2AH0D

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ah0D00
2HKMD 2IUQD 3SXTC 1MAEL 2OJYD 3L4OC 3PXTC 2AH1D 2IUPD 4L3HC 3SVWC 2IURD 1MAFL 2AGYD 2GC4B 2MTAL 2I0SD 3RMZC 2H47B 2MADL 3L4MC 2AGZD 3RN0C 4FA4C 4FB1C 2I0RD 2OIZD 3SLEC 4FA9C 3PXSC 3PXWC 2AGWD 2Q7QD 4L3GC 2AGLD 2IAAB 1MG2B 2HJBD 1MG3B 2AGXD 2J57K 2HJ4D 2OK4D 2HKRD 4L1QC 2H3XB 4FAVC 2GC7B 3SJLC 3SWSC 3C75L 4FA5C 2J56L 4Y5RC 1MDAL 2OK6D 2HXCD 4K3IC 4O1QC 4FA1C 2J55L 3ORVC 2IUVD 3RN1C 4FANC 3RLMC 2BBKL 2I0TD 2AH0D
chains in the Genus database with same CATH superfamily
2HKMD 2IUQD 3SXTC 1MAEL 2OJYD 3L4OC 3PXTC 2AH1D 2IUPD 4L3HC 3SVWC 2IURD 1MAFL 2AGYD 2GC4B 2MTAL 2I0SD 3RMZC 2H47B 2MADL 3L4MC 2AGZD 3RN0C 4FA4C 4FB1C 2I0RD 2OIZD 3SLEC 4FA9C 3PXSC 3PXWC 2AGWD 2Q7QD 4L3GC 2AGLD 2IAAB 1MG2B 2HJBD 1MG3B 2AGXD 2J57K 2HJ4D 2OK4D 2HKRD 4L1QC 2H3XB 4FAVC 2GC7B 3SJLC 3SWSC 3C75L 4FA5C 2J56L 4Y5RC 1MDAL 2OK6D 2HXCD 4K3IC 4O1QC 4FA1C 2J55L 3ORVC 2IUVD 3RN1C 4FANC 3RLMC 2BBKL 2I0TD 2AH0D
chains in the Genus database with same CATH topology
2HKMD 2IUQD 3SXTC 1MAEL 2OJYD 3L4OC 3PXTC 2AH1D 2IUPD 4L3HC 3SVWC 2IURD 1MAFL 2AGYD 2GC4B 2MTAL 2I0SD 3RMZC 2H47B 2MADL 3L4MC 2AGZD 3RN0C 4FA4C 4FB1C 2I0RD 2OIZD 3SLEC 4FA9C 3PXSC 3PXWC 2AGWD 2Q7QD 4L3GC 2AGLD 2IAAB 1MG2B 2HJBD 1MG3B 2AGXD 2J57K 2HJ4D 2OK4D 2HKRD 4L1QC 2H3XB 4FAVC 2GC7B 3SJLC 3SWSC 3C75L 4FA5C 2J56L 4Y5RC 1MDAL 2OK6D 2HXCD 4K3IC 4O1QC 4FA1C 2J55L 3ORVC 2IUVD 3RN1C 4FANC 3RLMC 2BBKL 2I0TD 2AH0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKM D;  2IUQ D;  3SXT C;  1MAE L;  2OJY D;  3L4O C;  3PXT C;  2AH1 D;  2IUP D;  4L3H C;  3SVW C;  2IUR D;  1MAF L;  2AGY D;  2GC4 B;  2MTA L;  2I0S D;  3RMZ C;  2H47 B;  2MAD L;  3L4M C;  2AGZ D;  3RN0 C;  4FA4 C;  4FB1 C;  2I0R D;  2OIZ D;  3SLE C;  4FA9 C;  3PXS C;  3PXW C;  2AGW D;  2Q7Q D;  4L3G C;  2AGL D;  2IAA B;  1MG2 B;  2HJB D;  1MG3 B;  2AGX D;  2J57 K;  2HJ4 D;  2OK4 D;  2HKR D;  4L1Q C;  2H3X B;  4FAV C;  2GC7 B;  3SJL C;  3SWS C;  3C75 L;  4FA5 C;  2J56 L;  4Y5R C;  1MDA L;  2OK6 D;  2HXC D;  4K3I C;  4O1Q C;  4FA1 C;  2J55 L;  3ORV C;  2IUV D;  3RN1 C;  4FAN C;  3RLM C;  2BBK L;  2I0T D;  2AH0 D; 
#chains in the Genus database with same CATH topology
 2HKM D;  2IUQ D;  3SXT C;  1MAE L;  2OJY D;  3L4O C;  3PXT C;  2AH1 D;  2IUP D;  4L3H C;  3SVW C;  2IUR D;  1MAF L;  2AGY D;  2GC4 B;  2MTA L;  2I0S D;  3RMZ C;  2H47 B;  2MAD L;  3L4M C;  2AGZ D;  3RN0 C;  4FA4 C;  4FB1 C;  2I0R D;  2OIZ D;  3SLE C;  4FA9 C;  3PXS C;  3PXW C;  2AGW D;  2Q7Q D;  4L3G C;  2AGL D;  2IAA B;  1MG2 B;  2HJB D;  1MG3 B;  2AGX D;  2J57 K;  2HJ4 D;  2OK4 D;  2HKR D;  4L1Q C;  2H3X B;  4FAV C;  2GC7 B;  3SJL C;  3SWS C;  3C75 L;  4FA5 C;  2J56 L;  4Y5R C;  1MDA L;  2OK6 D;  2HXC D;  4K3I C;  4O1Q C;  4FA1 C;  2J55 L;  3ORV C;  2IUV D;  3RN1 C;  4FAN C;  3RLM C;  2BBK L;  2I0T D;  2AH0 D; 
#chains in the Genus database with same CATH homology
 2HKM D;  2IUQ D;  3SXT C;  1MAE L;  2OJY D;  3L4O C;  3PXT C;  2AH1 D;  2IUP D;  4L3H C;  3SVW C;  2IUR D;  1MAF L;  2AGY D;  2GC4 B;  2MTA L;  2I0S D;  3RMZ C;  2H47 B;  2MAD L;  3L4M C;  2AGZ D;  3RN0 C;  4FA4 C;  4FB1 C;  2I0R D;  2OIZ D;  3SLE C;  4FA9 C;  3PXS C;  3PXW C;  2AGW D;  2Q7Q D;  4L3G C;  2AGL D;  2IAA B;  1MG2 B;  2HJB D;  1MG3 B;  2AGX D;  2J57 K;  2HJ4 D;  2OK4 D;  2HKR D;  4L1Q C;  2H3X B;  4FAV C;  2GC7 B;  3SJL C;  3SWS C;  3C75 L;  4FA5 C;  2J56 L;  4Y5R C;  1MDA L;  2OK6 D;  2HXC D;  4K3I C;  4O1Q C;  4FA1 C;  2J55 L;  3ORV C;  2IUV D;  3RN1 C;  4FAN C;  3RLM C;  2BBK L;  2I0T D;  2AH0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...