2B5UA

Crystal structure of colicin e3 v206c mutant in complex with its immunity protein
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
470
structure length
470
Chain Sequence
SAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSCPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Colicin E3 In Complex With Its Immunity Protein
rcsb
source organism Escherichia coli
molecule tags Ribosome inhibitor, hydrolase
molecule keywords Colicin E3
total genus 142
structure length 470
sequence length 470
chains with identical sequence C
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06958 Pyocin_S S-type Pyocin
A PF09000 Cytotoxic Cytotoxic
A PF11570 E2R135 Coiled-coil receptor-binding R-domain of colicin E2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.620 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b5uA02
3.10.380.10 Alpha Beta Roll Ribonuclease domain of colicin e3 (Residues 456-551) Colicin E3-like ribonuclease domain 2b5uA03
1E44B 1UJWB 2B5UA 2YSUB 4UDMB 1JCHA
chains in the Genus database with same CATH superfamily
1KP2A 3C3SA 1KP3A 4F6RA 2XASA 4G27B 2IJHA 4X89A 4JI4B 3SJCC 5CA0B 3C3TA 4LR3A 2BTOA 4DR1O 1VQ5V 4NXNO 1L8DA 2HLDG 1ZUQA 3SJAC 2OCCB 2DQ3A 4PA4A 3CP1A 5KMGB 5JJJB 3HKCB 3HKCA 1YXBA 3CEIA 4R7CA 2DN9A 1IBMB 4X1KB 1IBKO 2EJRA 1NH2D 3A8TA 2GBOA 1YCIA 3B2EE 3ETQA 1YHQV 3A0RA 2QE7G 3P3NA 2EJ7A 2WLNA 3ZRWB 3JATA 4B3SB 1F23A 2WLIB 1FD9A 3B8NA 2R9AA 3O9OA 1Q7YW 2P6JA 1K97A 3OMIB 3ZN1A 3CC4V 3JSLA 1ORQC 4U3JA 4KFMA 1JVMA 1E1RG 3OT7A 1GN2A 1S3JA 1Y76A 1K5SA 3SPHA 1QNMA 3NR7A 3B09A 1H2GA 1N32B 1LUVA 1F4NA 1Q81W 1B6QA 1JCHA 4P2ZA 2R9IA 2Y0IA 2F95B 1MSDA 5LOVA 4LFAB 5H2FZ 2WLJA 1Y6XA 1MG1A 4F6EA 4LF9B 1XHXA 1AJPA 2Y0PA 3BHPA 3VQWA 5A9GA 3UT5B 3WG7B 3A2FA 2N04A 4AHCA 1N33B 3BCCH 4HNAA 3AK2A 5L3EA 4B7KA 5DEDA 1M90W 1VEWA 1R6KA 2DYRB 2PI4A 1Y74A 5IYZB 4LF8B 1SA0A 4G2KA 3H9VA 1YJNV 3JCZA 1NTMH 1JA8A 1ROPA 4XBFA 3FAVB 4KHPB 2X6BA 4I55A 5J2TB 3CS5A 4F6RB 2RDCA 4XDKA 2W6IG 4X20B 4JI5O 1H2SB 3K0DA 2QKSA 5BR8O 5GTHZ 2LP7A 3DXRB 1YTFD 4WFHA 5CBGA 1W59A 4NXMO 3Q4HB 3ETGA 1SKVA 2RCVA 2QM7A 5IYBO 1WAZA 5LP6C 4ABMA 3L75H 1J5EO 4AQYB 2ZE6A 4W4LA 4U3JB 4P9OA 4YIPA 5H6RA 4DV6O 1M5IA 2Y4TA 4NTWA 2A3QA 3JCUZ 2JIZG 4TQDA 5EC2C 1WPXA 5CA1B 2OCCC 1FJGB 2VQFO 1EN5A 3JD3A 1DLBA 2EINC 2E3CA 1XMQB 1NH2B 4FLWA 1OCRB 1X4TA 3SYOA 5F2VO 4NVPA 2JGUA 4X9QA 2V1DA 4X8AA 1YSCA 4GKKO 3FB6C 5HFLA 3E2EA 1O9HA 1S0VA 1PV0A 2AHYA 4P9PA 1FPOA 3OD4A 4A5UB 4U7OA 3CCUV 3ZRXA 5IYZA 2P5OA 2QKAA 2EULA 4QGPA 5JCOC 5B3SC 1Z5WA 2FMLA 1P7BA 1I5YA 5LA6B 3UO3A 1XL6A 3K9AA 3CRCA 5IJ0A 2X7RB 4NTXA 3HKDB 1IZ3A 3X2QB 3S3WA 3G71V 3HKDA 4TV8B 2VWKA 4GX0A 1P4RA 2EX3A 2KSDA 3M99B 3RYHB 4UDMB 3GWKC 1SF9A 1UPGA 5GONB 4IYIA 1W0JG 2UU9B 3BAAA 2P4KA 3WB1A 3VQVA 2OCHA 5LYJB 3WFVA 1FFXB 1JPXA 1RPRA 4JI7O 3UM7A 4JAUA 1H2NA 3SR2C 3JAKB 3CCEV 3G6BA 1KBHA 1URFA 4HYOA 3D8CA 2ZE8A 1S5JA 1N34O 2YC0A 2X6AA 1VQ8V 3W7SA 2YIBA 1HR0B 4QPJA 2LFRA 5DN6G 4GX1A 4FLVA 5LMNO 5DM6V 4DUZB 1HNZB 3W7WA 1SESA 2IM9A 2HVKC 1XEQA 3LDEA 1YDXA 2YI9A 2YUAA 1U97A 2QWRB 2IJIA 5LP6B 3AK3A 1Q86W 2LGQA 1R3IC 1M4UA 3ETDA 4JYAB 4JZ2A 2P90A 4BIUA 1TAEA 2QA4V 4CS3A 3E83A 2UXNA 3C90A 1KKCA 1PKXA 3G4SV 2GUZA 2UXBO 4NKGB 4TV9B 1SQGA 3E89A 1FXVA 1IBKB 2HEPA 5J2UA 5EZYB 4DR5B 1GN4A 4ZI7B 2ARHA 1BS3A 1XL4A 2GDSA 3JD2A 1B3QA 4PI0A 2Y4UA 5C8YA 3RFRA 4D6TH 4DUYB 3N2KA 1VQMV 3N2KB 1VARA 4B3MB 1TVKA 3N2GB 3HR0A 3TK1A 2YIAA 3ZMUA 3L74H 1RM1B 4NB5A 3E8GA 4LF9O 2ZNIA 4AQYO 1QCEA 1ENVA 2CTRA 1FFTB 5JVDA 1N34B 1QLEB 4RWUA 5B1BB 3DTUB 1H8HG 5IJ0B 3EFFK 4ZIBA 2YEVA 4DYLA 4JTAB 5IE9A 4IHJA 2ZXWC 2R72A 1XNQO 4MVOA 