2AKEA

Structure of human tryptophanyl-trna synthetase in complex with trna(trp)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
373
structure length
373
Chain Sequence
b'GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transfer RNA-Trp
publication title Structure of human tryptophanyl-tRNA synthetase in complex with tRNA(Trp) reveals the molecular basis of tRNA recognition and specificity
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase/rna
total genus 140
structure length 373
sequence length 373
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2akeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2akeA01
2A88A 1N2BA 2H29A 3FNRA 1F7UA 1MC1A 2QTMA 1MJHA 3H9CA 1G59A 3DLAA 1JIJA 1F9AA 1Y42X 1NSYA 1JGTA 2R5WA 4ZT2A 1D2RA 1KAQA 1ZH6A 3FOCA 1QJCA 3LCJA 3N05A 4PBRA 1U7DA 1JILA 2A1TS 4GU5A 3HMQA 2J07A 2NSYA 3N2YA 1JZQA 3TS1A 2JA2A 4RUKA 1VBNA 2XRZA 1ZH0A 3ILVA 1BS2A 2X0KA 3FIUA 1VBMA 3SDBA 3GUZA 5F23A 4G5FA 1KQOA 4UZFA 2E18A 1IH8A 3D6UA 1QU3A 3FDXA 4ZT7A 4EGAA 2VTBA 1TFUA 1IQUA 4MVCA 2DR2A 5IJXA 3ZJTA 1NURA 1WXIA 2Z08A 3H9BA 4YP5A 3S3TA 2E89A 4NX2A 4YP6A 4Q16A 4OJMX 1ZUNA 3CLSC 2XRYA 3SZGA 4DE5A 3IMEA 1VBKA 1KR2A 2A1UA 4NATA 1GLNA 2CT8A 2J08A 2DEUA 1U3CA 1O95D 4Q93A 3CVYA 4CDMA 2J5BA 3OTWA 3A4IA 5DB4A 1MB9A 1SURA 4MAFA 5DASA 4WSOA 2JANA 1TEZA 1S4MA 1N78A 4HJXA 1YULA 3ND5A 3P52A 4I6JA 4MW6A 2RD2A 3CVWA 2Z09A 3DV2A 3FETA 3UC5A 1COZA 5HUHA 2CSXA 4MW9A 1PFWA 1I6MA 3FH0A 1T9GR 1VL2A 2CFOA 4MUHA 2YXNA 3ZJVA 3H99A 2CV1A 1NUQA 3MUEA 1EJ2A 2DPLA 1GPMA 2HGZA 3KT0A 2IELA 3ZUGA 2ZP1A 3ZXIA 4EF6A 1OBCA 4R2LA 3FY4A 4KPUB 2TS1A 3CLRD 1WQ4A 4H3SA 1T9GS 3A04A 1WY5A 3CLUD 2HZ7A 3ISJA 1N1DA 4MVYA 1PFYA 2I1LA 5H7XA 1M8PA 1N2OA 1TYDE 1O5TA 3GLVA 1KH2A 3E27A 1G8GA 3RK0A 3COYA 2DUMA 2A4MA 4G6ZA 2VTBB 2WB2A 1QU2A 1EXDA 1GTSA 5TEWA 3ZGZA 4ARIA 4MQ6A 2IJGX 4ND6A 1EFVA 1H3NA 1M83A 2YWBA 4MW1A 4I6EA 4QREA 3AIIA 4R0NA 1J21A 1NUUA 1T6YA 4KKVA 3MLAA 4P2BA 5J5AA 1Q15A 1WXHA 4RPIA 3FI0A 2QUHA 4MLPA 1N2IA 3VGJA 1TYCA 1K97A 5K0TA 2B7LA 3CR8A 2ZUFA 2CYBA 3DO8A 1ILEA 1MAWA 4WNYA 2QJFA 5KCMA 4U7JA 4EG7A 2CV0A 1M1ZA 4MUFA 2CUZA 4U8HA 3UOWA 4F3RA 1GAXA 1F7VA 3IMCA 1YIAA 2VXOA 5TGTA 1J70A 4JXZA 2D54A 3IVXA 1H3EA 3IVGA 5HUJA 4QBTA 1IVSA 1NUTA 1WKBA 1HYBA 3IOCA 1I2DA 4FZJA 4QRDA 1U3DA 1NZJA 2ZUEA 3L92A 3AG5A 3OP1A 4KR7A 1QRSA 1PG2A 1QQTA 1OWNA 1O94D 5KHAA 5LLTA 1WXGA 3ND6A 3SYTA 3IH5A 4MULA 1XNJA 4CT0A 1O97D 2J09A 1O96A 3C8ZA 5DEOA 4DDMA 1O0CA 3NV7A 1NUPA 1V8FA 2AKEA 4ZCQA 4KR6A 3LOQA 5LM3A 4MWEA 2NZ2A 1X6VA 4YP7A 3MLBA 1EUYA 3QTBA 3SEZA 4ZCRA 4G5YA 2AG6A 2YY5A 1JMVA 1XJQA 1J1ZA 4JYZA 4EG4A 2BYTA 2JAXA 4HJRA 4F4HA 3CLTC 3IOEA 4MUJA 1EFVB 4DLPA 4NZPA 4R2MA 1QTQA 1F4LA 4XSVA 3AFHA 1N75A 2A7XA 1IRXA 1NP7A 1NI5A 3VRHA 1KH1A 1LW7A 3CVVA 1UFVA 3HGMA 2PZAA 4BWVA 1Q19A 2PG3A 2O8VA 4MUGA 5AHWA 3CVXA 3A05A 2PFSA 2YWCA 4DJAA 1IQ0A 1N2HA 2BTEA 1MB2A 1OWPA 1XNGA 2EJCA 3PRHA 4MUKA 4XFDA 4XFJA 4ZT6A 3IODA 4ZT5A 1WXFA 3TQIA 1GN8A 1J1UA 1IHOA 1B6TA 1YI8A 2D13A 1JEEA 4ZT4A 1TQ8A 3CLSD 2OV4A 4HPWA 1EFPA 1JIKA 1M8JA 3IVCA 2GM3A 1YIDA 4JFAA 1LI5A 2X3FA 4MW7A 4NAHA 3U1VA 1NYLA 1YUNA 1MRZA 5FO1A 4DDHA 3HZRA 1I6LA 1H1TA 4MWCA 1KKUA 1O96B 3Q10A 4CQNA 3RFFA 1OBHA 3H97A 3RJZA 2QUKA 5K0SA 3IOBA 3X1MA 3AG6A 1WJGA 3IUBA 1MAUA 1N2JA 1KAMA 2QJOA 3H05A 2DERA 3SEQA 1YUMA 1QRUA 3G59A 3IUEA 5DK4A 1J09A 1EE1A 1Q11A 1U7XA 3UY4A 1WQ3A 2A1UB 1O0BA 1PG0A 4ARCA 3PNBA 3PXUA 3UK2A 3K9WA 4A91A 1M8FA 3Q12A 2RE8A 3COWA 2C5SA 3L93A 4NAUA 5FNZA 3GMIA 4TS1A 3IDFA 1OD6A 4J76A 2DXIA 2X1LA 2CYCA 3ELBA 2E21A 3COVA 1X8XA 3KT3A 4L2IA 5BNZA 2WQ7A 3CVUA 2CV2A 3MMXA 4U63A 1TYAE 1O97C 3ZXSA 3IMGA 1K92A 3X1KA 2DETA 1JHDA 1Q77A 2X1MA 2H2AA 1H3FA 4AQ7A 2A1TR 1K4MA 1OWOA 4KR9A 3RHSA 5EKDA 1K4KA 1XNHA 1P7PA 1JIIA 3P0HA 3HFJA 1KORA 4JXXA 1KQPA 3BL5A 4E1AA 3ZJUA 5TS2A 4MW2A 1G8FA 1JEDA 1EFPB 1EUQA 1QNFA 1O95C 4EG8A 3CA8A 2QUJA 2V0CA 4KPUA 4S1OA 1R6TA 3D6VA 3DPIA 2OQ2A 4OUDA 2QJTA 3FG9A 2GOYA 3G5AA 3KT8A 3PNYA 3FWKA 4I6GA 1M8GA 1T6XA 3N8HA 1KQNA 2PZBA 1DNPA 5J59A 4PBSA 1PFVA 1N2EA 1IFXA 5J58A 1KP2A 3P0JA 2WSIA 5H16A 3A2KA 5JBNA 3QTTA 2J4DA 1J20A 1NUSA 4DNXA 1MOPA 1I6KA 3AKZA 4MVXA 5FO0A 1KH3A 3VU8A 1IQRA 3HL4A 2AZXA 3CLRC 3PNVA 5IHXA 3RBAA 4UZEA 3CLUC 3RK1A 1A8HA 1CT9A 2CYAA 3SZ3A 4MUIA 4X0EA 3M5WA 1N77A 4ZCTA 5LFAA 1N2GA 1GZUA 1V47A 1GTRA 4L2IB 3HV0A 1JECA 1R6XA 4MW5A 4NDAA 1O6BA 3K32A 2G36A 2A86A 1TYBE 2HMAA 3I05A 3QE4A 4EFKA 3G6KA 3KFLA 3TNJA 4ZCPA 1VLHA 2PZ8A 3LE8A 3CLTD 1PFUA 3KT6A 2PIDA 4MUNA 4EG1A 3P0IA 4EG6A 1FFYA 4J75A 3INNA 2QUIA 4HK4A 2V0GA 3TZEA 1MBZA 2QTNA 4MUEA 3AL0C 3ZIUA 4MWDA 1M8KA 4MW4A 1LI7A 4ND7A 3Q4GA 2Z3VA 3FHJA 1KP3A 3TQOA 1N3LA 2QTRA 4YMIA 1T6ZA 4YBRA 2IP1A 2E0IA 4OUDB 4MVWA 4DDKA 1WOYA 3MXTA 4CDNA 3NBKA 4PY2A 2EL7A 4PBTA 5HG0A 3X1JA 5KWVA 2GKSA 3NBAA 1OWMA 2WQ6A 3COZA 3TZLA 3SP1A 4GRIA 4EG5A 4JZYA 4ZCSA 4MW0A 1WZ2A 3F3MA 3JXEA 4AS1A 4EG3A 2PXHA 1U0BB 1ZJWA 4ZT3A 2A84A 3N9IA 1QRTA 3ND7A 1WXEA 2D5BA 1O94C 2DLCX 1JZSA 4K0RA 3UMVA 1R6UA 1RQGA 1ULHA 2O5RA 5TEVA 1FYDA 4K03A 1G8HA 4MWBA 1OWLA
