2AH1D

Crystal structure of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ah1D00
2Q7QD 2BBKL 1MAFL 2GC4B 1MAEL 2AH1D 3RN0C 1MG3B 1MG2B 2J56L 3SWSC 2IUPD 2AH0D 3L4MC 3PXTC 4FANC 2MADL 4FA9C 2H3XB 3PXWC 2OJYD 2AGLD 3RMZC 2HJBD 4FB1C 2HJ4D 2IUVD 3L4OC 3SVWC 2I0TD 2J57K 4Y5RC 4O1QC 4FA4C 3ORVC 4FA1C 4L3HC 2MTAL 4K3IC 3RN1C 3SLEC 2AGWD 3RLMC 2AGYD 3PXSC 2I0RD 2OK4D 4L1QC 2HXCD 2I0SD 2AGZD 2OK6D 2IURD 2IUQD 2HKRD 3SJLC 4FAVC 2IAAB 4FA5C 3C75L 1MDAL 3SXTC 2HKMD 4L3GC 2AGXD 2J55L 2GC7B 2H47B 2OIZD
chains in the Genus database with same CATH superfamily
2Q7QD 2BBKL 1MAFL 2GC4B 1MAEL 2AH1D 3RN0C 1MG3B 1MG2B 2J56L 3SWSC 2IUPD 2AH0D 3L4MC 3PXTC 4FANC 2MADL 4FA9C 2H3XB 3PXWC 2OJYD 2AGLD 3RMZC 2HJBD 4FB1C 2HJ4D 2IUVD 3L4OC 3SVWC 2I0TD 2J57K 4Y5RC 4O1QC 4FA4C 3ORVC 4FA1C 4L3HC 2MTAL 4K3IC 3RN1C 3SLEC 2AGWD 3RLMC 2AGYD 3PXSC 2I0RD 2OK4D 4L1QC 2HXCD 2I0SD 2AGZD 2OK6D 2IURD 2IUQD 2HKRD 3SJLC 4FAVC 2IAAB 4FA5C 3C75L 1MDAL 3SXTC 2HKMD 4L3GC 2AGXD 2J55L 2GC7B 2H47B 2OIZD
chains in the Genus database with same CATH topology
2Q7QD 2BBKL 1MAFL 2GC4B 1MAEL 2AH1D 3RN0C 1MG3B 1MG2B 2J56L 3SWSC 2IUPD 2AH0D 3L4MC 3PXTC 4FANC 2MADL 4FA9C 2H3XB 3PXWC 2OJYD 2AGLD 3RMZC 2HJBD 4FB1C 2HJ4D 2IUVD 3L4OC 3SVWC 2I0TD 2J57K 4Y5RC 4O1QC 4FA4C 3ORVC 4FA1C 4L3HC 2MTAL 4K3IC 3RN1C 3SLEC 2AGWD 3RLMC 2AGYD 3PXSC 2I0RD 2OK4D 4L1QC 2HXCD 2I0SD 2AGZD 2OK6D 2IURD 2IUQD 2HKRD 3SJLC 4FAVC 2IAAB 4FA5C 3C75L 1MDAL 3SXTC 2HKMD 4L3GC 2AGXD 2J55L 2GC7B 2H47B 2OIZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q D;  2BBK L;  1MAF L;  2GC4 B;  1MAE L;  2AH1 D;  3RN0 C;  1MG3 B;  1MG2 B;  2J56 L;  3SWS C;  2IUP D;  2AH0 D;  3L4M C;  3PXT C;  4FAN C;  2MAD L;  4FA9 C;  2H3X B;  3PXW C;  2OJY D;  2AGL D;  3RMZ C;  2HJB D;  4FB1 C;  2HJ4 D;  2IUV D;  3L4O C;  3SVW C;  2I0T D;  2J57 K;  4Y5R C;  4O1Q C;  4FA4 C;  3ORV C;  4FA1 C;  4L3H C;  2MTA L;  4K3I C;  3RN1 C;  3SLE C;  2AGW D;  3RLM C;  2AGY D;  3PXS C;  2I0R D;  2OK4 D;  4L1Q C;  2HXC D;  2I0S D;  2AGZ D;  2OK6 D;  2IUR D;  2IUQ D;  2HKR D;  3SJL C;  4FAV C;  2IAA B;  4FA5 C;  3C75 L;  1MDA L;  3SXT C;  2HKM D;  4L3G C;  2AGX D;  2J55 L;  2GC7 B;  2H47 B;  2OIZ D; 
#chains in the Genus database with same CATH topology
 2Q7Q D;  2BBK L;  1MAF L;  2GC4 B;  1MAE L;  2AH1 D;  3RN0 C;  1MG3 B;  1MG2 B;  2J56 L;  3SWS C;  2IUP D;  2AH0 D;  3L4M C;  3PXT C;  4FAN C;  2MAD L;  4FA9 C;  2H3X B;  3PXW C;  2OJY D;  2AGL D;  3RMZ C;  2HJB D;  4FB1 C;  2HJ4 D;  2IUV D;  3L4O C;  3SVW C;  2I0T D;  2J57 K;  4Y5R C;  4O1Q C;  4FA4 C;  3ORV C;  4FA1 C;  4L3H C;  2MTA L;  4K3I C;  3RN1 C;  3SLE C;  2AGW D;  3RLM C;  2AGY D;  3PXS C;  2I0R D;  2OK4 D;  4L1Q C;  2HXC D;  2I0S D;  2AGZ D;  2OK6 D;  2IUR D;  2IUQ D;  2HKR D;  3SJL C;  4FAV C;  2IAA B;  4FA5 C;  3C75 L;  1MDA L;  3SXT C;  2HKM D;  4L3G C;  2AGX D;  2J55 L;  2GC7 B;  2H47 B;  2OIZ D; 
#chains in the Genus database with same CATH homology
 2Q7Q D;  2BBK L;  1MAF L;  2GC4 B;  1MAE L;  2AH1 D;  3RN0 C;  1MG3 B;  1MG2 B;  2J56 L;  3SWS C;  2IUP D;  2AH0 D;  3L4M C;  3PXT C;  4FAN C;  2MAD L;  4FA9 C;  2H3X B;  3PXW C;  2OJY D;  2AGL D;  3RMZ C;  2HJB D;  4FB1 C;  2HJ4 D;  2IUV D;  3L4O C;  3SVW C;  2I0T D;  2J57 K;  4Y5R C;  4O1Q C;  4FA4 C;  3ORV C;  4FA1 C;  4L3H C;  2MTA L;  4K3I C;  3RN1 C;  3SLE C;  2AGW D;  3RLM C;  2AGY D;  3PXS C;  2I0R D;  2OK4 D;  4L1Q C;  2HXC D;  2I0S D;  2AGZ D;  2OK6 D;  2IUR D;  2IUQ D;  2HKR D;  3SJL C;  4FAV C;  2IAA B;  4FA5 C;  3C75 L;  1MDA L;  3SXT C;  2HKM D;  4L3G C;  2AGX D;  2J55 L;  2GC7 B;  2H47 B;  2OIZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...