1RFYA 1Q82W 2LO1A 2ADQB 3A0BZ 2AZ0A 3TXQA 5KHGA 1BCCH 3FFQA 1M57C 4DV2B 5B1AC 3U0ZA 4X65O 2LW7A 1SZXA 5KHKA 3JAWB 3JAKA 2JS5A 2E76B 1QR8A 1VP7A 2L35A 1HDJA 3FD9A 4UCTA 5B1NA 3VOUA 3QO8A 4MVMA 1FYJA 1US6A 4MVZA 1I94O 1R1BA 1VQPV 1E79G 3HKEB 4B3SO 3CCLV 2Q5ZA 1KU9A 3VBBA 4NXNB 4CZZA 1XDCA 1DGSA 2Y69B 3L70H 1W2BU 1N36B 3CD6V 2NNUA 2QSAA 2GUZB 1BMFG 2Q68A 5L3BA 4J7ZA 4DR4O 2QTOA 2AXTZ 2FKXA 3OFNG 4NR1A 4HZ3A 2UXDO 3QTCA 2EINB 4WCEV 1TUBB 5JH7A 1WP7A 5B1OA 4O2BA 3PN1A 1DF5A 2P67A 1IX9A 5FL7G 5FLXN 1BHAA 3OUSA 1Y76B 4DV7O 3K59A 3F5WC 2JEXA 4YJ3A 2PYJA 1SRYA 4YJ2A 1YTFB 4YJ2B 4O4HA 3OTOO 2XNDG 2AHZA 3OGIB 5IJ9B 2YIDA 5TISZ 3LNMB 2NN4A 1VIBA 1OCZB 3FX7A 4FFKA 3JD0A 2WSSG 3BFRA 1EN6A 1BQZA 3K58A 4L8JA 3LSQA 4IIJA 3K03A 2XAQA 1KKDA 4LF4B 3CRRA 2Q6AA 4X65B 1TVKB 3CRAA 3T4ZA 2JDIG 4D7SA 1YJWV 2HHHO 3APQA 3CYOA 1I5XA 3ZN0A 4EFEA 4HNAB 2KG7A 2OTLV 2KG7B 2W6JG 1YEWA 2YIBD 5KAFZ 3JALB 3SPJA 2JGDB 3J81N 1Y74B 2AZ2A 4JI1B 2B5UA 1F51A 1FAFA 5D5PA 3CPWU 3H1KH 1Q43A 4FPPA 1S5HC 4TT3G 2DYRC 4X1YB 3H1IH 3R66A 4UVBA 2XTAA 3CMEV 2QWOB 3E8FA 1AROP 1SQVH 2OIEA 4GT1A 2UUBO 4JI6O 1J95A 4UV8A 2G38A 1MMMA 2XAFA 4FLTA 2CAZC 1H2LA 1VQ4V 2DW4A 1VQKV 3R65A 1FXKB 4LF8O 4JYBA 1WN7A 5B1BC 5FPRA 4J9ZB 4B3TO 4UB6Z 2YDEA 2O57A 3OW2U 1HNWB 4DV7B 4PHZA 2CUGA 3ZHTA 1LNQA 3W7XA 4FFBB 4O2AB 4JAAA 4DUYO 4X66B 1VF6A 2Q73A 2QGNA 4JI1O 5CBHA 4DV4O 4UXNA 3FB8C 3ZHSA 4FLZA 2DMXA 3B77A 5E79Z 4X64B 5LHHA 4J80A 3RYFB 2X6CA 4UCVA 2A0LA 3QVNA 1HNXO 1QHTA 2IH3C 3RGBA 1IBLB 4DV3B 3NXSA 2IBZH 2Y48A 2Q69A 3IJ4A 5LGNA 1L0LH 1TUBA 4QJFB 2PZSA 2QM4A 2UUCO 1F7YA 2WAMA 5CB4A 3E8HA 1NVPD 1IURA 3LNNA 1BZKA 3JASA 5EC1C 3TXSA 1H8EG 1MNGA 2PUSA 4O4JB 3UQ8A 2YSUB 3SGIA 3QO7A 4JI8B 3ZHRA 1JJ2U 5LMNB 2FTKA 4CS2A 1AILA 4FM0A 4B3TB 3G80A 2DWEC 2ILMA 1I7FA 3SYAA 4E4EA 2F4VB 4JPRA 4OPAA 4J7KA 3ZMVA 4BIZA 3K06A 2HJDA 1OZ0A 4YY3O 1I0HA 1KB9F 5BMVA 3SYCA 4JI4O 5LMUB 3AG2C 4I55B 4MTFA 4TQFA 4PDLA 3STLC 2JK5C 4DV1O 4H13B 3X2QC 1BSMA 5GONA 1ZAUA 2WWWA 4TUYA 4I0XA 4DV5O 1KC8W 1HR0O 2D3OW 2IJKA 5B5EZ 1U96A 3ABKC 4CH4A 3JYCA 1Q6UA 4PD4F 3K9SA 5LYJA 3L71H 3VQYA 5K1XA 2DE0X 4K8ZA 4O4IA 3ZS8C 3CCVV 2Z0AA 1AVMA 4FM1A 5J9PC 2BOCC 1QQCA 4MW3A 1QLEC 2QJ1A 1N8RW 1KUQA 2ZD9A 2HVJC 2OIGA 1WB8A 4JI3B 5LL6Y 3FYEB 3ZMTA 1AI6A 2WLIA 3JAMN 4Z1MG 1SZTA 1NR7A 1JMKC 5KHHA 1IDSA 3AG4C 5CA1A 3ZHUA 4MW8A 4ZHQB 2JRIA 3MHHC 4JTDB 5FNVB 3SPIA 2ZKOA 2E5LO 2WLLA 2IJJA 2CK3G 3IFXA 3BRCA 3MD0A 3SJQC 2QWPB 1H38A 4KHPO 1WLEA 1KD1W 3CC2V 2KQXA 3BABA 4FZ1A 2PY5A 5KA5A 1KMIZ 2M6YA 1QR9A 5LHGA 2A9HA 3OR6C 3T1HB 3K5MA 4PV1B 2HHHB 3T2MA 2LJ2A 4PELA 3AG4B 4DV1B 3H01A 3CCJV 1R6NA 3ML0A 2CTQA 4DR6B 4ASUG 1AR5A 5A2QN 2A7WA 5J2UB 4PI2A 4X88A 2P22C 2WLKA 4WFGA 1GN6A 3DGEA 2B9ZA 1XMQO 4WBNB 4UCUA 3FAVA 4K0KO 1WB7A 2UXCB 1AR1B 3M7MX 4Q6GA 3K79A 3H1JH 5L3FA 4I7ZB 1QU7A 2FB5A 1AI4A 2HKOA 4DV2O 2QWQB 1XMOB 1UFIA 3T1YB 4B3RO 2LQTA 2XUMA 3DC5A 5KMGA 5DECA 5CA3A 1XQ8A 2QTSA 1G6UA 1NT2B 1DTOA 3RW0A 2F43G 5EYPA 4LFCB 1NU1H 3EXAA 1GKFA 1V54B 2B1GA 3KCXA 3LDCA 3CWBH 4UVCA 3MAQA 4J42A 1MOFA 2WLMA 1SERA 1NBMG 4GKKB 1L0NH 1ZLZA 5IWAO 5KUMA 1NI8A 2FL4A 5GTIZ 4FK5C 5IY5B 3W7UA 4OX9B 5FNVA 1R3LC 1XNQB 4KUMA 3CB2A 1XNRO 1KYOF 2UXDB 4GYCB 4OXSA 4X64O 2Q0OC 4PA3A 1JX9A 4QE9A 2BTQB 4RAIA 3UKMA 3ABTA 1AI7A 1KECA 5L3CA 2YS8A 2RN9A 3E22A 2UUAB 1F4MA 3ZHVA 1YJ9V 1QVFU 5E1AC 4AI8A 4DW1A 3K04A 5L3DA 1OCOC 1K92A 3LSSA 5CBFA 1P49A 2YICA 3H1HH 1Z5VA 2ZE5A 3K3WA 2ZT9B 4LF4O 3SDLA 1NKDA 4J7JA 3U11A 4NTQA 2DJVA 3ASNB 4J9YB 1BGYH 2JJ1G 4PA9A 4DK0A 5ITZB 2ZIOA 5LBQA 5H5NA 1JQ0A 2EZPA 5BR8B 4O4HB 1NTKH 4LF6B 1SQBH 1HP8A 1AI5A 4GCZA 1K4CC 3OEHG 1N36O 2ZM6B 2GTAA 2Q67A 4WBNA 