chains in the Genus database with same CATH superfamily
1SOMA 2D5LA 3T3HA 1AT1A 1YJ5A 3T5GA 3S1SA 4JK3A 3ZVKA 3EF0A 4TRNA 5F7XA 3RQIA 1JSLA 1VBFA 1J23A 3M2PA 1SZJG 2TSYB 5MDHA 3CPEA 2OSBA 4E0BA 5HM6A 2VG8A 2IEBA 3CRZA 4JDPA 3RRXA 1CJCA 1IBCA 2IT1A 1V5FA 2NVUA 4IDDA 3T7AA 4TYNA 1X7GA 4RF5A 1BCSA 1E6LA 1SVSA 1TT5B 3ABZA 3M0EA 4KXUA 4M7PA 5MHTA 2GSDA 3PU6A 5C2JB 1P8JA 2QGFA 2CLFB 3ZDEA 1BD3A 2JRCA 4R9VA 4WZBA 5BVHA 4LNAA 4KDEA 5FR1A 1RLOA 4ZD6A 1LZKA 3D7RA 1UBUS 1W94A 1H85A 1QIHA 2WTMA 4D1YA 2VSYA 5ENDA 4E30A 2YVLA 4F72A 4D57A 1PBNA 1IPEA 3BXFA 3O4RA 2JGKA 2HK8A 3IAXA 3O9ZA 1P5FA 5A62A 4QVIA 2PUAA 4YRAA 3BDAA 1G8SA 3D2AA 3ZEIA 1JFRA 2CXXA 2X0KA 1VBMA 3AUJB 3R8XA 5KVCA 2C31A 3GEPA 1YO6A 4U5XA 2GJSA 2D0OB 1KI6B 4DUPA 4F8EA 3RR2A 5JFGA 1HQCA 1SWWA 3ZTWA 4EFNA 5IYZB 1DJMA 4EGAA 1PE0A 3B5JA 2CF5A 3Q1LA 3RIYA 2PRJA 3WYNA 3MPUA 1H94A 4PHHA 1L5NA 3OPVA 5M2QA 3DL7A 2IV7A 1E3WA 1NG1A 2J7KA 2V74B 3CF4A 1NBEA 4UDNA 3MCTA 1EFDN 1NVUQ 3TIFA 3V8QA 4NOKA 3JD3A 2W2XA 4O02B 5KIAA 2ZT8A 1I3LA 3TNDA 1ZCAA 2ZTVA 3OOHA 5FPKA 2BCJQ 3QFHA 5LSAA 2DECA 2OXRA 2WUVA 3P9ZA 4NBKA 3ZDQA 2LPMA 3GYGA 1LS1A 1PJ3A 4RTMA 4HXFB 1EZ1A 1S2NA 2FEAA 2RAFA 4LVUA 1ZMBA 3T12A 2CB0A 4E1VA 2JGDB 4UBMA 4L1KA 4XJTA 2IU0A 1W96A 2REQB 3VPGA 2JK0A 3M1LA 2ZBPA 1Q0UA 1G21B 1LNZA 2YVAA 1L4EA 1KGDA 4MJ7A 5CFRA 1SURA 1YXMA 1JDTA 3SDSA 1JDBB 2J3MA 4Q4JB 4TXNA 4Q05A 2YBEA 4QOHA 1ECJA 4BS9A 4DNFA 5JXHA 1H0RA 1GLVA 4YREA 5JOQA 2FZKA 3C6BA 3RUAA 4EPVA 1I13A 3G9UA 4EO7A 5EZYA 1G8JA 1V6CA 2X7XA 5J2TA 4URWR 3EHDA 5JLAA 3G7NA 1GGEA 4ZALA 2AUMA 3PXGA 1KBQA 1XO1A 2X23A 4DQ0A 2ZJBA 4LJ4A 2CJXA 5FWNA 3KSBC 3THYB 1UAAA 1ECLA 1SCKA 1X94A 3DHNA 4ZTBA 5EIAA 4UPEA 3H42B 1SIUA 1SRQA 4D46A 2BLLA 2NYRA 3WGNA 1R4ZA 5IZ4A 2PS3A 1WQ4A 1E2HA 3A04A 1CRLA 2TMYA 3A3KA 3OG9A 3HRKA 3ISJA 4H60A 4LYGA 4RJTA 1K6IA 4S0XA 4URXR 1V8OA 2FOXA 3PVZA 4U7FA 4B75A 3UPTA 1PFYA 4DLLA 3LGSA 3UJ3X 3ZBUA 3EXIA 4DEVA 5E1DA 2IUTA 1N2OA 1A9QA 3LHSA 4CMGA 3TFOA 2UYHA 1ARZA 1T2VA 1U9JA 3DCYA 2JEYA 4ZCRA 1KH2A 1HURA 4DGSA 1DCMA 5LOVB 1ES9A 2RK4A 4YAJA 1M3SA 2IXTA 1I10A 3B5IA 3W4IA 3MTIA 1Q3KA 1WW8A 3MTJA 4HWGA 2J8ZA 1P1KA 2HBYA 4G6ZA 5K7SA 2WYHA 4EJ0A 1GU1A 2PBZA 4X60A 2BH9A 5F1OA 3FJYA 4EY7A 4P7GA 3FKSD 4YJFA 1Y4AE 2ACKA 3ICQB 2IJGX 2G9QA 3PFNA 1EFVA 2WSSD 1SCDA 4KPEC 1B8VA 1KDYA 5EQJB 4R0NA 3ZH2A 3ZOZA 3RI3A 3KWMA 1RM3A 1P0PA 5EIXA 3IIJA 2IX9A 1QHSA 4WK2B 5G1PA 5C31A 3SHTA 5JCZA 3U19A 1DWQA 4W8GA 1KRHA 1ZN7A 5CB4B 2FEXA 1FE8A 3I34X 2HW8A 1BS1A 4CN9A 4LRYA 4IXNA 4CIYA 1LX7A 4GPBA 1AGXA 2IPXA 5LQMA 3O8CA 1LLUA 3MWLA 2B7LA 2HDHA 4PGGA 2W2TA 2OYRA 1Y1RA 1T9DA 5HTKA 3QMWA 1AHNA 4M9UA 3SSMA 3COJA 2O1WA 4U39A 2VNSA 3MCUA 4RVNA 2H9IA 3M34A 5AKIA 2ADOA 4EG7A 1LVUA 3K0CA 1RAIA 3KUKA 1J8MF 3K1ZA 5LYJF 16PKA 1T34A 3OZSA 4F2HA 2IHVA 1MOSA 4FDTA 3RS2A 4Z2AA 3PE6A 3WLHA 1B4DA 1RBZA 1M1YB 2XYGA 2FR0A 1DKUA 1YGPA 3IVGA 3C8DA 5B2FA 3AJRA 5F5XA 5FV7A 4DXAA 2Y1WA 2CNLA 3NHJA 1TVKA 5FOXA 4DHEA 1OQAA 1YL7A 3FE2A 4D9MA 1IONA 2Z2ZA 3BCHA 2WNHA 3PRJA 4LDQA 1P77A 3EVNA 4PHCA 4BV9A 2CVPA 3DF7A 1I3NA 2WIAA 5KYVA 1PG2A 3IESA 3MF4A 2EKZA 2QQFA 2P4EA 5IXYA 1XXHB 2BBWA 3TW4A 4FYWA 1E1LA 4J4TA 3STXA 4ZJUA 2J0UA 3OWHA 5IJ0B 5LU9A 4JBWA 3H2ZA 4S35A 1O96A 4CR8A 1RJEA 3KYJB 1MA3A 1YD7A 4W5JA 3G2PA 5HJ5A 4GKKB 2AYZA 1TMGE 2QN8A 4NAVA 4Y3UA 3WMFA 2EFGA 5AHKA 1PT5A 1VSUA 3UV7A 1BHQ1 1FFBA 2PYIA 3IRUA 4D80A 4F4JA 5F4BA 1DMSA 3HJNA 3OZWA 3GP5A 1JSCA 2GBGA 4CM8B 3KKNA 5JAIA 3HXMA 4OQXA 2HJGA 2AEEA 3LFUA 1UFKA 3RTBA 3ELDA 3JQ6A 4QL3A 3ZI4A 4DBZA 2BYTA 2P2CA 2P75A 1N9KA 4EENA 1VDZA 4HGZA 1PTJC 5K6AC 2EJVA 1V7CA 2QJRA 3F4LA 1GKYA 3S8YA 4R2MA 2ZYTX 3VH4A 3CH6A 4KZKA 3DEIA 3JARB 2YYZA 2A5YB 4TLDA 1LPAB 2J0EA 2V6FA 5I9NA 4WKBA 3T5BA 2J1LA 3WMRA 2J4CA 3QY9A 5SZJA 4ME6A 2EKBA 2WKPA 3EOAI 1ONNA 1JWBB 1NBAA 2LCFA 4L3VA 2V0NA 2Q0QA 3WHLA 2KYRA 3DT9A 3GLGB 4M1MA 3FMIA 3OTHA 4ZO8A 3K0FB 1ZGZA 2YJ5A 4WVLA 1P2UA 5BXYA 4JXJA 4OMCA 2NG1A 4PFQA 4H77A 4YRRA 1GAEO 4DT1A 3KJFA 5HDBB 4ER3A 2CF6A 2OCGA 4OD0A 3ZDDA 2J0SA 5AJZA 3DTYA 3MWDA 3U7JA 4AMBA 4EITA 1DWUA 2WILA 1KETA 2R25B 4JP2A 4LQDA 4E31A 1GNPA 2WPDD 5EESA 2C3MA 4Q3KA 4QM6A 1M54A 3MINB 1Z5PA 3DV0B 5DF1A 3RCBA 2KHZA 3TLGB 4FP9A 2HA5A 1OH6A 1WLSA 4RA9B 3KB1A 2ILTA 2OAGA 1OYVA 2OV4A 2JAPA 3H18A 4TZKA 3AIOA 5JZSA 5LZ9A 1EFPA 4HATA 3V8EA 4EHKA 5GJCA 2YN4A 4R1NA 2AX4A 2EFJA 5BW4A 2BL4A 3SF8B 2HQSA 2O23A 1GCGA 4P0QB 2BTOA 1OR8A 3OT4A 2JCGA 3MUOA 4D25A 2UZ1B 4QWWA 3BXPA 2YJNA 1D0VA 4MWTA 4AROA 4ESVA 4GXNA 4MWCA 2QPLA 3K15A 2ZI4A 4DR4B 4W7HA 2Z8YM 2P7IA 2ZWAA 3FRJA 3FWHA 5JR3A 3R9WA 1E2EA 5KQRA 2VKQA 3AZQA 4ALIA 3BMNB 3D5TA 3CJTA 2F00A 1N2JA 2HU8A 1RADA 1FX0B 1UEJA 2VHXA 2V7TA 2EFCB 3CH4B 3FKSA 2GBLC 4YJ3B 4I4CA 4MI6A 1G2QA 3V48A 1J0CA 2ZFUA 2WSSA 3K70D 4V0MA 3ANYB 3BK7A 4PCAA 3O92A 4BKPA 3B48A 1FF9A 3OQPA 4DIBA 4EX7A 2VJAA 1GSOA 3GRRA 2XUKA 1TM3E 4ARCA 3UV3A 2BGKA 2R4QA 4KSCA 3U7IA 4KQMA 2D6FA 5IG2A 4IV8A 4GOKA 1CJSA 1MHPA 3TSWA 4H3HB 5K9ZA 1BAPA 1T3SA 3SVTA 1QBGA 3VDQA 3UTDA 2WAMA 1X1AA 2IZ1A 2WSBA 1KYWA 1QLJA 2HRCA 3OBIA 4KXLA 3W9UA 2VPPA 4KQGA 2WAXA 3LQ2A 2P35A 3OA2A 3Q5GA 