2AGYD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agyD00
3PXSC 4L3GC 3RN0C 1MDAL 2AH0D 3PXWC 3SXTC 3L4OC 2I0SD 3C75L 2IUVD 4O1QC 2OK4D 1MAFL 2AH1D 2H47B 2IUPD 2MTAL 2Q7QD 3SLEC 2HXCD 2AGXD 2GC4B 2OJYD 3L4MC 3RLMC 2HJ4D 3SWSC 3RN1C 4L3HC 4FA1C 4FANC 4FAVC 1MG2B 2AGYD 2H3XB 3PXTC 2AGZD 2IURD 1MAEL 2J57K 4Y5RC 4K3IC 2GC7B 4FB1C 2IAAB 2IUQD 3SJLC 3SVWC 2AGWD 4L1QC 4FA9C 2I0TD 2AGLD 2OK6D 2HKMD 2I0RD 2MADL 3ORVC 4FA4C 2OIZD 2HKRD 2J56L 4FA5C 2BBKL 1MG3B 2J55L 2HJBD 3RMZC
chains in the Genus database with same CATH superfamily
3PXSC 4L3GC 3RN0C 1MDAL 2AH0D 3PXWC 3SXTC 3L4OC 2I0SD 3C75L 2IUVD 4O1QC 2OK4D 1MAFL 2AH1D 2H47B 2IUPD 2MTAL 2Q7QD 3SLEC 2HXCD 2AGXD 2GC4B 2OJYD 3L4MC 3RLMC 2HJ4D 3SWSC 3RN1C 4L3HC 4FA1C 4FANC 4FAVC 1MG2B 2AGYD 2H3XB 3PXTC 2AGZD 2IURD 1MAEL 2J57K 4Y5RC 4K3IC 2GC7B 4FB1C 2IAAB 2IUQD 3SJLC 3SVWC 2AGWD 4L1QC 4FA9C 2I0TD 2AGLD 2OK6D 2HKMD 2I0RD 2MADL 3ORVC 4FA4C 2OIZD 2HKRD 2J56L 4FA5C 2BBKL 1MG3B 2J55L 2HJBD 3RMZC
chains in the Genus database with same CATH topology
3PXSC 4L3GC 3RN0C 1MDAL 2AH0D 3PXWC 3SXTC 3L4OC 2I0SD 3C75L 2IUVD 4O1QC 2OK4D 1MAFL 2AH1D 2H47B 2IUPD 2MTAL 2Q7QD 3SLEC 2HXCD 2AGXD 2GC4B 2OJYD 3L4MC 3RLMC 2HJ4D 3SWSC 3RN1C 4L3HC 4FA1C 4FANC 4FAVC 1MG2B 2AGYD 2H3XB 3PXTC 2AGZD 2IURD 1MAEL 2J57K 4Y5RC 4K3IC 2GC7B 4FB1C 2IAAB 2IUQD 3SJLC 3SVWC 2AGWD 4L1QC 4FA9C 2I0TD 2AGLD 2OK6D 2HKMD 2I0RD 2MADL 3ORVC 4FA4C 2OIZD 2HKRD 2J56L 4FA5C 2BBKL 1MG3B 2J55L 2HJBD 3RMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS C;  4L3G C;  3RN0 C;  1MDA L;  2AH0 D;  3PXW C;  3SXT C;  3L4O C;  2I0S D;  3C75 L;  2IUV D;  4O1Q C;  2OK4 D;  1MAF L;  2AH1 D;  2H47 B;  2IUP D;  2MTA L;  2Q7Q D;  3SLE C;  2HXC D;  2AGX D;  2GC4 B;  2OJY D;  3L4M C;  3RLM C;  2HJ4 D;  3SWS C;  3RN1 C;  4L3H C;  4FA1 C;  4FAN C;  4FAV C;  1MG2 B;  2AGY D;  2H3X B;  3PXT C;  2AGZ D;  2IUR D;  1MAE L;  2J57 K;  4Y5R C;  4K3I C;  2GC7 B;  4FB1 C;  2IAA B;  2IUQ D;  3SJL C;  3SVW C;  2AGW D;  4L1Q C;  4FA9 C;  2I0T D;  2AGL D;  2OK6 D;  2HKM D;  2I0R D;  2MAD L;  3ORV C;  4FA4 C;  2OIZ D;  2HKR D;  2J56 L;  4FA5 C;  2BBK L;  1MG3 B;  2J55 L;  2HJB D;  3RMZ C; 
#chains in the Genus database with same CATH topology
 3PXS C;  4L3G C;  3RN0 C;  1MDA L;  2AH0 D;  3PXW C;  3SXT C;  3L4O C;  2I0S D;  3C75 L;  2IUV D;  4O1Q C;  2OK4 D;  1MAF L;  2AH1 D;  2H47 B;  2IUP D;  2MTA L;  2Q7Q D;  3SLE C;  2HXC D;  2AGX D;  2GC4 B;  2OJY D;  3L4M C;  3RLM C;  2HJ4 D;  3SWS C;  3RN1 C;  4L3H C;  4FA1 C;  4FAN C;  4FAV C;  1MG2 B;  2AGY D;  2H3X B;  3PXT C;  2AGZ D;  2IUR D;  1MAE L;  2J57 K;  4Y5R C;  4K3I C;  2GC7 B;  4FB1 C;  2IAA B;  2IUQ D;  3SJL C;  3SVW C;  2AGW D;  4L1Q C;  4FA9 C;  2I0T D;  2AGL D;  2OK6 D;  2HKM D;  2I0R D;  2MAD L;  3ORV C;  4FA4 C;  2OIZ D;  2HKR D;  2J56 L;  4FA5 C;  2BBK L;  1MG3 B;  2J55 L;  2HJB D;  3RMZ C; 
#chains in the Genus database with same CATH homology
 3PXS C;  4L3G C;  3RN0 C;  1MDA L;  2AH0 D;  3PXW C;  3SXT C;  3L4O C;  2I0S D;  3C75 L;  2IUV D;  4O1Q C;  2OK4 D;  1MAF L;  2AH1 D;  2H47 B;  2IUP D;  2MTA L;  2Q7Q D;  3SLE C;  2HXC D;  2AGX D;  2GC4 B;  2OJY D;  3L4M C;  3RLM C;  2HJ4 D;  3SWS C;  3RN1 C;  4L3H C;  4FA1 C;  4FAN C;  4FAV C;  1MG2 B;  2AGY D;  2H3X B;  3PXT C;  2AGZ D;  2IUR D;  1MAE L;  2J57 K;  4Y5R C;  4K3I C;  2GC7 B;  4FB1 C;  2IAA B;  2IUQ D;  3SJL C;  3SVW C;  2AGW D;  4L1Q C;  4FA9 C;  2I0T D;  2AGL D;  2OK6 D;  2HKM D;  2I0R D;  2MAD L;  3ORV C;  4FA4 C;  2OIZ D;  2HKR D;  2J56 L;  4FA5 C;  2BBK L;  1MG3 B;  2J55 L;  2HJB D;  3RMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...