2YXLA 1XUQA 2QWNB 5IYCO 1G1XB 1YVWA 4UCRA 4I4TB 4LF7B 2YEVB 2LFSA 3AG1B 1FFXA 3BEHA 3K5LA 2Y69C 4KP4A 3RYIA 4X20A 4QNHB 3CX5F 4DR2B 1VQNV 5LGUA 1XNRB 1EN4A 4LH6A 1PNKA 1AP6A 2WLHA 3P30A 2JGDA 4KL1A 4X62B 3J80N 1RSOB 3ABMC 3E8BA 4B08A 4UFZA 1PL4A 5JCOA 1NZ6A 3UO2A 3WG7C 1PPJH 1K33A 4GLXA 2UUBB 5B1AB 4FJCC 3OUFA 4GKJO 3ABKB 1K34A 3OTFA 3ZX6A 3ASOC 4FZ0A 2VRZA 1MSWD 3JD1A 2Z5UA 4PA7A 2VQEB 1BE3H 4MVSA 1TA8A 1YZBA 1JR9A 2JJ2G 2PTMA 4D7TA 3IC9A 4X1KA 5IDJA 1HW7A 2EIJC 4JYCA 4YHHO 3BPZA 1ZX3A 5CN0A 4ZKIA 3W7TA 2W0XA 1ZTEA 1XOUA 4JYYA 4X62O 4LCUC 3UCSC 3CJHA 1R73A 5LP6A 5EBLC 2Q8VA 1OHHG 3CE2A 4CH6A 3OE7G 2EIKB 2QR4A 1NTZH 3A0HZ 4E2LA 1SS3A 4YIOA 5EZYA 3BY6A 1N33O 2DYSC 4CH5A 3TJTA 3SJBC 1OV9A 4MSWC 1BQ0A 4DR6O 3WB2A 3ZHQA 4JF3A 4N21A 1M57B 2ETNA 4JI2O 1AP5A 4WF9V 3TGUH 5LA6A 3WB0A 4G28B 4RO2A 5C8YB 3JD4A 2Q9LA 2VWJA 4OGQB 1ZSPA 1NR1A 4DR4B 3T1CA 4K0KB 2W0FC 4IHJB 3THOA 1EZJA 4UB8Z 4RUEA 3RYHA 1B06A 3CCQV 2V4DA 2BSKB 4F4LA 3APOA 4PDVA 4I4TA 1WJZA 4GZRB 1WPBA 4YY3B 1VQ9V 1OCRC 3D3QA 2MK3A 1N0JA 2M7WA 3RYIB 5IYDO 1OJHA 4X1IB 4X1YA 5B66Z 4B3RB 1JOYA 1SQPH 5CA0A 4U7NA 1QBZA 1VQOV 3AEIA 2R70A 3ICXA 1AJQA 2F93B 4LNUB 2KKWA 2ZINA 4DV5B 4U3FH 1GMGA 2AW9A 4BWAA 2EIMC 4GX2A 3JAWA 3T1YO 4UV9A 4BW5A 1K7DA 4TUYB 1GTOA 4LWSA 1KQSU 4I9WA 3B4SA 4WFFA 1GRJA 2N74A 4QPKA 3BVOA 3MHSC 3Q4HA 1CP9A 3SPGA 2QKCA 4CH3A 2P7TC 1QVGU 3E86A 3D36C 1D5NA 1OCCC 3B40A 1ZL8A 3P3PA 1PNMA 1VF6C 4IT5A 2WPDG 5IT9N 4DR7O 2A06H 2R9RB 3RYFA 1YIJV 2HG5C 3TETA 1XREA 3JATB 2EZOA 4Z2WA 1P7GA 4H37A 2UUAO 4ICGA 4JGSA 1K5QA 2ATKC 2CGOA 1GO3F 4O2BB 5BY1A 2EILB 3DSQA 4DV0O 2IH1C 1V9PA 1J5EB 1S76D 1E44B 3QG5A 2F23A 4IIJB 2CDYA 5KHIA 4JI2B 4J11A 1OCZC 1XHZA 2ZXWB 1MZFA 4YJ3B 3T4DA 1WA8B 1FS0G 4K35A 5FPOA 3RN4A 2RMKB 3L72H 2H8PC 3F7VC 5KHJA 1B04A 1BT8A 4PDMA 4LF7O 1HNXB 1SC5B 4BR6A 3K08A 1GAXA 3UT5A 2WA3A 3CSXA 3OAAG 4GUNA 4IL6Z 4BW9A 4R50A 4C7UA 5JWPA 4MT8A 1VF5B 4EEQA 4FIPC 1VQ6V 2F1MA 1PD3A 1S77D 3AG3B 1VQ7V 4J41A 1HNWO 1Q6HA 4BAYA 1WNSA 5BMVB 1HWYA 2IU0A 3WU2Z 3SYPA 1AR4A 2Z3YA 4TSFG 4H0LB 4YXWG 2ODMA 4JI0B 1JFFB 3LUTB 2AGAA 3OEEG 2Q0AA 3IC7A 4LWSB 2ZR3A 3CRMA 3DXRA 1Q5OA 1OCCB 1YF2A 1XILA 4JI8O 1V55B 3ZJZA 2XT9A 4N23A 4FVMA 5H9CA 2X0LA 3SPCA 3CXHF 4O4IB 4NXMB 3I5DA 2CGNA 3D3IA 4MTXA 2UUCB 1R3JC 4LFBO 4MTGA 3CC7V 3M8AA 3EVKA 2EIMB 1ZL8B 4LP8A 2ITDC 3ZMZA 2P4VA 2D2CB 4UVAA 1VMGA 2N05A 5JQGB 1N32O 4PA6A 1X59A 3MDSA 5LMUO 1FJGO 1K73W 4DR3O 3GVMA 3RYCB 3RYCA 4FMTA 3E22B 3CMAV 4QIWF 5JJNB 3OMNB 4ZOLB 5LXTB 4LC1A 4ZOLA 5CB4B 5LXTA 3U10A 5CMUA 4LF5B 4CC5A 1YI2V 4O4JA 3JSNA 2VQEO 2LGWA 4JZGA 1GM9A 5L3GA 3AG3C 4WFAV 4IYHA 4YHHB 2VQFB 3ABLC 1UJWB 5C93A 1AB3A 2BE3A 3K5NA 4EKWA 2ZDIC 5ITZA 4DV6B 4IGGA 4MVQA 1GH6A 3ETEA 4I50A 4JYAO 4NTYA 4I50B 4BIOA 4I0XB 4OX9O 5JJEB 3FB7C 3JARA 1EFRG 4MS2A 4UCOA 3GB7C 3JARB 5J2TA 1R3KC 1M56C 1FXKA 4H33A 1JJOA 3K57A 3KG2A 4ZBMA 3IAYA 1IXMA 2QDOA 2EILC 5EYPB 4LFAO 3VQXA 2EBOA 1COWG 2E5LB 3FKSG 3I55V 1RSOA 1Y66A 4DR7B 3I56V 4GKJB 2PI5A 2IW5A 1XBLA 4FLUA 5KUKA 4I5SA 2C2AA 3OM3B 4WFEA 4DK1A 2ADPA 4PJ0Z 3B8MA 1I08A 2EIKC 3H1LH 5B3SB 4JTCB 4B7EA 5IWAB 3FYIB 3CCSV 5H6QA 2L6LA 1FXKC 1NQTA 2OWOA 4EFBA 5KX5A 3KZIZ 5KX5B 3G67A 5LGTA 4H44B 3L9DA 2MW2B 5LOVB 3EHBB 3E35A 4K3AA 3ZCCA 2Q7EA 1M93A 4WFBV 4DV0B 5KLVH 4CC6A 4OPHA 2PF4E 1OCOB 1QLNA 3RBZA 2LW1A 1NJIW 3G6EV 2FYUH 4DR2O 5LHIA 2DQ0A 4ZI7A 1Q90D 1TUEB 4DRXB 1NS1A 3KCYA 1PP9H 1VF7A 2V7QG 2GHYA 4TWKA 3ASOB 2XAHA 4RQEA 4K8XA 3AK1A 4LFCO 3S3XA 1GN3A 4AILC 2E75B 3OGCC 2E74B 2ZQMA 4J10A 1EZVH 4DR1B 3ZMSA 3HKBA 2HJFC 4FLYA 2ZNJA 3HKBB 4JV5B 3HB3B 1BL8A 3IGAC 3ZIAG 2YXYA 2ZCEA 1THZA 3ZEDA 3DC6A 2JVDA 1EM1A 3F7YC 2UXXA 