2NQ8A 4IJ6A 3COVA 3ZIDA 4DREA 1X8XA 3Q72A 1SBIA 2YVKA 4CIWA 1WBJB 1BMFD 1I30A 5JCOA 3CVUA 1FRVA 3CE6A 1M72A 2GJAA 4BO0A 2W43A 3X1KA 4Y1RA 2WJPA 1UKBA 3KEFA 4NS4A 4KE6A 1WUKS 3FOWA 3LCRA 4WD3A 1JTVA 1Z28A 4F0JA 4PVDA 5BVGA 1YNOA 2P9HA 1C0IA 3QG1A 1ZBDA 5E4JA 4C3VA 5C35A 5KMGB 1MH1A 4LRTB 3T54A 5ESDA 1ZIYA 5LBTA 4F2GA 4RNDB 4FFVA 5HKKD 3TW6A 3LJKA 4TS4A 4L4ZA 2GLUA 5I7VA 3ROQA 4O8ZA 3U49A 3W90A 3NETA 3K92A 3SX4A 5H9WA 4ESOA 1G8FA 3L8YA 4IWXA 1WF3A 3CTMA 1J90A 3IV6A 1UMBA 1UPAA 3OCZA 1RYFA 3PC3A 4ID3A 3LY9A 1R0XA 2JBHA 3QOWA 4HSGA 4KWEA 2ETVA 4HWPA 1EDEA 3JY6A 5DYTA 3RC2A 4D8UA 5DNUA 1K7YA 3ETEA 3NX4A 1EUCA 2QMUA 4J6EA 1TD9A 1XELA 1U31A 5T4HA 4A6XA 2BGNA 4AZSA 2ZBVA 1YVEI 3GEEA 5I9SA 2WWWA 3ERCA 1I7QB 5A7FA 2GFQA 3AZPA 3L8EA 1T8UA 1V3VA 1ATZA 1T43A 3FVTA 3KVOA 4AMGA 1N4DA 2YC2C 4RS4A 5EL0A 4KPGA 4HBZA 3BFXA 3LC7O 3DVQX 4URYR 3C6MA 3RSHA 1V2GA 4OGLA 2DFNA 3SZLA 4KBFA 4BO4A 1TM2A 3WWOA 3F8SA 4QSHA 3DVSX 5IBCA 4FHCA 1E1CA 2WYOA 1LX6A 3HHPA 1GYPA 4RE5A 4YK7A 1MOPA 1L5HA 1OJ7A 4DARA 2XTNA 2NUPB 4QELA 2QXUA 1MC8A 4P3NA 2H1FA 1QK5A 4J3NA 2RHBA 3D3JA 4NSNA 3LUFA 3LC2O 4NNJA 3RBZA 3V8RA 4UZEA 4JBNA 1SN7A 1A9SA 4OHUA 3EARA 1XK6A 1IMOA 5CMLA 4H0NA 1DJOA 3ZCPA 3ZS8A 4OPMA 1OLXA 4MCJA 5EHIA 2X77A 1X7YB 4HYTA 1I1QB 2OECA 4MYHA 3JQGB 3CZPA 1CZNA 3B7WA 5D00A 1LNSA 4FCTA 1VL0A 2LD4A 4KFSA 4YRGA 5LNK1 3TZQA 1L5MA 1TTQB 2VEDA 3CW2A 2MWMA 3BIFA 4KVZA 4QDTA 3MCVA 2V03A 2V45A 3PQ3A 2QM7A 3MFYA 3PFBA 4DNPA 4GIBA 2WPDA 5D01A 3U6BA 3IEUA 3AINA 2Z1MA 4CMAA 3RU3A 1WXWA 4OREX 2QN1A 2GZHA 3GL9A 3HVKA 3DNFA 1IHXA 3MA0A 5AWFC 3A11A 5HF8A 4E5VA 2HBZA 1WNFA 2VL7A 2SCUB 3C7KA 5AUOB 2CCKA 1LA2A 3IAS1 4HWSA 4MUNA 4CGYA 2DPHA 2UVQA 2HB6A 1FSFA 1WG8A 5HZKA 5BSFA 4PHTA 4WCDA 2ZIEA 4EOGA 3CM0A 4IIGA 3MPOA 1PGNA 2QUIA 1IK6A 4G89A 3TLBA 4BQFA 4YRBA 4MUEA 1R6AA 2I4TA 4FFNA 3EX7C 1CUGA 4GZ6A 3D0KA 1ZUHA 2OBLA 3NEAA 1AHPA 4ND7A 2YRXA 2DHCA 1UC8A 5GJBA 1IEQA 1HG0A 4AZWA 2FZWA 4FMDB 3PCXA 3H3XA 5JG7A 4C0QC 3CW9A 1LBSA 2R8YA 3PQEA 1JBKA 4O63O 4HWRA 4JOCA 3ZWYA 1G291 3UV6A 1UCFA 1W85B 2OL4A 4O4JB 2DULA 4OSEA 2JK1A 3AXSA 4RD6A 1NF8A 4CCSA 4LJ8A 5BQFA 2J9ZB 4PQEA 3RW9A 3NBAA 3R5SA 4PLPA 4QTUB 3H13A 4GP9A 3W5BA 1GCUA 4I2NA 5AVUA 4TVOA 1V48A 1AB6A 2JFNA 2QMHA 4KSBA 4C6TB 1IB6A 3WMWA 1OFHA 4EBBA 4DWOA 4JJKA 4ZCSA 1YR1A 2J9FA 1BKYA 3PKJA 4IG4A 4MW0A 4AUNA 3GZNB 2IQ5A 5ARCA 2GXUA 4JI3B 1N8NA 2W48A 3WSWA 3WSVA 1Z2NX 3FA2A 1SBQA 4L9WA 5BN3B 4ER5A 3EG9A 2R6R1 4JJAA 1XRMA 2QLFA 5AJTA 3DCJA 2RHLA 3LDGA 4G5QA 2IS2A 1MAHA 3M4ZA 2VXBA 1CY7A 4QAJA 3O90A 1J2YA 4NU5A 4B4UA 2F64A 4DR2B 1Y6RA 1Y3CE 4QU0A 2ZJ1A 1R6UA 4R1SA 1BMFA 3OQIA 2V98A 3JYQA 4FB5A 2VQ6A 3D81A 4UQOA 4KXYA 4V03A 2PZEA 3Q7QA 4WZAE 5J5CA 1N2BA 2YZKA 2FVXA 4D6XA 1MC1A 5IEJA 5ITZB 3CJRA 4FNOA 2XCTB 1QM5A 1RAAA 2ONZA 1NNUA 3PIRA 1MJHA 3H9CA 2ZSKA 3ORRA 5BSVA 5HKKA 5ALDA 1LW6E 2NXJA 4YCSA 4JQZA 5K99A 2PJRA 1D2RA 3N8NA 2WWTA 3ZY2A 2HMVA 4PX5A 3QWAA 5JWOA 1X0XA 1B8PA 5DWQA 1VG8A 2GTHA 1AKNA 1B1CA 2CL5A 2NUTA 2PO5A 3WE7A 1BGVA 3H5LA 3N2YA 3HA2A 4RHUA 5EKSA 3PX3A 1XTRA 2P1ZA 3EDRA 2G8LA 3LF1A 3LVFO 2FP4A 1ZH0A 3PCTA 2WUDA 5IAJA 5C8YA 3UT0A 1ODSA 3CKMA 4UUMA 4B74A 1YAJA 4S05A 2DSTA 2LKCA 4L7VA 4OLBA 5AM3A 1ZCBA 4MI1A 4FJ1A 1JR2A 5DTJA 4CG0A 4MR7B 3AM5A 4M89A 2H00A 1E5DA 3AH8A 4R1OA 1U7WA 1FDSA 1V35A 2PL9A 3AVXA 1PW5A 4COKA 2GJ8A 4IOLA 1QU3A 1NBIA 3A0UA 3AF4A 3A1WA 2D5IA 2XJ9A 2ZIUB 2O8CA 2VHJA 2DZDA 4KMRA 4BLSA 3FYUA 4EA7A 1Q0HA 2W00A 1E8DA 1G0OA 1ULBA 2OAP1 2XMQA 4HZUB 5COQA 4LSWA 4OXXA 2H17A 4C43A 4M3NA 5JZ9A 3S3TA 4BQRA 4QPJC 3P94A 3COSA 3TCKA 3U26A 4LI3X 4NX2A 1JAZA 1R2QA 4C4YA 3VO9A 1V7ZA 5DGHA 1N6NA 4FPXA 5BUQA 4A6EA 2AMVA 4EM6A 3RKUA 1UBMS 2O8DB 4V2IA 2VF8A 4US0R 3IAEA 1YZKA 4Z1OA 1QHGA 2Z4RA 1SQ5A 1H0SA 2VJLA 2WYWA 3GCXA 4QYWA 4XQGA 1EX9A 4ZQBA 4EP1A 3R8CA 1PDWA 2IXBA 1RQ7A 5DB4A 1HRKA 3H8VA 4AP6A 3UWSA 4BP3A 1SOUA 2G82A 2HZBA 2JB9A 2MR6A 3TTUA 3VDXA 2YJ3A 1E1YA 2F1JA 4F9TA 3GVPA 4JB0A 2MCFA 3G2QA 4M1ZA 1IZZA 1GILA 2H5EA 5COBA 5GGXA 3SZOA 3WQRA 3NKVA 1W4CA 1VPTA 3CEMA 1XZHA 3KOWA 3RS4A 2PY6A 7YASA 5IVPA 5IPFA 2LZ0A 3CZ9A 2KLBA 1FNNA 1M10A 3NC4A 3ZJVA 1KEUA 1T9KA 5EI5A 4KQXA 2YNMC 2CV1A 1GPJA 2DH5A 5ALOA 2LIPA 3PHJA 5K3AA 2ZUTA 3HP1A 1RM5A 1IM8A 2Q46A 4UTZA 3B6JA 3K5IA 1N0UA 2FLKA 3ADOA 4LX0A 4V0OA 5DNEA 4CM3A 4F93B 1F6BA 3QLVC 4EW2A 5L40A 4CG1A 1NW4A 3I0MA 3FY4A 5FOSA 5E1BA 3ZE6A 2Q5QA 3FSEA 4DIKA 3L43A 4YMLA 1T9GS 1UBJS 3CPJB 5D8DA 3VSAA 2XUFA 1YQTA 1CUFA 3DKVA 2FB9A 4YV2A 3GLFE 3KD3A 1Q92A 3K5WA 3LC1O 1U7OA 2WMOB 2ZPTX 2C4HA 1DLIA 5ALGA 3R5FA 2R8EA 5ALEA 2D1TA 1D4ZA 1Z6QA 2ATIA 1EA5A 1XCPA 5DNCA 2GD2A 1IUOA 2C92A 2OFOA 4EABA 1YQUA 1ZHHA 2EZ8A 1AUOA 4FEAA 1P0QA 5JS2A 3DMGA 2VH1A 3VR3D 1VIAA 3OJLA 2B78A 4LMAA 1IY9A 1JJFA 1WMBA 1Q22A 2H1CA 4UJ3A 5CT4A 2AOWA 4BRUA 3OUZA 3QENA 3THWA 2Z04A 2AFIA 4EZIA 3R23A 2FETA 1VLQA 2Y9PB 4HXEB 4JLAA 4ND6A 4WFQA 5DIZA 5IVHA 3RT1A 3O8RA 1WB6A 1N6OA 2HUNA 3LO8A 4KOAA 1C0LA 1PCXA 5ETJA 3G6WA 1ESEA 4XH9B 4RVCA 2Z6UA 2HRDA 3Q9UA 1T2FA 5KWIA 1C41A 3D1JA 3DEKA 1WCV1 2AG0A 5AR1A 4Q9NA 2JIZD 5LQRA 3ZX4A 3HY4A 5J5VA 4DEXA 