2AGYD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agyD00
2I0RD 2AGXD 2HJ4D 1MAEL 2OK4D 4O1QC 3RLMC 3RMZC 4FANC 4FA5C 2AGYD 4FA4C 3RN1C 2GC7B 4FA9C 1MAFL 2OK6D 2AGLD 2AH1D 3ORVC 3PXWC 3SVWC 2Q7QD 4Y5RC 1MG2B 1MG3B 2IUQD 4FAVC 4K3IC 4FA1C 4FB1C 2BBKL 2OJYD 2MTAL 2HKMD 2IURD 2OIZD 3PXTC 3C75L 2IUVD 3RN0C 4L1QC 1MDAL 4L3HC 2H47B 2MADL 2GC4B 2AGWD 2IUPD 3SWSC 3SLEC 2J56L 2I0SD 2AH0D 3L4OC 2I0TD 2IAAB 2HXCD 2J55L 3L4MC 3SXTC 2HKRD 3PXSC 2J57K 3SJLC 4L3GC 2AGZD 2HJBD 2H3XB
chains in the Genus database with same CATH superfamily
2I0RD 2AGXD 2HJ4D 1MAEL 2OK4D 4O1QC 3RLMC 3RMZC 4FANC 4FA5C 2AGYD 4FA4C 3RN1C 2GC7B 4FA9C 1MAFL 2OK6D 2AGLD 2AH1D 3ORVC 3PXWC 3SVWC 2Q7QD 4Y5RC 1MG2B 1MG3B 2IUQD 4FAVC 4K3IC 4FA1C 4FB1C 2BBKL 2OJYD 2MTAL 2HKMD 2IURD 2OIZD 3PXTC 3C75L 2IUVD 3RN0C 4L1QC 1MDAL 4L3HC 2H47B 2MADL 2GC4B 2AGWD 2IUPD 3SWSC 3SLEC 2J56L 2I0SD 2AH0D 3L4OC 2I0TD 2IAAB 2HXCD 2J55L 3L4MC 3SXTC 2HKRD 3PXSC 2J57K 3SJLC 4L3GC 2AGZD 2HJBD 2H3XB
chains in the Genus database with same CATH topology
2I0RD 2AGXD 2HJ4D 1MAEL 2OK4D 4O1QC 3RLMC 3RMZC 4FANC 4FA5C 2AGYD 4FA4C 3RN1C 2GC7B 4FA9C 1MAFL 2OK6D 2AGLD 2AH1D 3ORVC 3PXWC 3SVWC 2Q7QD 4Y5RC 1MG2B 1MG3B 2IUQD 4FAVC 4K3IC 4FA1C 4FB1C 2BBKL 2OJYD 2MTAL 2HKMD 2IURD 2OIZD 3PXTC 3C75L 2IUVD 3RN0C 4L1QC 1MDAL 4L3HC 2H47B 2MADL 2GC4B 2AGWD 2IUPD 3SWSC 3SLEC 2J56L 2I0SD 2AH0D 3L4OC 2I0TD 2IAAB 2HXCD 2J55L 3L4MC 3SXTC 2HKRD 3PXSC 2J57K 3SJLC 4L3GC 2AGZD 2HJBD 2H3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0R D;  2AGX D;  2HJ4 D;  1MAE L;  2OK4 D;  4O1Q C;  3RLM C;  3RMZ C;  4FAN C;  4FA5 C;  2AGY D;  4FA4 C;  3RN1 C;  2GC7 B;  4FA9 C;  1MAF L;  2OK6 D;  2AGL D;  2AH1 D;  3ORV C;  3PXW C;  3SVW C;  2Q7Q D;  4Y5R C;  1MG2 B;  1MG3 B;  2IUQ D;  4FAV C;  4K3I C;  4FA1 C;  4FB1 C;  2BBK L;  2OJY D;  2MTA L;  2HKM D;  2IUR D;  2OIZ D;  3PXT C;  3C75 L;  2IUV D;  3RN0 C;  4L1Q C;  1MDA L;  4L3H C;  2H47 B;  2MAD L;  2GC4 B;  2AGW D;  2IUP D;  3SWS C;  3SLE C;  2J56 L;  2I0S D;  2AH0 D;  3L4O C;  2I0T D;  2IAA B;  2HXC D;  2J55 L;  3L4M C;  3SXT C;  2HKR D;  3PXS C;  2J57 K;  3SJL C;  4L3G C;  2AGZ D;  2HJB D;  2H3X B; 
#chains in the Genus database with same CATH topology
 2I0R D;  2AGX D;  2HJ4 D;  1MAE L;  2OK4 D;  4O1Q C;  3RLM C;  3RMZ C;  4FAN C;  4FA5 C;  2AGY D;  4FA4 C;  3RN1 C;  2GC7 B;  4FA9 C;  1MAF L;  2OK6 D;  2AGL D;  2AH1 D;  3ORV C;  3PXW C;  3SVW C;  2Q7Q D;  4Y5R C;  1MG2 B;  1MG3 B;  2IUQ D;  4FAV C;  4K3I C;  4FA1 C;  4FB1 C;  2BBK L;  2OJY D;  2MTA L;  2HKM D;  2IUR D;  2OIZ D;  3PXT C;  3C75 L;  2IUV D;  3RN0 C;  4L1Q C;  1MDA L;  4L3H C;  2H47 B;  2MAD L;  2GC4 B;  2AGW D;  2IUP D;  3SWS C;  3SLE C;  2J56 L;  2I0S D;  2AH0 D;  3L4O C;  2I0T D;  2IAA B;  2HXC D;  2J55 L;  3L4M C;  3SXT C;  2HKR D;  3PXS C;  2J57 K;  3SJL C;  4L3G C;  2AGZ D;  2HJB D;  2H3X B; 
#chains in the Genus database with same CATH homology
 2I0R D;  2AGX D;  2HJ4 D;  1MAE L;  2OK4 D;  4O1Q C;  3RLM C;  3RMZ C;  4FAN C;  4FA5 C;  2AGY D;  4FA4 C;  3RN1 C;  2GC7 B;  4FA9 C;  1MAF L;  2OK6 D;  2AGL D;  2AH1 D;  3ORV C;  3PXW C;  3SVW C;  2Q7Q D;  4Y5R C;  1MG2 B;  1MG3 B;  2IUQ D;  4FAV C;  4K3I C;  4FA1 C;  4FB1 C;  2BBK L;  2OJY D;  2MTA L;  2HKM D;  2IUR D;  2OIZ D;  3PXT C;  3C75 L;  2IUV D;  3RN0 C;  4L1Q C;  1MDA L;  4L3H C;  2H47 B;  2MAD L;  2GC4 B;  2AGW D;  2IUP D;  3SWS C;  3SLE C;  2J56 L;  2I0S D;  2AH0 D;  3L4O C;  2I0T D;  2IAA B;  2HXC D;  2J55 L;  3L4M C;  3SXT C;  2HKR D;  3PXS C;  2J57 K;  3SJL C;  4L3G C;  2AGZ D;  2HJB D;  2H3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...