5HFMA 1Y67A 4DR5O 1FXHA 1K8AW 2F4VO 4JAVA 1IBMO 4MTOA 3GWOA 4R8CA 4XDLA 2ITCC 1DK1A 3J7AU 5KAIZ 4LFBB 3CCMV 5AG2A 2XAJA 3QF7A 3N27A 2UXBB 3SYQA 2HFEC 3ABUA 2CTPA 3KKYA 3K0GA 1ZWIC 3O65A 4Z1VA 4MVRA 1D5AA 3CCRV 1SQQH 1GM8A 1S72V 2Q4PA 3ASNC 2RJZA 4UUJC 1Z2GA 1RPOA 1D2DA 4RUFA 4I9QA 1W0KG 1T5EA 4Q20A 4ZHQA 1N4CA 2OT5A 1YITV 3QO5A 2OYQA 1AJNA 5GW7A 4FLXA 2K1EA 2Q7GA 1BHBA 4R6ZA 3HKEA 1S5LZ 3PJSK 3ABLB 1L1FA 2F66C 4W4KA 5JH7B 2RNBA 3L73H 2UXCO 4LBEC 4JV5O 2XOKG 5K1PA 4KXRA 4P30A 2OTJV 4HAMA 4TV9A 1Y4MA 2GSMB 1K9MW 4JI5B 1IXBA 2DOSA 3ABMB 3ZRSA 1XMOO 4DV3O 2UU9O 1G8MA 4B3MO 4GX5A 1VQLV 1A32A 4JASA 4DRXA 1K4DC 2EIJB 3N2GA 3RWRD 1XI1A 3D36A 1CXZB 4TV8A 3CHXA 1PL0A 5IJ9A 5EIBD 1V54C 1CEZA 4DUZO 1HNZO 2PGGA 1DF4A 1CPYA 1MZEA 4JI0O 4DXWA 1WP8A 2GV9A 4CS4A 1RP3B 5KA6A 1IBLO 1R6TA 1H2MA 3ZRVA 1PM9A 1M56B 3RVYA 2XAGA 4TOIA 3OTOB 2DYSB 4QE7A 4X1IA 2DWDC 4L87A 1LUWA 1Q3EA 2CE4A 4JI7B 1H2KA 2NLJC 1K3EA 4O4LA 1LR1A 1PNLA 1V55C 3AG7A 1RM1C 1G4YB 2ZDIA 1N0NA 1JFFA 1NVPB 2QEXV 1O9GA 1TGOA 3RVZA 2PYLA 1SETA 1GK9A 2KB1A 2HP8A 4FFBA 4O2AA 3CJHB 2ZE7A 3HPLC 3LSUA 2BTQA 2GTSA 5BZBA 4LF6O 3OMAB 5EIBC 3CRQA 4JI6B 3K5OA 4DW0A 2HR3A 1M9NA 3ZRWA 1P84F 2B1IA 2CTWA 3QNEA 5EBWC 2H94A 4PDRA 1MA1A 5EBMC 1Q6IA 1E1QG 2JS3A 2YI8A 2ZIMA 4NYKA 2ZM6O 5JQGA 5EK0A 2WLLB 4UCSA 5D5QA 1EBOA 2A79B 2P06A 3ZBHA 3CXCU 1Q8IA 4DV4B 3LDDA 3AG1C 3JASB 2RQ6A 2WA4A 1WA8A 4JI3O 2ZR2A 3T1HO 5BXZA 4LF5O 3BA9A 2YXHA 3F5TA 1SQXH 2H3OA 2K9PA 2VS0A 3RT3C 4HBNA 1FKAO 5JVDB 3STZC 4EB6B 2BCCH 4EB6A 2JEUA 1GM7A 4LH7A 4MVUA 4XDJA 1IVSA 4X66O 3AG2B 1SA0B 2NR5A 4FM2A 4CBCA 1I94B 1MABG 3TCUA 3P32A 3FB5C 2XHBA 4RQFA 5IY5C 2Q7HA 3JALA 2CH7B 4DO2A 2CH7A 3OR7C 2BSKA 4DR3B 2IU3A 4O4LB 2BOBC 1SQFA 4LNUA 3BA8A 1M1KW 2QM8A
chains in the Genus database with same CATH topology
1GM9A 1KP2A 4MVMA 5L3GA 3K04A 1KP3A 5L3DA 3AG3C 4WFAV 2XASA 1OCOC 1K92A 4G27B 2IJHA 3LSSA 4X89A 5CBFA 4MVZA 3ABLC 1VQPV 1E79G 1UJWB 5C93A 1VQ5V 4EKWA 3K3WA 3VOUA 2HLDG 2ZDIC 2OCCB 3CCLV 2DQ3A 3VBBA 4PA4A 1NKDA 4CZZA 4MVQA 3CP1A 2Y69B 1W2BU 3ETEA 3CD6V 2NNUA 1BMFG 4R7CA 2Q68A 5L3BA 2QTOA 3ASNB 4J9YB 2EJRA 1NH2D 2JJ1G 3OFNG 4PA9A 3FB7C 4HZ3A 4MS2A 1EFRG 5LBQA 3GB7C 1JQ0A 1YHQV 2EINB 3A0RA 2EZPA 2QE7G 4WCEV 5B1OA 1R3KC 2WLNA 3ZRWB 1M56C 1DF5A 2P67A 1FXKA 4H33A 1AI5A 5FL7G 4GCZA 1K4CC 1F23A 1BHAA 3OUSA 3OEHG 3KG2A 4ZBMA 2Q67A 2WLIB 1IXMA 3B8NA 3F5WC 2EILC 2JEXA 1SRYA 5IYCO 2EBOA 1YTFB 1Q7YW 2P6JA 1K97A 1COWG 3OMIB 3ZN1A 2YEVB 3FKSG 2AHZA 2LFSA 2XNDG 3I55V 3CC4V 3LNMB 1OCZB 3AG1B 1ORQC 1Y66A 3BEHA 2WSSG 3JD0A 4KFMA 1JVMA 3I56V 1E1RG 2Y69C 4KP4A 4QNHB 3SPHA 1S3JA 3LSQA 1K5SA 2PI5A 2IW5A 3K03A 1VQNV 2XAQA 5LGUA 5KUKA 1KKDA 1H2GA 4I5SA 1PNKA 2C2AA 1F4NA 1Q81W 1B6QA 2Q6AA 3OM3B 2WLHA 4WFEA 3T4ZA 2JDIG 1JCHA 3P30A 4P2ZA 2R9IA 3B8MA 1YJWV 2EIKC 5B3SB 3ABMC 3E8BA 4JTCB 3FYIB 3CCSV 5H6QA 3CYOA 2WLJA 1I5XA 3ZN0A 1FXKC 1NQTA 2OTLV 1MG1A 3WG7C 2W6JG 1K33A 1AJPA 5B1AB 3SPJA 4FJCC 5LGTA 3OUFA 3WG7B 3ABKB 1K34A 3ASOC 2B5UA 1MSWD 1F51A 3EHBB 3CPWU 4FPPA 3E35A 1S5HC 3ZCCA 4TT3G 3JD1A 2Z5UA 4PA7A 2DYRC 5L3EA 4MVSA 4UVBA 1M90W 4WFBV 2JJ2G 3CMEV 3E8FA 1AROP 1R6KA 5IDJA 2EIJC 2DYRB 4GT1A 4JYCA 1J95A 4UV8A 2PI4A 1OCOB 5CN0A 1QLNA 4ZKIA 2XAFA 3RBZA 3W7TA 1NJIW 3G6EV 4G2KA 5LHIA 2DW4A 1VQ4V 1VQKV 3R65A 2DQ0A 1YJNV 4LCUC 3JCZA 1FXKB 1R73A 4JYBA 1ROPA 5EBLC 5B1BC 4XBFA 1OHHG 1TUEB 4J9ZB 3OW2U 3OE7G 2X6BA 2V7QG 2EIKB 2GHYA 4TWKA 3ASOB 2XAHA 4E2LA 4RQEA 1LNQA 3W7XA 3BY6A 2DYSC 5CBHA 4XDKA 2W6IG 4UXNA 3K0DA 2QKSA 4MSWC 3OGCC 3FB8C 2ZQMA 3ZMSA 2HJFC 2LP7A 4JF3A 1YTFD 3HB3B 1BL8A 4N21A 3IGAC 3B77A 4WFHA 3ZIAG 5CBGA 1THZA 5LHHA 1M57B 2X6CA 2A0LA 3ETGA 