2CHFA 3LUBA 4LY6A 1M74A 1Q7CA 4UD2A 1AF7A 1MIHA 2ZYDA 2CYBA 2D2VA 4L8LA 1X7ZB 3WWPA 4Q3OA 2AFHB 3WICA 3GHYA 4F3CA 2BJVA 1UF9A 3BXHA 3LQFA 4BBAA 1G8PA 2WKWA 2YJTD 2YV3A 4LECA 3KVVA 1DEOA 3MWEB 1O8BA 5EP3A 2PL5A 3GEDA 5AICA 1E6CA 1RWWA 2XTMA 4H1UA 1VIDA 1K89A 4D5EA 4C07A 1OC2A 4N5DA 3U4MA 2EW8A 3HS3A 2PD3A 2B2XA 1W4RA 2D54A 3WAGA 1LDMA 1W0CA 4YMTA 4A4DA 4FMBB 2FPUA 3NFYA 3M6VA 1B73A 2FWRA 1EWYA 3QE0A 4G84A 5GGYA 3QXSA 4OLAA 3O0DA 1CD5A 1DKOA 2Q3EA 3AKDA 1V37A 3OP1A 4A5OA 3LBFA 2Y2VA 4QNRA 5JALA 1C1XB 6ADHA 4GC5A 1K7SN 5HJ7A 3RVNA 4PGFA 2CZCA 4GRDA 2VHYA 2VXCA 2DE0X 3LYUA 3WMXA 1A98A 1XZGA 3PENA 5IF3A 4ITVA 1XNJA 1AQYA 4LNUA 3T7RA 2WIDA 4ZOLF 3KTOA 5EY5B 3WWYA 3PGKA 4FU0A 1V8FA 2JIMA 2AKEA 4J4HA 4OH1A 1EM8A 1Q1ZA 5GZ1A 1HKUA 5K0GA 3FLAA 3QWIA 1E61A 3URMA 3SS7X 2VEOA 3SEZA 1RRCA 1HQYE 2Z5GA 4X8MA 1YJ8A 2V9PA 3V2HA 1L7XA 4DM3A 1P61B 3ZUPA 4ISCA 4AVYA 1RI4A 4GC9A 3NBZC 1IN4A 3QVKA 2OCPA 3BMCA 5KSYA 1SHLA 3JQFA 1EWQA 1O03A 2A14A 3B1XA 3MBKA 1NGSA 1GPLA 1QF7A 3AHJA 3FMPB 3D8UA 3Q3GE 4HQ6A 1SUAA 3EE6A 5K45A 3C3XA 4DYHA 1CIVA 4RJLA 5T6BA 4CIBA 3AFHA 3VSBA 1X13A 1NMXA 5JTTA 2AW3A 3LY7A 2Q2WA 2VDOB 4FMDF 3VR2A 1LW7A 2PMWB 3CVVA 3RVMA 3DL2A 1L4NA 1PX0A 3MSCA 3VPAA 4ALNA 4X8LA 3HB0A 3IKLA 1IPFA 1BGWA 2XT6A 5LMNB 5JCPA 1EWKA 1EAYA 4WK4B 2EIHA 1HE2A 5DISB 4AUMA 5KVAA 3RASA 1Z4IA 2FX2A 4JU9A 3GRPA 2C1EA 5CX1B 2QMZA 4LY3A 5NLLA 1YMUA 4CV3A 1X7WA 4ROTA 4EF4A 4D5GA 2PL3A 3RV3A 4Y7CA 3DOOA 2X7HA 1QTQA 4Z4CA 4GF5A 4M9RA 5H1YA 2HEIA 1NZDA 2EF1A 3FDFA 3RU7A 2ZRDA 3SSNA 5CNIA 2WFLB 3CH7A 1J0BA 1KFEB 3U1TA 4D99A 3T1VA 3M3HA 4TUYA 4G4JA 2A5LA 3MAJA 3HDVA 1QYVA 4KYIB 1U1CA 4ZQHA 2V7EA 4EY8A 4KRXA 3NEYA 2D62A 2QYHA 1EXVA 2I1WA 1ZRNA 1R5NA 4BXOA 3L0PA 1YUNA 2NQ2C 3I0NA 4X71A 4EL5A 2WPNA 3F67A 2MYTA 3I01M 1MR3F 1YDWA 1NRIA 2Q3CA 3A3OA 3DXYA 2XGSA 3HPRA 4J29A 3CIOA 3TPFA 3UKDA 5JSUA 5KDDA 5DJ5A 1EB9A 3LRPA 4OIFA 4R1MA 1VE5A 4BZQA 4IX1A 3GBVA 3QX7A 2B0JA 4ZOAA 4BQEA 2PUDA 3KEQA 5JYCA 1DBVO 5LUAA 4M1TA 2IF0A 2YRWA 3ESAA 3VR3A 3C24A 4O4HF 1JEQB 3NH9A 4JOQA 1SVUA 3WYCA 4BTLA 1KAMA 3NHZA 1Q0RA 5J2UB 1DWOA 1G16A 2J46A 1RWBA 2NPIA 2RGUA 3EC7A 2D4HA 3N8KA 4RF4A 2ZVDA 1WEKA 1HNXB 2CW5A 5L4SA 4RY8A 2CEKA 4R9UC 5HJ2A 2GARA 1TO1E 2AQHA 2A1UB 4OBBA 3AR9A 2HO4A 1M8FA 1TJ3A 3HY3A 2PUFA 1QWSA 1V4BA 3L93A 1JHUA 1M7HA 1UOOA 4RKFA 5FNZA 3INRA 3E8SA 4P22A 3S44A 5H9VA 3SKYA 3ZYZA 4BO5A 1MKYA 4F5WA 4K05A 4YO8A 1A1SA 4E4RA 1DU4A 2ZSDA 2X1LA 4MJXA 1HGXA 3RUCA 2BMJA 3C3JA 4GOLD 2YUTA 4KAFA 1OFIA 1W48A 2MU1A 3A70A 3I5AA 4LJRA 3CUSA 4KGZA 3L07A 4I5FA 4WXEA 3T3OA 2OM6A 3FYUC 3R5JA 3T7DA 3IBCA 1SD5A 4E3ZA 1TYAE 1NRXA 1QX4A 2ZQYA 1DS6A 1W5AA 2VA9A 3H16A 1JHDA 1QGAA 3L8MA 3GFBA 3OIWA 1DV2A 2Q4BA 1NKTA 3RTGA 3OCJA 1GT6A 5TARA 5HR5A 2VP6A 1GYRA 5C5CA 4RDIA 4PQFA 3MJFA 2QVBA 5KYYA 5H83A 2I6FA 4MGYR 4A2CA 2C77A 4I1OA 4KXXA 1ISMA 1ECPA 2A9VA 2W2QA 2ZRAA 3FCOA 3UAZA 4H16A 5NULA 1BZYA 4L5YA 3H1BA 1QWOA 5EJ9A 2ZYIA 4H7JA 3VTKA 1ULAA 2W22A 3G7SA 1R88A 1ZI8A 3K94A 1JJAA 4ICIA 3U1BA 3QZUA 1G6Q1 5A4IS 3ONDA 2HCJB 1IATA 1L4KA 1ZVKA 1E60A 1S7GA 2X2OA 5IEBA 5AKHA 1RTTA 3SE0A 3NHWA 4ZZ0A 3NIGB 5AJUA 1PWYE 2Q0SA 4ZAVA 5JO0A 3TUIC 1Q2UA 3ETNA 1ENOA 4EHNA 4NBSA 2D0PB 1E1DA 1PT7A 4O4IA 4RVGA 3UT6A 2YFQA 4JFRA 4KSYA 2HY7A 2YRFA 3H2YA 2AMYA 4PNZA 1SR8A 1Z0UA 4GX5A 4RJKA 2NP6A 2DRIA 1P7YA 2JJYA 3NNSA 3A2KA 4FMPA 3WLKX 1JE1A 2OAQ1 4Z9XA 2ANBA 2Q3BA 4C0HA 3IIEA 4GP7A 1E0DA 3PUZA 1KZYC 1P2DA 1T1RA 4NCKA 1DE0A 3CG0A 3QF7A 4JBHA 5DSZA 3S2SA 5FO0A 4Z3KA 1TMYA 1U7HA 1Y98A 5BN4A 2OG2A 4D8WA 3WY9A 4MMZB 3NNNA 4YO7A 3HGQA 2HC9A 4KWHA 4UULA 5IBPA 3GUYA 2F1RA 2HK9A 5MF6A 5DI3B 1F2UA 2BZGA 3ITDA 1R5OA 3KLNA 2Y1KA 3EWAA 3HWWA 3Q98A 5DRYA 5FBQB 3T7JA 2C7RA 5I9LA 2AL7A 3UG6A 1UQTA 3V4PB 3FPGA 1TYZA 1KYXA 2FY8A 3DKIA 3TCXB 4ACAA 1ZD1A 4PSCA 1Z6TA 5ALTA 3TB6A 2VHTA 2YDYA 4H6VA 3TVDA 3LUKA 1SQSA 1F8XA 4D0RA 2JJ1D 3VMFA 5IULC 1IXZA 3A58B 2D2IA 5FYDA 3UT5B 4F11A 3OPYI 4Y0NA 2I8CA 3SZMA 2CE7A 3FUTA 3JZFA 5CFPA 3EZGA 4PIPA 2YHIB 1DUVG 1Z6AA 2Q1SA 1F5NA 1JWAB 3O8BA 2AJBA 3QSGA 3I05A 3UHAA 3K1AA 3QE4A 3P2MA 2OHGA 1CIJA 3VNVA 4BWYA 3H86A 3QW4B 2ORWA 3VMMA 4AYWA 2XKKA 1JT2A 1VP9A 4AJNA 3U4QB 4B3SB 4M86A 4BZZA 2D2FA 3OJOA 1QE0A 3LBNA 4BNNA 2A7QA 5ITVA 1VCNA 3UWOA 1E0KA 2ID7A 121PA 4Z51A 2JLAA 2FYTA 2L18A 1JAYA 3S2IA 3GUCA 2XTJA 2Q1XA 3BMQB 1HE3A 4Y0AA 5K0BA 4RK6A 3U3MA 1WULS 3BSYA 3QVGA 2DUWA 3CEPB 4RABA 1ECCA 1QS0A 4XB2A 3Q7IA 5AK4A 2W4QA 4I1YA 2AHOA 3R09A 4K6OA 4Q4HA 2N46A 3A2MA 4WVFA 4FX5A 5TQJA 4C87A 4YGXB 3VU9B 4YBRA 3MJEA 1G3UA 2IP1A 3G9TA 3OHPA 2AI3A 3ESQA 3ACBA 5T3UA 3HZZA 3L6EA 3QKRA 2PE5A 1GHTA 1JDBC 1JN0A 1QMGA 1U1IA 2V6MA 3BG5A 3KQMA 3NASA 3ZQJA 2ZR9A 1FEZA 2EL7A 2VAPA 1ZL0A 3AR7A 2LCQA 1SFRA 4QG3A 5ITSA 5HNKA 2X6QA 4WASA 3T1HB 2WD7B 3FBGA 4B31A 3EY9A 4Q9DA 4UNSA 4XTRA 3ZVMA 4U1RA 1J8QA 3HKEA 1DFGA 5FBWB 2RKOA 4MTCA 1GTZA 1UEXC 2XXBA 2G0AA 1YK0A 3FLEA 3I6ZA 3MWJA 3WLPA 5A5VA 2OHOA 1GV1A 5ALNA 1U0BB 1KMHB 3ZBTA 5C1BA 1YKGA 3R5KA 3U0BA 2YW2A 3N9IA 3X0DA 4AY3A 3DWGA 1ISJA 3A31A 3ND7A 1WXEA 1F20A 1BNCA 2VUIB 2Y1OA 4R84A 2I65A 4DJDC 4BOYA 