2AGLD

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2aglD00
3SWSC 3L4OC 3SVWC 2OJYD 3PXTC 4L1QC 2HKRD 4L3HC 4FB1C 4FAVC 2AGYD 1MDAL 3ORVC 4FA5C 2OK6D 3SLEC 2IAAB 2J57K 2MADL 3RLMC 4FA9C 1MAEL 2GC4B 3PXWC 2AGZD 2AGXD 2AH1D 2OK4D 2AGLD 2H3XB 3RMZC 3C75L 2AH0D 2BBKL 3RN0C 3SXTC 2IURD 2IUVD 2H47B 2HJBD 2MTAL 2GC7B 4FA1C 4L3GC 2AGWD 2IUQD 2IUPD 4O1QC 4K3IC 1MG3B 4Y5RC 2HXCD 3RN1C 4FANC 2I0TD 2J56L 3PXSC 3SJLC 2HJ4D 3L4MC 2OIZD 1MAFL 2I0RD 2HKMD 4FA4C 2I0SD 2Q7QD 1MG2B 2J55L
chains in the Genus database with same CATH superfamily
3SWSC 3L4OC 3SVWC 2OJYD 3PXTC 4L1QC 2HKRD 4L3HC 4FB1C 4FAVC 2AGYD 1MDAL 3ORVC 4FA5C 2OK6D 3SLEC 2IAAB 2J57K 2MADL 3RLMC 4FA9C 1MAEL 2GC4B 3PXWC 2AGZD 2AGXD 2AH1D 2OK4D 2AGLD 2H3XB 3RMZC 3C75L 2AH0D 2BBKL 3RN0C 3SXTC 2IURD 2IUVD 2H47B 2HJBD 2MTAL 2GC7B 4FA1C 4L3GC 2AGWD 2IUQD 2IUPD 4O1QC 4K3IC 1MG3B 4Y5RC 2HXCD 3RN1C 4FANC 2I0TD 2J56L 3PXSC 3SJLC 2HJ4D 3L4MC 2OIZD 1MAFL 2I0RD 2HKMD 4FA4C 2I0SD 2Q7QD 1MG2B 2J55L
chains in the Genus database with same CATH topology
3SWSC 3L4OC 3SVWC 2OJYD 3PXTC 4L1QC 2HKRD 4L3HC 4FB1C 4FAVC 2AGYD 1MDAL 3ORVC 4FA5C 2OK6D 3SLEC 2IAAB 2J57K 2MADL 3RLMC 4FA9C 1MAEL 2GC4B 3PXWC 2AGZD 2AGXD 2AH1D 2OK4D 2AGLD 2H3XB 3RMZC 3C75L 2AH0D 2BBKL 3RN0C 3SXTC 2IURD 2IUVD 2H47B 2HJBD 2MTAL 2GC7B 4FA1C 4L3GC 2AGWD 2IUQD 2IUPD 4O1QC 4K3IC 1MG3B 4Y5RC 2HXCD 3RN1C 4FANC 2I0TD 2J56L 3PXSC 3SJLC 2HJ4D 3L4MC 2OIZD 1MAFL 2I0RD 2HKMD 4FA4C 2I0SD 2Q7QD 1MG2B 2J55L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS C;  3L4O C;  3SVW C;  2OJY D;  3PXT C;  4L1Q C;  2HKR D;  4L3H C;  4FB1 C;  4FAV C;  2AGY D;  1MDA L;  3ORV C;  4FA5 C;  2OK6 D;  3SLE C;  2IAA B;  2J57 K;  2MAD L;  3RLM C;  4FA9 C;  1MAE L;  2GC4 B;  3PXW C;  2AGZ D;  2AGX D;  2AH1 D;  2OK4 D;  2AGL D;  2H3X B;  3RMZ C;  3C75 L;  2AH0 D;  2BBK L;  3RN0 C;  3SXT C;  2IUR D;  2IUV D;  2H47 B;  2HJB D;  2MTA L;  2GC7 B;  4FA1 C;  4L3G C;  2AGW D;  2IUQ D;  2IUP D;  4O1Q C;  4K3I C;  1MG3 B;  4Y5R C;  2HXC D;  3RN1 C;  4FAN C;  2I0T D;  2J56 L;  3PXS C;  3SJL C;  2HJ4 D;  3L4M C;  2OIZ D;  1MAF L;  2I0R D;  2HKM D;  4FA4 C;  2I0S D;  2Q7Q D;  1MG2 B;  2J55 L; 
#chains in the Genus database with same CATH topology
 3SWS C;  3L4O C;  3SVW C;  2OJY D;  3PXT C;  4L1Q C;  2HKR D;  4L3H C;  4FB1 C;  4FAV C;  2AGY D;  1MDA L;  3ORV C;  4FA5 C;  2OK6 D;  3SLE C;  2IAA B;  2J57 K;  2MAD L;  3RLM C;  4FA9 C;  1MAE L;  2GC4 B;  3PXW C;  2AGZ D;  2AGX D;  2AH1 D;  2OK4 D;  2AGL D;  2H3X B;  3RMZ C;  3C75 L;  2AH0 D;  2BBK L;  3RN0 C;  3SXT C;  2IUR D;  2IUV D;  2H47 B;  2HJB D;  2MTA L;  2GC7 B;  4FA1 C;  4L3G C;  2AGW D;  2IUQ D;  2IUP D;  4O1Q C;  4K3I C;  1MG3 B;  4Y5R C;  2HXC D;  3RN1 C;  4FAN C;  2I0T D;  2J56 L;  3PXS C;  3SJL C;  2HJ4 D;  3L4M C;  2OIZ D;  1MAF L;  2I0R D;  2HKM D;  4FA4 C;  2I0S D;  2Q7Q D;  1MG2 B;  2J55 L; 
#chains in the Genus database with same CATH homology
 3SWS C;  3L4O C;  3SVW C;  2OJY D;  3PXT C;  4L1Q C;  2HKR D;  4L3H C;  4FB1 C;  4FAV C;  2AGY D;  1MDA L;  3ORV C;  4FA5 C;  2OK6 D;  3SLE C;  2IAA B;  2J57 K;  2MAD L;  3RLM C;  4FA9 C;  1MAE L;  2GC4 B;  3PXW C;  2AGZ D;  2AGX D;  2AH1 D;  2OK4 D;  2AGL D;  2H3X B;  3RMZ C;  3C75 L;  2AH0 D;  2BBK L;  3RN0 C;  3SXT C;  2IUR D;  2IUV D;  2H47 B;  2HJB D;  2MTA L;  2GC7 B;  4FA1 C;  4L3G C;  2AGW D;  2IUQ D;  2IUP D;  4O1Q C;  4K3I C;  1MG3 B;  4Y5R C;  2HXC D;  3RN1 C;  4FAN C;  2I0T D;  2J56 L;  3PXS C;  3SJL C;  2HJ4 D;  3L4M C;  2OIZ D;  1MAF L;  2I0R D;  2HKM D;  4FA4 C;  2I0S D;  2Q7Q D;  1MG2 B;  2J55 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...