4WF9V 3F7YC 2UXXA 4G28B 2QM7A 5HFMA 5IYBO 4RO2A 2IH3C 1FXHA 3JD4A 1K8AW 4JAVA 1NR1A 3NXSA 4MTOA 2Y48A 2Q69A 5LGNA 3GWOA 4R8CA 3T1CA 4XDLA 4QJFB 2ITCC 2W0FC 4P9OA 5H6RA 3CCMV 2XAJA 1EZJA 4RUEA 2WAMA 3E8HA 3SYQA 3CCQV 2JIZG 1NVPD 5EC2C 2HFEC 1WPXA 3ABUA 5EC1C 1H8EG 2OCCC 2YSUB 4F4LA 3QO7A 4PDVA 3JD3A 1DLBA 3K0GA 1JJ2U 2EINC 1VQ9V 1OCRC 2MK3A 1ZWIC 2M7WA 2FTKA 5IYDO 4MVRA 3CCRV 1NH2B 1GM8A 1S72V 1JOYA 3ASNC 1OCRB 4UUJC 4U7NA 3SYOA 1RPOA 4RUFA 1QBZA 2DWEC 1VQOV 3AEIA 3SYAA 1AJQA 2V1DA 4X8AA 1W0KG 4JPRA 4Q20A 1YSCA 1GMGA 2OT5A 3FB6C 5HFLA 1YITV 3QO5A 3E2EA 1S0VA 1AJNA 5GW7A 2EIMC 4GX2A 2AHYA 4P9PA 3ZMVA 4BIZA 2K1EA 3K06A 1OZ0A 4UV9A 4BW5A 1K7DA 4R6ZA 1BHBA 1GTOA 4U7OA 3CCUV 3ZRXA 1KQSU 3PJSK 4I9WA 3SYCA 3ABLB 1L1FA 4WFFA 3AG2C 4MTFA 4QPKA 3MHSC 5B3SC 4PDLA 1P7BA 1I5YA 3STLC 2JK5C 1CP9A 4LBEC 3SPGA 2P7TC 1XL6A 3E86A 3K9AA 2XOKG 3X2QC 1QVGU 2WWWA 1OCCC 1KC8W 1PNMA 2WPDG 4P30A 2OTJV 2D3OW 4HAMA 2X7RB 2IJKA 1Y4MA 2GSMB 3X2QB 1K9MW 3ABKC 3G71V 3ZRSA 3ABMB 2R9RB 3JYCA 1YIJV 2HG5C 4GX0A 1P4RA 1G8MA 3TETA 3M99B 2EZOA 4UDMB 4GX5A 1VQLV 1M1KW 4H37A 1W0JG 4JASA 3CCVV 1K4DC 4JGSA 1K5QA 2EIJB 2ATKC 3D36A 5J9PC 2BOCC 1GO3F 4MW3A 1QLEC 1PL0A 2EILB 1N8RW 2IH1C 1V54C 3WFVA 1S76D 2ZD9A 2HVJC 1E44B 1CEZA 1JPXA 1RPRA 3FYEB 3ZMTA 1AI6A 3UM7A 4JAUA 2WLIA 4Z1MG 3CCEV 1DF4A 1OCZC 1SZTA 1CPYA 1NR7A 2ZXWB 4HYOA 3T4DA 3AG4C 4DXWA 1FS0G 4MW8A 2X6AA 3MHHC 4JTDB 5KA6A 2H8PC 3F7VC 3SPIA 3ZRVA 4PDMA 1VQ8V 3RVYA 1M56B 2XAGA 2WLLA 3W7SA 2IJJA 2CK3G 2DYSB 3IFXA 4QPJA 4QE7A 2LFRA 5DN6G 4GX1A 2DWDC 3K08A 3MD0A 4L87A 3SJQC 1H38A 5DM6V 1WLEA 1KD1W 3W7WA 2NLJC 3CC2V 1K3EA 1SESA 3OAAG 5KA5A 2HVKC 3LDEA 1QR9A 5LHGA 2A9HA 3OR6C 1PNLA 1V55C 1RM1C 4R50A 1G4YB 2ZDIA 4MT8A 3T2MA 4FIPC 1VQ6V 2IJIA 1NVPB 2QEXV 1PD3A 1S77D 3AG3B 1VQ7V 1Q86W 4PELA 3AG4B 1R3IC 4BAYA 3H01A 3ETDA 2P90A 3RVZA 4BIUA 3CCJV 2QA4V 1SETA 1R6NA 1GK9A 3ML0A 2KB1A 1HWYA 2IU0A 4ASUG 3SYPA 2Z3YA 4TSFG 3E83A 2UXNA 4YXWG 3HPLC 1PKXA 4X88A 3G4SV 5BZBA 2WLKA 4WFGA 3DGEA 3LUTB 3OEEG 3IC7A 3OMAB 1AR1B 2ZR3A 3K79A 3E89A 1FXVA 1OCCB 5L3FA 2HR3A 1M9NA 3ZRWA 1V55B 3ZJZA 2B1IA 1AI4A 2HKOA 4N23A 2X0LA 1XL4A 3JD2A 5H9CA 3SPCA 3QNEA 5EBWC 2H94A 4PDRA 5EBMC 1E1QG 1VQMV 3D3IA 4MTXA 1R3JC 4MTGA 3TK1A 3ZMUA 3CC7V 1RM1B 3E8GA 5EK0A 5CA3A 1QCEA 2WLLB 1ENVA 1FFTB 1EBOA 2A79B 2EIMB 1QLEB 3CXCU 4LP8A 2ITDC 5B1BB 1DTOA 3DTUB 2F43G 1H8HG 3RW0A 3LDDA 3AG1C 3EFFK 1GKFA 3ZMZA 1V54B 2B1GA 4UVAA 2ZR2A 2YEVA 3LDCA 4JTAB 4UVCA 4PA6A 2ZXWC 3STZC 1MOFA 2WLMA 1SERA 1NBMG 1K73W 2JEUA 1GM7A 4MVOA 5KUMA 1Q82W 4MVUA 4FMTA 4XDJA 4FK5C 5IY5B 3W7UA 3AG2B 1R3LC 4KUMA 1M57C 3CMAV 5B1AC 4QIWF 4OXSA 3OMNB 4CBCA 1MABG 3TCUA 3P32A 3FB5C 4LC1A 4PA3A 4RQFA 5IY5C 1JX9A 4QE9A 5CMUA 4RAIA 3UKMA 4DO2A 3ABTA 3OR7C 1YI2V 1QR8A 1AI7A 1KECA 2IU3A 2BOBC 5L3CA 1F4MA 1YJ9V 5B1NA 1QVFU 2QM8A 3QO8A 5E1AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E44 B;  1UJW B;  2B5U A;  2YSU B;  4UDM B;  1JCH A; 
#chains in the Genus database with same CATH topology
 1KP2 A;  3C3S A;  1KP3 A;  4F6R A;  2XAS A;  4G27 B;  2IJH A;  4X89 A;  4JI4 B;  3SJC C;  5CA0 B;  3C3T A;  4LR3 A;  2BTO A;  4DR1 O;  1VQ5 V;  4NXN O;  1L8D A;  2HLD G;  1ZUQ A;  3SJA C;  2OCC B;  2DQ3 A;  4PA4 A;  3CP1 A;  5KMG B;  5JJJ B;  3HKC B;  3HKC A;  1YXB A;  3CEI A;  4R7C A;  2DN9 A;  1IBM B;  4X1K B;  1IBK O;  2EJR A;  1NH2 D;  3A8T A;  2GBO A;  1YCI A;  3B2E E;  3ETQ A;  1YHQ V;  3A0R A;  2QE7 G;  3P3N A;  2EJ7 A;  2WLN A;  3ZRW B;  3JAT A;  4B3S B;  1F23 A;  2WLI B;  1FD9 A;  3B8N A;  2R9A A;  3O9O A;  1Q7Y W;  2P6J A;  1K97 A;  3OMI B;  3ZN1 A;  3CC4 V;  3JSL A;  1ORQ C;  4U3J A;  4KFM A;  