3OCYA 1NLFA 3RWOA 1I94B 5HRAA 4FINA 2FFHA 1GTMA 1PLKA 4OLFA 1IBMB 2WJZB 1ICEA 2W6OA 3OC6A 4TMKA 1SOAA 1VHLA 2WFAA 1O77A 2XNJA 3KQNA 2HRRA 4K03A 2GR9A 3K5HA 2OB2A 3CU5A 4Y18A 3QJYA 5IM4A 3MWKA 1FSPA 2V5AA 1NHGA 4W5NA 1A72A 4E32A 2FZEA 4TLAA 1NLMA 2PL1A 4JX9A 1NI4B 2HBRA 2QLNA 5D87A 1RYHA 4UU1A 3V1MA 2IYFA 3K9QO 4YAGA 3TJZA 3BWBA 4K46A 5K3SA 1H4VB 2J7PD 2XNSA 1UKVY 1JIJA 3E5RA 1MJNA 3E7WA 1FNBA 3L5OA 4ZOBA 2UU9B 3FOZA 2B8TA 5FTLA 3LCJA 2ID9A 3MGAA 3AHFA 4IDBA 4IIUA 1G1MA 3NBFA 1JILA 1QCDA 4A8PA 3DG9A 3WOVA 4IUBS 5DI9A 4CBVA 2F1IA 1ZW1A 1VE6A 2ZI3A 3GF4A 1SGWA 3BQNB 4NCHA 5DOZA 5I9MA 1YZFA 2O5CA 2Q5EA 4PX2A 4LYEA 5A5DA 1BDBA 2WHRA 5FEMA 3AY6A 2YMLA 2HWYA 3CLKA 3NP9A 3EWIA 5DHTA 1TPYA 2ZT7A 2XMDA 5EGSA 3FIUA 1TUGA 4YAFA 4BX8A 5FOTA 4IQ8A 1ISGA 1T9HA 3LLVA 3PQ6A 2WSYB 4ARSA 2B9VA 3CNQS 2COUA 1GIAA 4EGCB 5CLFA 1K4YA 2V6GA 3C41J 1U4NA 3PC2A 4MKFA 5BO5A 3HCBA 4O4LF 3AV3A 4XSHA 4XUDA 1HTBA 2B8JA 1EZZA 5DTMA 4V1CI 1YRLA 3IP5A 3HJCA 3HM2A 1YHNA 5H80A 1I4EB 4P4SA 5H4GA 4C0JA 2ZRCA 2H5JA 3VOTA 1QE3A 4UD6A 3W8NA 5I6DA 4C14A 5LLDA 2TYSB 5B64A 2B1JA 1T3GA 1Z7YA 4CM9D 2B3TA 3WR5A 3LYHA 2QPAA 5DYYA 3GRAA 4J91A 4DS3A 2SICE 5BWMA 2OCXA 5B53A 4BRWA 4ZHQB 1XVIA 2OXEA 2J5BA 1NFFA 1XWWA 1EMDA 2R00C 3LBIA 4DJ5X 5JS8A 3BMXA 1BWRA 4C4AA 3O2NA 3ZHOA 3RAPR 3B82A 3ZWAA 1AA9A 1Q7EA 2QUAA 3HR8A 3IULA 1RI3A 2JJ1A 1LFAA 2ACWA 2LXNA 2ZDHA 2V4UA 3ZU5A 2XWSA 3WI7A 4NE7A 1R4MA 1P39A 5JMTA 4WINA 3KQYA 2FPGB 4MW9A 3BFKA 3GX1A 3FH0A 1JXAA 1T9GR 3A1VA 5LQNA 4YRKA 1IEXA 1Z25A 3JQ8A 1O58A 1JV2B 3HACA 1MX9A 1LWOA 4KE8A 5KYXA 1SU6A 3K0EA 5IVDA 3RC7A 1NUQA 2BR4A 4HQFA 1Z7BA 4MGEA 4OATA 1SM4A 4UE6A 1PFQA 5A3JA 3NNDA 2VAMA 1NBMD 3ENWA 3TKAA 1Q7RA 2H5IA 1RKUA 3BRWD 1UXHA 1FDRA 4L8FA 2HR1A 4TMZA 1WS6A 4MZDA 4M0DA 2I7VA 3RRZA 4B87A 1QKIA 1X1TA 1O6GA 5DBIA 4IJWA 5DV9A 5H7XA 3A6ZA 4EPWA 3DDHA 4B1FA 3PS9A 3V7YA 5HKBA 1GFZA 3B7PA 1J5XA 1GARA 4OJQA 2IHYA 3UIEA 5ISMA 2WZCA 3IDZA 4JNCA 2ES4A 5LP6B 1QHHB 4EW3A 1SXJD 1XFDA 3CZ5A 4OLJA 2DUMA 2Q50A 1Z75A 1XZIA 2DQ4A 1MDBA 1JYFA 2VK4A 4EO4A 5L95A 3B3JA 1UJ4A 1UT6A 4IHJA 2XGGA 3KXDA 3QQ5A 4OXRA 4NP6A 4B7ZA 2IP4A 5I8WA 2ZSBA 1L7OA 5DOVA 1PS8A 3KZXA 4XYBA 5E6RA 2J41A 2WKRA 3I2IA 3I83A 3WDKA 3ZDFA 4BAZA 2G1PA 2NTEA 3MLAA 5AK6A 3CCBA 4G5OA 5J5AA 4PM4A 3RSSA 3UCEA 1Q15A 4QUEA 3L6UA 4P31A 1MRNA 4FBGA 5AKKA 4F86A 2W6ID 2X5KO 1J39A 2O0KA 4TKVB 2JLZA 3GRZA 1W5BA 1YFKA 1FQKA 1AXEA 3HKDA 3UQZA 4H6PA 3BHNA 1SG6A 3C8HA 1ZGCA 3H5OA 5A71A 1QTRA 5JD6A 1W0KD 1W1WA 1ADCA 5DE3A 3AUUA 2C7BA 1Y1KE 3VPBA 1MB4A 4ZODA 4EATA 1Y6JA 4X90A 3B85A 7REQA 1M1ZA 1QGUA 5IZCA 1H8HD 1EE2A 2YC4C 5EZQA 1JHRA 4KOEC 1AG9A 1CDEA 4K2HA 1N8KA 4PRLA 3IQEA 4CG2A 1CUVA 1JQEA 1F7VA 2J7PA 2VXOA 4UAUA 1HLDA 3L7DA 3I6MA 2P1RA 4JXZA 4ZI7F 4RGYA 5HSGA 5JBQA 1RS0A 1DXYA 1JDVA 3IVXA 5LZ2A 4DF3A 3GPBA 5I7FA 2QRHA 1NUTA 5CM2Z 2Q45A 3OEYA 4N6NA 1ZGBA 1VL5A 3I9MA 4KITB 1UEIA 3A06A 1FK8A 3BXXA 1NZJA 5ADUS 1N5JA 3MD0A 3UBTA 1GDTA 3T0FA 5JAMA 3IAUA 3DE2X 2PWZA 2XYQA 1X2EA 5I8PA 3V97A 3HBAA 4L72A 1CHNA 4TSRA 1GZ4A 1RCUA 5C1PA 1EQUA 5BSKA 3BE8A 3BJRA 1GL7A 4QRIA 1ISPA 4JJFA 3SE7A 1R1DA 1YZVA 2A0FA 4XGRA 1R10A 3DOHA 4BC1A 2XXAB 1P72A 2PSFA 2VRBA 2OFPA 4X3OA 5LM3A 4KR6A 4Y7DA 4MHTA 3R3ZA 1P4SA 2BR5A 2PUTA 3WLNA 3C3DA 3W77A 1JHQA 3C2QA 4LMPA 2PUWA 1TUBB 1CDOA 1WAMA 5ED0A 1MQ9A 1Y4ZA 4OBEA 2AG6A 1FFHA 2OMEA 3LUPA 5A6SB 1XJQA 4R40A 4KRYA 2HA6A 4QKQA 1K6JA 3WRVA 3LKVA 4LXYA 1GL6A 4YV7A 1SJ9A 2YJZA 3MG9A 3L9XA 2R79A 4ES6A 1VPEA 1B6GA 1LSSA 2FLVA 3CLTC 4BYMA 3DFKA 4H35A 2BFMA 4DLPA 1CZLA 3PG5A 4PLWA 4YAWA 1NM5A 4M99A 4EUKA 3JVUA 5KQMA 4YMHA 1HUQA 1CR6A 4QJ3A 1AN9A 4UBIA 4E2ZA 3WADA 4L27A 2C98A 2IPAB 4BKMA 2HRZA 5BXQC 3UA4A 4AIIA 4JJ8A 2W90A 4LC9A 3W2EA 1RKVA 2AXNA 2D8AA 2VWQA 3H4TA 5JAPA 3WVNA 1R4NA 4XOIA 2PMBA 2B8WA 4MQEA 3MN1A 4QDXA 1T2DA 1T25A 5FULA 4CM7A 4ZDIA 5BQ3A 1NWCA 2O7QA 4YA6A 3MUNA 1O87A 3CCFA 3DEJA 4HX9A 4P8RA 5EKTA 1VLZA 3CVXA 5CFNA 5EJFA 1PU2A 4UQLA 4LNHA 5GTDA 5L6LB 1I2CA 1TIKA 2L2QA 2I4LA 1D4OA 4JCCA 4P33A 4DCMA 5K01A 2V4ZA 3HMKA 2JLBA 2BEUA 4L07A 1MTZA 3T7CA 1MB2A 3W8EA 3H2BA 5JI2E 2BM1A 4OX9B 1TK2A 1EVYA 2JFZA 4Y30A 1ZMXA 2I4OA 2X8WA 2VI5A 4U8GA 3VYWA 4MRPA 4YX9A 1X1EA 5LCXA 3VNQA 4HB4A 3VPSA 2WFZA 1GLGA 1XD8A 1M6YA 5HQ3A 1JXQA 1NBMA 1QK4A 1TZMA 2Y0CA 4JQYA 3BRWA 5M3BA 4AX4A 2V55B 2J45A 2CKMA 3WLLA 2GQ0A 3ED5A 5IKOA 3COPA 3U7QA 4XQ0A 1LQ2A 1X1DA 2XVZA 2JCBA 5FPPA 3T3MB 1J2JA 4PYOA 2IEYA 4FOOA 2RJNA 1O57A 4EPXA 4YIHA 3RFVA 5A7HA 1EGVB 5B1HA 3E9NA 3RREA 2VJMA 1JDZA 3NW9A 5BQ5A 2FJUA 1H1TA 3TW8B 3GJRA 1LQUA 1XDDA 1N3YA 1ZJ5A 3UJDA 1Q7BA 2G08A 1M7BA 3UOGA 1SXJA 4HPJB 4UHJA 3PGLA 4RXTA 1E2JA 4JA2A 3THRA 1C8KA 3X1MA 3Q9LA 4B7XA 4D44A 4EKIA 2NXEA 3GJQA 3H05A 2V7GA 1YFLA 3I9V1 4Q1CA 5ILQA 1DP4A 1EFCA 5A05A 3WNCA 3BD9A 1L9XA 2OA0A 3D02A 4OU4A 1KXJA 5G4KB 3SS8A 1IE3A 1IBKB 2I0FA 3QUTA 4C5BA 7ADHA 3SSOA 5IXJA 2PJUA 4BO1A 1EFUA 4YPVA 1T0UA 2WE8A 3I12A 1JEJA 1X1QA 4FDUA 3Q85A 2QD4A 2GD1O 2R1TB 1SIOA 3ECSA 3S28A 3PXUA 2W6IA 1JVNA 1MO3A 1RCTE 4G65A 4XD7A 1TTPB 1RABA 2A9FA 5HE9A 1EFAA 1TOAA 3CXUA 4GLOA 4YP1A 3W5UA 3ZX5A 