A;  2FJA B;  1S9E A;  3UNY A;  4RZR A;  3EUN A;  3RYL A;  2OSQ A;  1IKY B;  4PAA A;  3UQS A;  3TRG A;  1VLO A;  2E5H A;  1KNZ A;  4LRA A;  4E98 A;  3KG4 A;  3GJT B;  3M8Q B;  1BWE A;  1C4A A;  3K5N A;  1UJ6 A;  3U02 A;  2J7U A;  4ECW A;  1UJ5 A;  3TP2 A;  3T5J A;  2HFV A;  4QIE A;  1KFS A;  3C6U B;  3N28 A;  1RAA B;  5KT2 A;  4U6P A;  1SH2 A;  4DPX A;  2DIV A;  4CLK A;  1Y3J A;  1REV A;  2GS8 A;  1WOS A;  1RU2 A;  2OEJ A;  1EQM A;  3BQ1 A;  1DTQ A;  5HRO B;  2F3J A;  1WF0 A;  3MD3 A;  4Y28 C;  1XNQ J;  3AB2 B;  4F2S A;  2UUW A;  5KAK A;  2LEC A;  3TR5 A;  3PW5 A;  2BJD A;  1AB8 A;  1YRU A;  4KH0 B;  3PW0 A;  2WK4 A;  1QUV A;  1R8H A;  1RWK B;  3HHD A; 
#chains in the Genus database with same CATH homology
 3H90 A;  2QFI A;  3W8G A;  3W63 A;  3W5X A;  3W62 A;  3W64 A;  3W60 A;  3W65 A;  3BYP A;  3W8P A;  3W5Y A;  3W61 A;  3W66 A;  2ZZT A;  5HSP A;  3BYR A;  3W5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...