1JVM A;  1E1R G;  3OT7 A;  1GN2 A;  1S3J A;  1Y76 A;  1K5S A;  3SPH A;  1QNM A;  3NR7 A;  3B09 A;  1H2G A;  1N32 B;  1LUV A;  1F4N A;  1Q81 W;  1B6Q A;  1JCH A;  4P2Z A;  2R9I A;  2Y0I A;  2F95 B;  1MSD A;  5LOV A;  4LFA B;  5H2F Z;  2WLJ A;  1Y6X A;  1MG1 A;  4F6E A;  4LF9 B;  1XHX A;  1AJP A;  2Y0P A;  3BHP A;  3VQW A;  5A9G A;  3UT5 B;  3WG7 B;  3A2F A;  2N04 A;  4AHC A;  1N33 B;  3BCC H;  4HNA A;  3AK2 A;  5L3E A;  4B7K A;  5DED A;  1M90 W;  1VEW A;  1R6K A;  2DYR B;  2PI4 A;  1Y74 A;  5IYZ B;  4LF8 B;  1SA0 A;  4G2K A;  3H9V A;  1YJN V;  3JCZ A;  1NTM H;  1JA8 A;  1ROP A;  4XBF A;  3FAV B;  4KHP B;  2X6B A;  4I55 A;  5J2T B;  3CS5 A;  4F6R B;  2RDC A;  4XDK A;  2W6I G;  4X20 B;  4JI5 O;  1H2S B;  3K0D A;  2QKS A;  5BR8 O;  5GTH Z;  2LP7 A;  3DXR B;  1YTF D;  4WFH A;  5CBG A;  1W59 A;  4NXM O;  3Q4H B;  3ETG A;  1SKV A;  2RCV A;  2QM7 A;  5IYB O;  1WAZ A;  5LP6 C;  4ABM A;  3L75 H;  1J5E O;  4AQY B;  2ZE6 A;  4W4L A;  4U3J B;  4P9O A;  4YIP A;  5H6R A;  4DV6 O;  1M5I A;  2Y4T A;  4NTW A;  2A3Q A;  3JCU Z;  2JIZ G;  4TQD A;  5EC2 C;  1WPX A;  5CA1 B;  2OCC C;  1FJG B;  2VQF O;  1EN5 A;  3JD3 A;  1DLB A;  2EIN C;  2E3C A;  1XMQ B;  1NH2 B;  4FLW A;  1OCR B;  1X4T A;  3SYO A;  5F2V O;  4NVP A;  2JGU A;  4X9Q A;  2V1D A;  4X8A A;  1YSC A;  4GKK O;  3FB6 C;  5HFL A;  3E2E A;  1O9H A;  1S0V A;  1PV0 A;  2AHY A;  4P9P A;  1FPO A;  3OD4 A;  4A5U B;  4U7O A;  3CCU V;  3ZRX A;  5IYZ A;  2P5O A;  2QKA A;  2EUL A;  4QGP A;  5JCO C;  5B3S C;  1Z5W A;  2FML A;  1P7B A;  1I5Y A;  5LA6 B;  3UO3 A;  1XL6 A;  3K9A A;  3CRC A;  5IJ0 A;  2X7R B;  4NTX A;  3HKD B;  1IZ3 A;  3X2Q B;  3S3W A;  3G71 V;  3HKD A;  4TV8 B;  2VWK A;  4GX0 A;  1P4R A;  2EX3 A;  2KSD A;  3M99 B;  3RYH B;  4UDM B;  3GWK C;  1SF9 A;  1UPG A;  5GON B;  4IYI A;  1W0J G;  2UU9 B;  3BAA A;  2P4K A;  3WB1 A;  3VQV A;  2OCH A;  5LYJ B;  3WFV A;  1FFX B;  1JPX A;  1RPR A;  4JI7 O;  3UM7 A;  4JAU A;  1H2N A;  3SR2 C;  3JAK B;  3CCE V;  3G6B A;  1KBH A;  1URF A;  4HYO A;  3D8C A;  2ZE8 A;  1S5J A;  1N34 O;  2YC0 A;  2X6A A;  1VQ8 V;  3W7S A;  2YIB A;  1HR0 B;  4QPJ A;  2LFR A;  5DN6 G;  4GX1 A;  4FLV A;  5LMN O;  5DM6 V;  4DUZ B;  1HNZ B;  3W7W A;  1SES A;  2IM9 A;  2HVK C;  1XEQ A;  3LDE A;  1YDX A;  2YI9 A;  2YUA A;  1U97 A;  2QWR B;  2IJI A;  5LP6 B;  3AK3 A;  1Q86 W;  2LGQ A;  1R3I C;  1M4U A;  3ETD A;  4JYA B;  4JZ2 A;  2P90 A;  4BIU A;  1TAE A;  2QA4 V;  4CS3 A;  3E83 A;  2UXN A;  3C90 A;  1KKC A;  1PKX A;  3G4S V;  2GUZ A;  2UXB O;  4NKG B;  4TV9 B;  1SQG A;  3E89 A;  1FXV A;  1IBK B;  2HEP A;  5J2U A;  5EZY B;  4DR5 B;  1GN4 A;  4ZI7 B;  2ARH A;  1BS3 A;  1XL4 A;  2GDS A;  3JD2 A;  1B3Q A;  4PI0 A;  2Y4U A;  5C8Y A;  3RFR A;  4D6T H;  4DUY B;  3N2K A;  1VQM V;  3N2K B;  1VAR A;  4B3M B;  1TVK A;  3N2G B;  3HR0 A;  3TK1 A;  2YIA A;  3ZMU A;  3L74 H;  1RM1 B;  4NB5 A;  3E8G A;  4LF9 O;  2ZNI A;  4AQY O;  1QCE A;  1ENV A;  2CTR A;  1FFT B;  5JVD A;  1N34 B;  1QLE B;  4RWU A;  5B1B B;  3DTU B;  1H8H G;  5IJ0 B;  3EFF K;  4ZIB A;  2YEV A;  4DYL A;  4JTA B;  5IE9 A;  4IHJ A;  2ZXW C;  2R72 A;  1XNQ O;  4MVO A;  1RFY A;  1Q82 W;  2LO1 A;  2ADQ B;  3A0B Z;  2AZ0 A;  3TXQ A;  5KHG A;  1BCC H;  3FFQ A;  1M57 C;  4DV2 B;  5B1A C;  3U0Z A;  4X65 O;  2LW7 A;  1SZX A;  5KHK A;  3JAW B;  3JAK A;  2JS5 A;  2E76 B;  1QR8 A;  1VP7 A;  2L35 A;  1HDJ A;  3FD9 A;  4UCT A;  5B1N A;  3VOU A;  3QO8 A;  4MVM A;  1FYJ A;  1US6 A;  4MVZ A;  1I94 O;  1R1B A;  1VQP V;  1E79 G;  3HKE B;  4B3S O;  3CCL V;  2Q5Z A;  1KU9 A;  3VBB A;  4NXN B;  4CZZ A;  1XDC A;  1DGS A;  2Y69 B;  3L70 H;  