3HA3A 1OD6A 3LBAA 2E4YA 3PCRB 3F5SA 3QVLA 1HFKA 2O0MA 4LXQA 4CLHA 5CFOA 2WF7A 1W0KA 3AF3A 2QD2A 4KQ1A 3IPRA 3QXGA 1XA0A 2C4NA 4LTMA 1BJTA 4EDFA 3SOZA 2GILA 3JQ7B 1IWOA 3LLSA 3HLKA 3T1NA 1B6RA 1H8HA 5DHAA 4UNQA 3W79A 3ZXSA 4AJ9A 4K9LA 4MVJM 2ZZKA 1SB8A 2A9OA 1IB0A 2J5RA 2VNIA 2I4MA 3F5DA 1SUSA 4WOKA 3IQFA 4C5AA 2A1TR 1XTZA 1XZFA 1OROA 2JGAA 2H16A 1OWOA 2XAAA 5JJBA 4DSNA 1QDUA 4ZVNA 1DPGA 4QU5A 2IYOA 1JPVA 1P9WA 3K4PA 3VUEA 3DZIA 3OCVA 1OXVA 2CCJA 4N18A 1DMRA 1ZVVA 1OFUX 1G2PA 3F73A 4HGNA 1JTEA 1TLLA 4JLKA 2W8ZA 3Q41A 3QVMA 1JXMA 4G9BA 4HQ0A 4M1KA 4GMKA 1G3QA 3FUXA 3TOSA 1U0TA 1WB9A 3G9QA 4C4TA 4Z4HA 2YMMA 3JYPA 1ONBA 2WEKA 2PVPA 4K81B 1LLCA 1IZ7A 1WIWA 1R8JA 4D9FA 1US8B 1CR1A 2PRIA 5JMWA 5JXGA 2ZBRA 2F17A 3ZHTA 3PFHA 3KJZA 2Z8YA 4RPJA 4BCCA 1DEKA 3CEAA 4YNBA 4GDMA 4GD3Q 1BSVA 1JF8A 3CQ9A 5DWDA 1JKFA 3B8HA 4FR0A 3RLIA 3V3TA 2JI8A 4OMFG 4A8JA 2FF5A 1M8GA 2IDMA 1KQNA 2PZBA 3E4CA 3C39A 1YCHA 5CT5A 2M6RA 2I76A 3LFTA 1LRLA 1XCGB 4B6FA 1CVLA 2TMDA 3EC1A 3KO8A 4BAGA 2DTDA 1GPUA 1Q7TA 5BW5A 4IJMA 2CDNA 2NU7B 2ZW9A 4KI0A 4LJYA 1SNYA 5EPEA 1Z7GA 5IFLA 4D0SA 4N3NA 2I6TA 4ZC1A 2W2NA 1GL3A 2ZQ5A 4TLLB 1I6KA 2H0RA 3JWEA 5GV8A 3JALA 2HCTA 4KR0A 1NC3A 1S2DA 1U7PA 2C0PA 5KYWB 3FPHA 1YA8A 1K3FA 2J30A 3GW8A 4M9ZA 2REOA 3DQQA 3GMTA 1CUUA 3AEUB 4DUYB 4Q9LA 4S12A 4EEKA 1CT9A 4OYYA 3MGCA 5BOVA 3LBYA 3BWEA 4HNRA 4IJ5A 4C9BA 4DCUA 3CWQA 3GLHE 4LDRA 4ND3A 5EZSA 3USCS 3VC7A 4XWOA 4YRIA 2KWIA 5FOQA 3L01A 3IHLA 5D7BA 1K0FA 4BEJA 3W9YA 4ON9A 5F1KA 1UK6A 5AJXA 4QM7A 4PG4A 2B2CA 4PN3A 2OO5A 5BMVF 4YAIA 1X1CA 3WLMA 2DBQA 5IDVA 2P11A 2WF6A 3UA3A 4CFYA 2HMAA 4E14A 2C2MA 2IW1A 1GXSB 4HNVA 4RM3A 4DMMA 3W34A 4LG1A 5KVVA 4MARA 5KTRA 3SGLA 1GSIA 4H7PA 3P0IA 1E5XA 2XWPA 3OZRA 4EG6A 1GRRA 2H8KA 3GCDA 3IXLA 4BWGA 1KQGA 2JFQA 5H3LA 1C8LA 4PAMA 5F2NA 3QW2A 3SJ7A 3ZTYA 4FGKA 3OZDA 3H6KA 3KBBA 4D9KA 2J67A 2AOTB 2JIRA 1I7NA 2XQVA 2BMDA 4TTQA 3ZU3A 1E98A 5E3HA 4F9FA 4RYDA 3W2GA 1U3UA 2VDUE 3IR6A 3EXEA 4N0EA 5E0OA 5LP1A 5LQCA 2D7JA 2W2VA 5FHRA 1FFXB 4R1UA 4BKUA 3OLQA 3H5IA 1DJPA 3O82A 4QU8A 5FORA 1XEXB 3K1JA 4L28A 5AW9A 4AXBA 3QFFA 4C4RA 3VKGA 2ZBUA 3HRIA 1BHJA 4XSGA 3RKRA 1BEEA 1CZOA 2GAIA 3B6EA 4M6WB 3TOCA 2A9PA 4E09A 4TV9B 2H1RA 3PICA 4W5WA 2BSXA 1Z12A 4YI3A 2ZITA 3KKZA 3GMDA 2AN1A 2BEWB 3DBRA 4MQUA 4BGIA 4DA0A 4A6PA 4JZYA 1UM8A 1QMPA 3LCCA 5DT2A 4LHVA 1OKKA 1D2NA 2P4SA 2Y67A 5G1NA 3BH6A 4AICA 5EJ6A 2ZSAA 1SA0A 1CUCA 1S2GA 1WVIA 2BEVA 1F51E 3OE1A 2JI9A 5IVKA 2PS9A 2FQYA 2G6BA 2C2KA 2HPHA 2ROQA 4EUHA 5B1YA 3JQAD 2D5BA 2QL9A 4EB3A 1KERA 5C80A 1ODCA 4Y2YA 2RMKA 3EFOB 2Z56A 1J9GA 3I9FA 4OCZA 4UJ5A 3KEGA 2ALJA 3VAZA 2PBLA 4L4YA 1FVXA 3NYQA 3FB4A 5HBGA 3HK2A 4WX2B 4QQ8A 1LPBB 1BROA 4CCYA 5TQ2B 3S27A 4BVKA 1WXQA 1MP0A 3TZBA 1G21E 1R4AA 4UCFA 5DNYB 2VYQA 2MMCA 3DEHA 1XRQA 1YRQA 3K8ZA 1EJ6A 2IXEA 721PA 2V6JA 3T38A 4KX5A 3ANNA 1U0GA 3UM9A 5CPBA 4A03A 1ZNQO 1KVUA 1B93A 1ZH6A 1XN1A 3ETHA 2XWBF 1C30B 3LOUA 1KEEB 5A0FA 2AOUA 3FNHA 4JLVA 5LZ5A 2J07A 2NUAA 4TT3D 2IPOA 2PKWA 4G81A 4CODB 2A2ZA 3TYXA 1VBNA 2RHDA 2X8JB 2QRVA 4FIDA 4LBVA 4N5MA 3RRYA 5I7UA 3SWWA 4IHKA 2I1QA 2DUJA 2VHUA 3QHQA 2FN9A 4QUBA 4QFCA 2OYSA 1SHUX 2Z9DA 4BO6A 1DPFA 4AJIA 1OXMA 1LSOA 1H5QA 3OEED 4DUZB 1IN8A 3R5HA 3P9RA 5F23A 3G7UA 2CL7X 4A26A 3RUFA 2QRPA 3ZE8A 3LWZA 1FW6A 2B5OA 1X9IA 3NGMA 2QTBA 1E2FA 1FYXA 3TCNA 1G64A 1YCFA 2GEKA 4C7MA 1N7IA 3KC2A 1E77A 1PJQA 3VHRA 1JT9A 2CNKA 3AKEA 4F71A 3EZ7A 3EW9A 1CZKA 1ZH8A 1KK1A 2VNJA 3EGXB 3FGPA 4CL3A 3F9CA 4Y9SA 3LSTA 1GO2A 4JI0B 4HQOA 1NVGA 3TD9A 4Q7MB 4B7CA 4CYMA 3F2IA 1QG0A 1QGYA 1S9DA 2E4XA 3FNEA 3IB3A 4MS1A 1GDHA 4AJ4A 1Q0QA 3DULA 3E5HA 1V6SA 1M6WA 2QL6A 4WBSA 5DCYA 3TIGA 4C4ZA 2Q21A 1CE8A 3AHHA 1RHRA 3G68A 1GAJA 3FDIA 3ROTA 5K3FA 2YS7A 1A88A 2Q5OA 2HJHA 4TTVA 1X70A 3VSEA 4XVUA 3V6LA 2JFBA 4JC5A 3OP4A 1DXHA 1E1MA 4J90A 4NBTA 4OA5A 1LJLA 4O2BF 1T9BA 3ND5A 1EB8A 4Z4QA 4A23A 1RMTA 3E3LA 1FFGA 1GRVA 4OAQA 3EY4A 2JIQA 2IOHA 3EPJA 2GRUA 3UJPA 3SVZA 3MUFA 3T5CA 1U81A 1PV4A 3WBFA 4A10A 1L3BA 1T4MA 3PUYA 2GCIA 4NV3A 5EKXA 3G49A 2P9GA 1K9SA 2G0TA 3IO3A 4Q24A 5TQ0B 3WGVA 3NHPA 4DCJA 4NZYA 4D8YA 1JDNA 3FOBA 2KM1A 3ONFA 4FCCA 4IDOA 3JRXA 5L3RA 3EIFA 1YA4A 3FPKA 4NCIA 8ATCA 3ZXIA 4JBYA 3SC4A 5EJ5A 3U9TA 1CQJB 3KJEA 3L8CA 4G5RA 1RE1A 2QTHA 2SBTA 2PBFA 3NGLA 1HL3A 3TSYA 3CBGA 3USZA 1KE1A 4BMXA 1CW2B 2GTIA 4F2WA 1DAGA 4BNJA 1WVGA 1Z13A 2O6LA 3EG5A 3PC4A 1II8A 2B1QA 1R74A 2H2DA 3E35A 2H2GA 5BP7A 2EEPA 4BO8A 3PNPA 4IUYA 1ZSYA 4FI3F 2XITA 3SDZA 4JLDA 4A2PA 4HF7A 1F6WA 1NP6A 2E4UA 3BL8A 3DWFA 2DP4E 1LI4A 1UXOA 2JAUA 3FF4A 4N3BA 3U40A 3HB4X 3V1UA 3R0JA 3PEYA 3PVCA 4LFCB 3T5MA 4UM9B 2HSGA 1C9EA 2NAFA 5CH3A 4P3KA 5A3RA 1D6SA 1Z26A 4JSRA 4RPGA 4D0LB 5BYKA 3B38A 3ZU2A 4DC9A 3D6AA 4HNSA 1M83A 1FCJA 2QN9A 3I6IA 4IIJB 4QT4A 4AT1A 4FE4A 3RTDA 4F12A 1C14A 4MRVA 4GM0A 4L6CA 1FUUA 2EX4A 2ORIA 2IZ5A 4RSMA 3CINA 1WXHA 4OI4A 4CKEA 3NG1A 4RPIA 3H75A 3JQAA 1EVZA 3TTSA 5KYUA 4W5OA 5JNUA 1K5PA 3LA6A 4R8KA 4DABA 1O4VA 5C5EA 2PX0A 3KQWA 4A0GA 4DSZA 5AM1A 1ZIDA 4ZV4A 1FRQA 4TMYA 2HADA 2OEPA 4V24A 4RJJA 1KY4A 2RSLA 1ZOPA 3E81A 1FXWF 4N40A 4MHSA 2WWHA 4QDUA 4B6SA 6AT1A 2D74A 4U7JA 5BUCA 5FNVB 1N6IA 1WM1A 4YRMA 1KRXA 4F3RA 1BH6A 2WTXA 4FOSA 3IIKA 4FBLA 1J8DA 4FONA 4UNRA 4DY4A 1URPA 3B3AA 3U17A 3P5BA 1DHRA 3EIUA 1AURA 1MORA 3EUWA 1KI4A 1A9RA 4ARUA 4RW0A 4QO7A 5EMJA 1H3EA 1UQRA 3D0OA 1FC0A 3R3WA 3CO5A 3LCVB 3I9OA 5C7OO 3FTFA 2Z4TA 3BMOA 1ADBA 4FZRA 4FSXA 4WQMA 2X0RA 4DCGA 3FKQA 4TT3A 5DEIA 1EXNA 1RYNA 1NYQA 1SY7A 3A37A 1Y0BA 1RT9A 3CZAA 2UUCB 2XZOA 3KYIB 3HSYA 5IT0A 1IOWA 2EP8A 4HR7A 1V45E 4AZ3A 1G19A 3OEEA 1QH1B 4FNGA 2J09A 3WQQA 1YVRA 1X7XA 3Q7SA 2PGIA 3UGQA 3UHOA 1AHIA 4DDMA 2HREA 4NMHA 1WO8A 4WOCA 1VRWA 4I81A 3D4PA 1NW8A 3LOQA 5FUBA 1M6VA 3S40A 1RLTA 4LF8B 3UN1A 5L3VA 2H54A 4XCXA 4DJTA 1FL9A 2ECOA 1ODIA 1RM0A 2G9ZA 2V59A 3A6HA 5DNVA 4AS3A 2IEGA 3FR7A 4ZO4A 2F1HA 4K40A 1GR0A 5BURA 4CKBB 3OM1A 3KOUA 4MV4A 1U8UA 4F5DA 3IDOA 1WX1A 3JV7A 2HD4A 4Q37A 4B34A 2AWNA 4C76A 2C9MA 3EK2A 4F4HA 3PT5A 4BFZA 1KHTA 3K31A 5TDHA 4EHDA 4BL5A 2BOVA 3CUEF 3TLCA 1NX9A 1FP4A 4ZYWA 3QVOA 4KUGA 3NTXA 1E8NA 1Y37A 3RVOA 5IUNC 1NP7A 1XAIA 2A8YA 2EQ5A 5F3DA 4KIWA 3WL5A 3LLMA 1RRGA 3ND8A 3KTAA 5AM0A 3CRNA 1Q12A 2QEQA 4G0XA 3WLSA 2HF2A 2CNDA 2EHJA 5C3UA 2FMHA 2NV0A 4I50B 1QFZA 2C1XA 5JH7B 3VBEA 3RROA 2RCYA 3RIHA 4Q9JA 2VAVA 1M34A 1OREA 1V1JA 2PFSA 1ZW6A 3C85A 4YFYA 1JQLB 1XFAA 3KKOA 2EATA 3F7MA 3T1QA 2QZPA 2IZ6A 4U02A 3DDNA 4U7GA 1AZWA 1M76A 4XFJA 3EXFA 3INTA 5IUJC 1JHPA 2E1RA 4MVJH 1MW9X 3ABQB 3A1SA 1CEXA 3EUFA 3ZJ4A 2C3UA 3KQLA 1VCHA 2XYVA 1YB7A 1Y5RA 1D9XA 3K6KA 4JLBA 4JVMA 5LR6A 1GZ5A 5FPYA 2UYYA 3L7AA 3KXPA 3R0IA 1CUJA 2GPSA 4XR4A 4FOPA 1F2VA 4PZAA 5DBGA 1E2DA 1N3BA 3LKDA 4I55B 4D4HA 2ZYVX 3GFFA 4IF6A 4BE7B 3TQFA 2F3UA 4HGRA 4JFAA 3RLFA 1UKZA 3HU2A 4MS3A 2FX5A 4XRRA 3MB5A 2FZ5A 3LPLA 4F4IA 1ZWKA 2WDPA 1G5IA 4CHTA 2AZ4A 4N76A 2Q1WA 2G3YA 3DM9B 3DYBA 5CB0A 4CQNA 3DE6X 4P92A 2ZBFA 3OTOB 1B74A 1WJGA 2RG1A 3RSOA 4DYDA 2TMGA 2HJ9A 4P3YA 1UC4B 1WSDA 5EZYF 1XRRA 2GVNA 3HB1A 4Q9AA 3SJZA 3H1GA 4P6VF 4KN9S 4YAUA 1HDZA 1CEYA 2VZEA 3W2TA 3N0WA 2E4WA 4FGLA 1NJGA 1NJ5A 2D1RA 1N5KA 1NPTO 3OMXA 4OQLA 2I67A 4NV0A 2OBFA 3VI4B 1BXRA 1ZLYA 2BVNA 1M2WA 5CLHA 5AJWA 4F6RA 1UBKS 3Q12A 2C5LA 3GWZA 5AUNB 3COWA 4UEWA 4WN3A 3QITA 1SKAA 2Q99A 4HBGA 1N8SA 4OHRA 1TB4A 3WQSB 5ABPA 2ZM6B 3MTDA 1CUEA 3EXAA 3QKSB 4H17A 3SQOA 1RJFA 3WXMA 2OHJA 4AK9A 1UINA 3QEAZ 1VJDA 1U4OA 4Z6KA 4RD3A 3UNXA 1SKMA 1Y8QA 3BB4A 1J2UA 4WGFA 1OAKA 4GGPA 1PAUA 2N1BA 3DYVA 2YXDA 4OEHA 1XVVA 4FR5A 2BEKA 1RJGA 2OWDA 1YZUA 1K0UA 1OAOC 5EXXA 3A6EA 3BGSA 5G4LA 1K92A 3WP1B 2H59A 3O73A 2ODBA 1F1BA 4AQ7A 3O5AA 1KY2A 1KBOA 3BC1A 3RHSA 4N7MA 3VUFA 2H2WA 1WUHS 4DSTA 4MR9A 5C1OA 2ZB2A 2QZZA 4X1KA 5IX8A 2XT0A 3HUEA 4Z9AA 3PD1A 3HFJA 4LTNA 1D9ZA 5C1DA 3PPWA 4ZVOA 2GI4A 3BE4A 3AU8A 4DQVA 4ENTA 4DFDA 2FTKE 4CKCB 2KMLA 1ADGA 1J06A 2FF7A 3N75A 1VKHA 1E9RA 2HFKA 3HKCA 3RU9A 1JEDA 4GMXA 3V2GA 2I1VB 1RZVA 3NU1A 3I01A 3P9IA 5JNLA 1E3EA 1O95C 2WJHA 1N5MA 1WZIA 5K8IA 2Z6QA 2GK3A 1XV5A 1E9AA 2BFOA 3QWHA 1JHVA 4AN0A 1J6UA 5E3JA 4S1OA 1NLZA 2H7VA 3PI6A 5IHPA 4OK6A 4GDFA 1Z3CA 4K6KA 2B5WA 1QHIA 2ZPAA 2VPTA 4MLCA 1L9KA 4X45A 1C50A 3ZXXA 3EHEA 3ER8A 2F1KA 3K0AB 2PD4A 3UXYA 2PM8A 2P4QA 1UMKA 4EHAA 4PHFA 3HR4A 3TI9A 2WHXA 1FTGA 3G0OA 4WNCA 5B37A 4JT8A 4W99A 2ZEJA 1AQUA 1ORIA 2NP7A 2OO3A 3G2OA 2VPYA 3VR4H 5E6SB 2GRJA 4J7AA 3O1IC 3O8LA 4TXLA 4BNLA 1O9HA 4Q9HA 3PEUA 3AV0B 2A35A 2GSWA 3NR2A 5FP0A 3DCNA 3T0IA 2HBQA 3FUVA 5H0IA 1E6MA 2K5UA 3QPDA 3DZGA 5AD1A 1KEZA 1I3MA 3KJIA 4A16A 2GT1A 1L6RA 1I1HA 3HDJA 1O4WA 4Y2HA 4R2HA 1RQLA 1Z0IA 5D7NA 4QEDA 4JASB 1MN6A 4DCTA 2N0SA 2OMKA 2ZR0A 1GG9A 1N77A 1N2GA 2Q9BA 4A2QA 1H2BA 4G26A 1WPQA 4Q7QA 1U7TA 1C8VB 4L2IB 1P18A 1KVQA 2DU8A 3PEEA 4JD5A 4DKJA 4MX8A 5LKRA 3PFKA 3H04A 2GGSA 1T29A 3VOBA 3GBSA 2QG6A 1TT5A 3MRTA 3FCAA 1Z2CA 1YB2A 3D8HA 3HM9A 1JLSA 2ZATA 4JEUA 1BQEA 3CLVA 1T5IA 4RZIA 4TKUB 3EGOA 3L6BA 4PC7A 1NV9A 3RRMA 5GINE 3LE8A 5LXTB 3ZD9A 3T15A 5CA0F 2ORVA 1OFTA 2YVQA 4LYYA 3TIIA 1LBEA 2JCVA 3C3MA 2AMJA 1MW8X 2I2XB 3OX4A 3I2JA 1UWCA 4AULA 4BEBA 4E4YA 4MWDA 3BT7A 2RG7A 3R7NA 4OKNA 2OVBA 4YP9A 1T3LA 3OOWA 3EXHB 4BB0A 4H59A 2NSDA 1N3LA 2R7AA 1QC5B 3JR3A 5LVAA 3ENVA 1NULA 3D2CA 3JQQA 3O9MA 4FQ7A 4D98A 1OI7A 2I54A 3AETB 1BD4A 4MVWA 5D6OA 5GONB 4I4TB 3O8OB 1JYSA 1M1UA 1KE2A 4C7OB 4BLRA 1HA3A 1SVWA 4X20B 2W4MA 1C0KA 4LZPA 3GRVA 4BPRA 2GN6A 1Z4NA 4HLNA 2F3PA 2E82A 2NOAA 1CJMA 2IUSA 4WDRA 4EB0A 5IN4A 1SC9A 3TUJC 3RJ9A 2IF2A 3IVMA 3G1UA 1LDNA 3I37X 2WT4A 5CVUA 3RS5A 1OA1A 2JATA 3H8WA 5AXCA 4D4GA 1K8XB 4PV7A 1B41A 3T3EA 5AM4A 4BNHA 4CQMB 3KWLA 1V16A 3VJMA 4QODA 2RBKA 2NO7A 1KDRA 3KB6A 4B44A 4DVJA 4UZSA 4Z4EA 2JGDA 2VCHA 1H2EA 2REQA 1Z4JA 5G0SA 1NWHA 2AF4C 1XZAA 4LDJA 4JXKA 1G21A 3ZC3A 1XVTA 2FK7A 4Y2SA 1CB7A 1WV1A 1W36B 5EN4A 3NRJA 4Q4JA 1BWQA 4M36A 2O20A 2VP2A 4LZZA 5KTMA 3HNRA 4OLHA 4ENUA 4ZK6A 4Q82A 1EUDB 2WJ6A 2FPKA 1UP6A 4M37A 3IEPA 2C2XA 2VOJA 4O1HA 3BGWA 3ZJ5A 3ZW9A 2PWAA 2K87A 4KXFB 2X4GA 4ZA2A 4LHWA 2QTMA 3KQPA 4AY2A 1NDHA 2IH4A 3NH6A 2BFFB 2WF9A 2F1OA 1SUDA 4H7FA 2R5WA 1G20E 4QFBA 1IXYA 3TSAA 4HLUC 4MO9A 3FOCA 4KN6A 3RH0A 1CF9A 2PLAA 3WK6A 4PBRA 