1W2B U;  1N36 B;  3CD6 V;  2NNU A;  2QSA A;  2GUZ B;  1BMF G;  2Q68 A;  5L3B A;  4J7Z A;  4DR4 O;  2QTO A;  2AXT Z;  2FKX A;  3OFN G;  4NR1 A;  4HZ3 A;  2UXD O;  3QTC A;  2EIN B;  4WCE V;  1TUB B;  5JH7 A;  1WP7 A;  5B1O A;  4O2B A;  3PN1 A;  1DF5 A;  2P67 A;  1IX9 A;  5FL7 G;  5FLX N;  1BHA A;  3OUS A;  1Y76 B;  4DV7 O;  3K59 A;  3F5W C;  2JEX A;  4YJ3 A;  2PYJ A;  1SRY A;  4YJ2 A;  1YTF B;  4YJ2 B;  4O4H A;  3OTO O;  2XND G;  2AHZ A;  3OGI B;  5IJ9 B;  2YID A;  5TIS Z;  3LNM B;  2NN4 A;  1VIB A;  1OCZ B;  3FX7 A;  4FFK A;  3JD0 A;  2WSS G;  3BFR A;  1EN6 A;  1BQZ A;  3K58 A;  4L8J A;  3LSQ A;  4IIJ A;  3K03 A;  2XAQ A;  1KKD A;  4LF4 B;  3CRR A;  2Q6A A;  4X65 B;  1TVK B;  3CRA A;  3T4Z A;  2JDI G;  4D7S A;  1YJW V;  2HHH O;  3APQ A;  3CYO A;  1I5X A;  3ZN0 A;  4EFE A;  4HNA B;  2KG7 A;  2OTL V;  2KG7 B;  2W6J G;  1YEW A;  2YIB D;  5KAF Z;  3JAL B;  3SPJ A;  2JGD B;  3J81 N;  1Y74 B;  2AZ2 A;  4JI1 B;  2B5U A;  1F51 A;  1FAF A;  5D5P A;  3CPW U;  3H1K H;  1Q43 A;  4FPP A;  1S5H C;  4TT3 G;  2DYR C;  4X1Y B;  3H1I H;  3R66 A;  4UVB A;  2XTA A;  3CME V;  2QWO B;  3E8F A;  1ARO P;  1SQV H;  2OIE A;  4GT1 A;  2UUB O;  4JI6 O;  1J95 A;  4UV8 A;  2G38 A;  1MMM A;  2XAF A;  4FLT A;  2CAZ C;  1H2L A;  1VQ4 V;  2DW4 A;  1VQK V;  3R65 A;  1FXK B;  4LF8 O;  4JYB A;  1WN7 A;  5B1B C;  5FPR A;  4J9Z B;  4B3T O;  4UB6 Z;  2YDE A;  2O57 A;  3OW2 U;  1HNW B;  4DV7 B;  4PHZ A;  2CUG A;  3ZHT A;  1LNQ A;  3W7X A;  4FFB B;  4O2A B;  4JAA A;  4DUY O;  4X66 B;  1VF6 A;  2Q73 A;  2QGN A;  4JI1 O;  5CBH A;  4DV4 O;  4UXN A;  3FB8 C;  3ZHS A;  4FLZ A;  2DMX A;  3B77 A;  5E79 Z;  4X64 B;  5LHH A;  4J80 A;  3RYF B;  2X6C A;  4UCV A;  2A0L A;  3QVN A;  1HNX O;  1QHT A;  2IH3 C;  3RGB A;  1IBL B;  4DV3 B;  3NXS A;  2IBZ H;  2Y48 A;  2Q69 A;  3IJ4 A;  5LGN A;  1L0L H;  1TUB A;  4QJF B;  2PZS A;  2QM4 A;  2UUC O;  1F7Y A;  2WAM A;  5CB4 A;  3E8H A;  1NVP D;  1IUR A;  3LNN A;  1BZK A;  3JAS A;  5EC1 C;  3TXS A;  1H8E G;  1MNG A;  2PUS A;  4O4J B;  3UQ8 A;  2YSU B;  3SGI A;  3QO7 A;  4JI8 B;  3ZHR A;  1JJ2 U;  5LMN B;  2FTK A;  4CS2 A;  1AIL A;  4FM0 A;  4B3T B;  3G80 A;  2DWE C;  2ILM A;  1I7F A;  3SYA A;  4E4E A;  2F4V B;  4JPR A;  4OPA A;  4J7K A;  3ZMV A;  4BIZ A;  3K06 A;  2HJD A;  1OZ0 A;  4YY3 O;  1I0H A;  1KB9 F;  5BMV A;  3SYC A;  4JI4 O;  5LMU B;  3AG2 C;  4I55 B;  4MTF A;  4TQF A;  4PDL A;  3STL C;  2JK5 C;  4DV1 O;  4H13 B;  3X2Q C;  1BSM A;  5GON A;  1ZAU A;  2WWW A;  4TUY A;  4I0X A;  4DV5 O;  1KC8 W;  1HR0 O;  2D3O W;  2IJK A;  5B5E Z;  1U96 A;  3ABK C;  4CH4 A;  3JYC A;  1Q6U A;  4PD4 F;  3K9S A;  5LYJ A;  3L71 H;  3VQY A;  5K1X A;  2DE0 X;  4K8Z A;  4O4I A;  3ZS8 C;  3CCV V;  2Z0A A;  1AVM A;  4FM1 A;  5J9P C;  2BOC C;  1QQC A;  4MW3 A;  1QLE C;  2QJ1 A;  1N8R W;  1KUQ A;  2ZD9 A;  2HVJ C;  2OIG A;  1WB8 A;  4JI3 B;  5LL6 Y;  3FYE B;  3ZMT A;  1AI6 A;  2WLI A;  3JAM N;  4Z1M G;  1SZT A;  1NR7 A;  1JMK C;  5KHH A;  1IDS A;  3AG4 C;  5CA1 A;  3ZHU A;  4MW8 A;  4ZHQ B;  2JRI A;  3MHH C;  4JTD B;  5FNV B;  3SPI A;  2ZKO A;  2E5L O;  2WLL A;  2IJJ A;  2CK3 G;  3IFX A;  3BRC A;  3MD0 A;  3SJQ C;  2QWP B;  1H38 A;  4KHP O;  1WLE A;  1KD1 W;  3CC2 V;  2KQX A;  3BAB A;  4FZ1 A;  2PY5 A;  5KA5 A;  1KMI Z;  2M6Y A;  1QR9 A;  5LHG A;  2A9H A;  3OR6 C;  3T1H B;  3K5M A;  4PV1 B;  2HHH B;  3T2M A;  2LJ2 A;  4PEL A;  3AG4 B;  4DV1 B;  3H01 A;  3CCJ V;  1R6N A;  3ML0 A;  2CTQ A;  4DR6 B;  4ASU G;  1AR5 A;  5A2Q N;  2A7W A;  5J2U B;  4PI2 A;  4X88 A;  2P22 C;  2WLK A;  4WFG A;  1GN6 A;  3DGE A;  2B9Z A;  1XMQ O;  4WBN B;  4UCU A;  3FAV A;  