4D8XA 1Q5PA 1JKJB 2NYVA 2YHUA 1TLTA 4EPTA 2HT1A 4R1TA 4RK5A 1PNQA 4NMMA 5EPOA 1MIOB 2O7RA 3VO8A 2WIKA 2IBMA 2F9FA 4JELA 5FT9A 4I50F 4EJSA 4KNWA 2J3IA 3KR0A 5JH7F 2XPCA 3IP7A 3ILVA 3GLTA 1VTKA 1QCYA 4C30A 4TXJA 2FZGA 4FSDA 3ZHCA 1UJ6A 4D0NA 5LOVA 1I4OA 1K7XB 3MIIA 5HIKA 1M2OB 3HA7A 4YMVA 4M76B 1ZP6A 3MT8A 4GI3A 3RFTA 2IPLA 1S3FA 2XECA 3O4VA 4XX1A 1K6EA 3HYCA 4MVCA 4WZZA 5IJXA 1HLGA 2O8FB 3WK8A 4QGSA 3G89A 2YKGA 1NJ6A 1I9CA 1Z83A 2AD1A 3CE9A 4XYEA 3UPDA 2CY0A 3BHIA 3JWHA 4OOFA 1BG6A 1L4FA 3VSDA 2OOSA 1QFJA 2JIPA 1UBEA 2Q5IA 3AESB 5C8XA 1DQPA 1P1IA 2IC5A 1RWPA 1N5RA 3PYXA 3SZGA 3WBJA 2CLEB 5KS2A 3G9XA 3EFHA 5EJ4A 2C8KA 3MTGA 1E5VA 3UAXA 5CB4A 2WOJA 4NI5A 4WFIA 1LPPA 1VJTA 4NATA 3WJAA 5C0OE 2XWQA 3PX7A 3RYCB 1YBHA 4CTOA 5GMOA 1IMJA 1Y5LA 4YMWA 1YZYA 4MGZR 1KI3A 4CDMA 3IQWA 1B14A 2ZBQA 4FT2A 2R68A 3S7TA 2XZLA 2XUIA 3DKRA 1V2HE 3LUDA 4XA8A 1KK3A 4NVRA 3RUHA 1TEZA 2PLNA 2Q5HA 4A8HA 4ZVSA 4EFDA 4AY6A 3KQSA 4IVPA 4TVKA 5DM4A 2W0SA 4UBOA 2RD2A 1W5SA 5LLSA 1E3MA 3KALA 5JJLA 4D9IA 3ENZA 5BWBA 4MKRA 7MDHA 1X86B 1TZKA 4UTOA 3ELUA 4YV1A 3NORA 1M1YA 2AFHE 3O4JA 5EHNA 3VHQA 4B32A 1GQRA 3UMBA 2C1ZA 1NV8A 5CDFE 2F4VB 2FSFA 2DBVO 2PFKA 1D0SA 3T8YA 5KJ6A 4JIGA 1U8TA 3MUEA 5DX1A 1N33B 4CV0A 1JIXA 1ZBQA 5U1PA 1V4NA 4C4SA 2FGKA 4W6QA 2AE2A 3AWIA 1UM9B 3DDWA 4DXDA 4GW3A 2FSIA 1VG1A 1PNTA 3LH5A 3DE7X 3H7AA 1C4OA 4GVLA 4IEEA 1XCBA 1DKNA 2VYFA 3LFHA 3NYRA 4I19A 4IL5A 1EI9A 5IJAA 1WLYA 1XXHA 5JATA 3T7KA 1VMEA 3ICOA 2B92A 2IYYA 2ONCA 4HH1A 4C5CA 1JKMA 1GZDA 4JLWA 3E9CA 5IJ0A 1I2AA 1TZBA 2VP4A 3JASB 4UHKA 1UAYA 2C99A 3FCEA 3LI2A 4BCBA 4KWIA 3CVOA 3DAPA 4O6VA 4ZYZA 4OK5A 5EPUA 1HX7A 4KYVA 4E51A 1DUSA 1D6JA 1SCBA 2VSFA 2ZKLA 5CW2A 4WNAA 2Z5LA 4Y6GB 1PR2A 4Y6LA 5AOCA 5K8UA 3P20A 3E27A 3ZKWB 2Z2KA 4HOYA 4NICA 4CM8A 3NDIA 4X8OA 2HLDD 4DXHA 1V43A 3P45A 3V00A 2WINI 5JE8A 2GESA 3PL5A 1P0IA 3VNSA 1R12A 1N0VC 1ZM4A 1SEVA 3CZRA 1NDUA 3AIIA 3OPXA 4QDZA 1A2QA 1J21A 2ODAA 3OI7A 2NTVA 2OBNA 4I4NA 3SNHA 4B83A 5BV0A 4P2BA 1ZUNB 1OX4B 2H1SA 2QN3A 5JCJD 1K3UB 2A92A 4E33A 1Z0KA 2BM9A 3MTQA 2IEIA 5ARDA 3RSFA 1XZ8A 3HO1A 3OOYA 2AJTA 2EV9A 1JAXA 2NXCA 3LQYA 4RF3A 3GZ4A 1N0IA 4B3TB 3GLGA 3OKFA 4Y1FA 3K0FA 1BN6A 1SXIA 1CJKC 1RXIA 4QQNA 1W87A 3W5IA 4Q4AB 2OV6A 4I5DA 4HB2A 2Q4TA 3PHBE 3PFCA 2IEDA 4DCPA 1FXSA 3FDZA 4Z0TA 2HF8A 4LRUA 1LEHA 3M6IA 4XJXA 3GAMA 4PS1A 2C0QA 4H4EA 1H23A 4M0PA 1XJCA 2D5AA 2YX1A 1TF7A 1MNAA 4M55A 3ON5A 1DTSA 4GWKA 4BUCA 4EJ2A 5ALRA 3MINA 1F3OA 3DV0A 5L8VA 4BU0A 2D00A 1UAGA 4H1VA 5HUJA 1T15A 2X0JA 3ABSB 2Q4RA 4KIGA 3WDLA 1MX1A 4JUBA 4RA9A 1ABFA 2FUCA 2RONA 3H84A 4WY8A 4AD8A 1K5GA 3RANA 4V0KA 4NWIA 3ZNOA 5CCXA 1SKYB 1P4JA 3OT5A 1IBSA 1U3DA 4JJ6A 1XE3A 3H0EA 2IYEA 3PD7A 3G82C 5ALWA 2MT9A 3SF8A 5TGDA 3NS7A 4I4IA 2HPVA 3AYZB 3J81k 1P2FA 8ADHA 3VYSB 4IJUA 5IAAA 2V96A 2Q2NA 4XUCA 3SAJA 3QBVA 4PN7A 4DV5B 3TDKA 2O57A 5T41A 4D6YA 4D8TA 1N6LA 2ZRNA 2IK8A 2ZJ3A 5DHUA 1PWHA 5ELLA 4DA4A 2HHJA 3V8NA 2IH2A 1X9HA 3AF1A 3BMNA 2PH7A 2QY6A 1QQ6A 3ANMA 3P2YA 3MVEA 5EIBC 4ACBA 3LHDA 2UDPA 3BYZA 1FX0A 1TT7A 1Y3IA 3G3EA 1RPZA 1E63A 4YJ3A 4REQB 2YY5A 1JMVA 1UK8A 2FSPA 3S2ZA 1MF7A 3O3NB 4N0PA 2Y77A 4QE3A 5LXTF 1Z38A 3WGJA 2NMVA 5KOJB 5DGDA 4N7RA 4JI6B 3MCWA 3Q8KA 2XOXA 1JH8A 2GHTA 3N0RA 3PJRA 1ORTA 2H52A 4AZVA 2O05A 1Z4QA 3X43A 4G0WA 2Q62A 2Y1DA 1XRLA 3M5PA 3QKUA 1C4XA 1O3YA 2YUIA 4NHOA 5CG1A 4B6EA 2XBMA 4D0GA 2FV8A 3DXXA 2H57A 4NL4H 1ACMA 2NADA 1U8YA 1P0FA 2OKGA 2R4TA 3OF2A 3MTBA 4MS4A 5L3ZA 2ONKA 1DZ3A 4UTXA 1E96A 4XAQA 5C8YF 3HUUA 3UFXB 5I7RA 4FBMA 2UKDA 3FFAA 5GONF 1E1RD 1NNI1 3QELA 1ACLA 4I4TF 3FXAA 5K3CA 3CKYA 3E9QA 4GPIB 3THXA 4DBLC 5J4HA 4MVJD 1NVXQ 4O25A 3IR5A 4J0KA 3SFVA 1P1JA 3RUPA 1USUA 3C1TA 4DJAA 2JZNA 1OB5A 1FNMA 4FEYA 1P4AA 2FWIA 2VHCA 5TGZA 4L3OA 3TF5A 2X6RA 1GNVA 1P5RA 2P62A 4XYMA 4Y9UA 4IMRA 3PRHA 1CQPA 2ODWA 1ENPA 4FGUA 2ATCA 5LC1A 3TG2A 5JQWA 3IIIA 4IGIA 1NPDA 4DR5B 2B8NA 4MITA 1TJYA 1HZZA 3DVLA 5AKGA 3C6YA 2BHNA 2BW0A 2E3JA 2QMEA 4ZT4A 3RYHB 2JI7A 4FYHA 4RSGA 3T61A 3I4CA 1X19A 2LUOA 2ZJYA 1R0WA 1E79A 1QHXA 1VB5A 4PAGA 4ZAZA 2B83A 2I62A 4CXMA 1LI5A 3EVZA 4R01A 4RMHA 2WC1A 3V6MA 2C7OA 1ZM2A 3D4IA 3F8WA 4O2RA 4ZAYA 5MN4A 4YVFA 2E5LB 3HU1A 3R74A 3O6VA 3D8NA 1XBTA 1H69A 1TUIA 2H65A 3GRYA 1VHTA 2BAGA 3O91A 4JBXA 2VZ8A 5JSHA 4KI7A 3VVLA 2Y2UA 5MGBA 4V3BA 4X7MA 5G0VA 4RTJA 3GA0A 3K0SA 4PPFA 3AFOA 3LK6A 3EIQA 5CDGA 4OB6A 2V7BA 3UOAB 1I4TD 2HLDA 4ILEA 1LTQA 1ZK1A 2G28A 2OP0A 3CC8A 4XWTA 1E1KA 4KO3S 1DADA 3MJHA 4FC7A 4MRAA 2I3BA 3WNVA 2RBGA 4EBFA 1WXDA 4Y6OA 3VOAA 2OYCA 1C81A 1T4CA 2H18A 4DIFA 1EP3B 1I2BA 2ID8A 2NUPA 1V8DA 2QVYX 1Q83A 3AR5A 4YRPA 3UJHA 3VTAA 5BQXA 3PKIA 5JCJA 5KU1A 3D9QX 1PG0A 3PNBA 1KO7A 1FTYA 1YS4A 2CJWB 4IZIA 1OLSB 3K9WA 1NFQA 4QFMA 4EJSC 1KEKA 3AEKA 1ZH2A 4C0KA 1BXKA 1QVAA 4ZMBA 4NCNA 1TTTA 1TJ4A 2BIFA 3FLBA 3HSKA 1A8QA 1V7QA 1ZVQA 1KMNA 1WTCA 3IA2A 2VJPA 4C0BA 5M7EA 1UBHS 1X7YA 1H1LB 3EJWA 4NH4A 3OUUA 5B4VA 1VZ3A 3CB4A 3K9CA 3ZWXA 5B6JA 4ITUA 4BLOA 1HLFA 5FCDA 1TPZA 4FSHA 2PT6A 2Q6OA 3RVJA 3GC6A 3G79A 1DTWA 5AOBA 3W5AA 1SBTA 4G63A 2R2GA 2XF8A 3MCAA 3GO4A 3PLRA <