4K0K O;  1WB7 A;  2UXC B;  1AR1 B;  3M7M X;  4Q6G A;  3K79 A;  3H1J H;  5L3F A;  4I7Z B;  1QU7 A;  2FB5 A;  1AI4 A;  2HKO A;  4DV2 O;  2QWQ B;  1XMO B;  1UFI A;  3T1Y B;  4B3R O;  2LQT A;  2XUM A;  3DC5 A;  5KMG A;  5DEC A;  5CA3 A;  1XQ8 A;  2QTS A;  1G6U A;  1NT2 B;  1DTO A;  3RW0 A;  2F43 G;  5EYP A;  4LFC B;  1NU1 H;  3EXA A;  1GKF A;  1V54 B;  2B1G A;  3KCX A;  3LDC A;  3CWB H;  4UVC A;  3MAQ A;  4J42 A;  1MOF A;  2WLM A;  1SER A;  1NBM G;  4GKK B;  1L0N H;  1ZLZ A;  5IWA O;  5KUM A;  1NI8 A;  2FL4 A;  5GTI Z;  4FK5 C;  5IY5 B;  3W7U A;  4OX9 B;  5FNV A;  1R3L C;  1XNQ B;  4KUM A;  3CB2 A;  1XNR O;  1KYO F;  2UXD B;  4GYC B;  4OXS A;  4X64 O;  2Q0O C;  4PA3 A;  1JX9 A;  4QE9 A;  2BTQ B;  4RAI A;  3UKM A;  3ABT A;  1AI7 A;  1KEC A;  5L3C A;  2YS8 A;  2RN9 A;  3E22 A;  2UUA B;  1F4M A;  3ZHV A;  1YJ9 V;  1QVF U;  5E1A C;  4AI8 A;  4DW1 A;  3K04 A;  5L3D A;  1OCO C;  1K92 A;  3LSS A;  5CBF A;  1P49 A;  2YIC A;  3H1H H;  1Z5V A;  2ZE5 A;  3K3W A;  2ZT9 B;  4LF4 O;  3SDL A;  1NKD A;  4J7J A;  3U11 A;  4NTQ A;  2DJV A;  3ASN B;  4J9Y B;  1BGY H;  2JJ1 G;  4PA9 A;  4DK0 A;  5ITZ B;  2ZIO A;  5LBQ A;  5H5N A;  1JQ0 A;  2EZP A;  5BR8 B;  4O4H B;  1NTK H;  4LF6 B;  1SQB H;  1HP8 A;  1AI5 A;  4GCZ A;  1K4C C;  3OEH G;  1N36 O;  2ZM6 B;  2GTA A;  2Q67 A;  4WBN A;  2YXL A;  1XUQ A;  2QWN B;  5IYC O;  1G1X B;  1YVW A;  4UCR A;  4I4T B;  4LF7 B;  2YEV B;  2LFS A;  3AG1 B;  1FFX A;  3BEH A;  3K5L A;  2Y69 C;  4KP4 A;  3RYI A;  4X20 A;  4QNH B;  3CX5 F;  4DR2 B;  1VQN V;  5LGU A;  1XNR B;  1EN4 A;  4LH6 A;  1PNK A;  1AP6 A;  2WLH A;  3P30 A;  2JGD A;  4KL1 A;  4X62 B;  3J80 N;  1RSO B;  3ABM C;  3E8B A;  4B08 A;  4UFZ A;  1PL4 A;  5JCO A;  1NZ6 A;  3UO2 A;  3WG7 C;  1PPJ H;  1K33 A;  4GLX A;  2UUB B;  5B1A B;  4FJC C;  3OUF A;  4GKJ O;  3ABK B;  1K34 A;  3OTF A;  3ZX6 A;  3ASO C;  4FZ0 A;  2VRZ A;  1MSW D;  3JD1 A;  2Z5U A;  4PA7 A;  2VQE B;  1BE3 H;  4MVS A;  1TA8 A;  1YZB A;  1JR9 A;  2JJ2 G;  2PTM A;  4D7T A;  3IC9 A;  4X1K A;  5IDJ A;  1HW7 A;  2EIJ C;  4JYC A;  4YHH O;  3BPZ A;  1ZX3 A;  5CN0 A;  4ZKI A;  3W7T A;  2W0X A;  1ZTE A;  1XOU A;  4JYY A;  4X62 O;  4LCU C;  3UCS C;  3CJH A;  1R73 A;  5LP6 A;  5EBL C;  2Q8V A;  1OHH G;  3CE2 A;  4CH6 A;  3OE7 G;  2EIK B;  2QR4 A;  1NTZ H;  3A0H Z;  4E2L A;  1SS3 A;  4YIO A;  5EZY A;  3BY6 A;  1N33 O;  2DYS C;  4CH5 A;  3TJT A;  3SJB C;  1OV9 A;  4MSW C;  1BQ0 A;  4DR6 O;  3WB2 A;  3ZHQ A;  4JF3 A;  4N21 A;  1M57 B;  2ETN A;  4JI2 O;  1AP5 A;  4WF9 V;  3TGU H;  5LA6 A;  3WB0 A;  4G28 B;  4RO2 A;  5C8Y B;  3JD4 A;  2Q9L A;  2VWJ A;  4OGQ B;  1ZSP A;  1NR1 A;  4DR4 B;  3T1C A;  4K0K B;  2W0F C;  4IHJ B;  3THO A;  1EZJ A;  4UB8 Z;  4RUE A;  3RYH A;  1B06 A;  3CCQ V;  2V4D A;  2BSK B;  4F4L A;  3APO A;  4PDV A;  4I4T A;  1WJZ A;  4GZR B;  1WPB A;  4YY3 B;  1VQ9 V;  1OCR C;  3D3Q A;  2MK3 A;  1N0J A;  2M7W A;  3RYI B;  5IYD O;  1OJH A;  4X1I B;  4X1Y A;  5B66 Z;  4B3R B;  1JOY A;  1SQP H;  5CA0 A;  4U7N A;  1QBZ A;  1VQO V;  3AEI A;  2R70 A;  3ICX A;  1AJQ A;  2F93 B;  4LNU B;  2KKW A;  2ZIN A;  4DV5 B;  4U3F H;  1GMG A;  2AW9 A;  4BWA A;  2EIM C;  4GX2 A;  3JAW A;  3T1Y O;  4UV9 A;  4BW5 A;  1K7D A;  4TUY B;  1GTO A;  4LWS A;  1KQS U;  4I9W A;  3B4S A;  4WFF A;  1GRJ A;  2N74 A;  4QPK A;  3BVO A;  3MHS C;  3Q4H A;  1CP9 A;  3SPG A;  2QKC A;  4CH3 A;  2P7T C;  1QVG U;  3E86 A;  3D36 C;  1D5N A;  1OCC C;  3B40 A;  1ZL8 A;  3P3P A;  1PNM A;  1VF6 C;  4IT5 A;  2WPD G;  5IT9 N;  4DR7 O;  2A06 H;  2R9R B;  3RYF A;  1YIJ V;  2HG5 C;  3TET A;  1XRE A;  3JAT B;  2EZO A;  4Z2W A;  1P7G A;  4H37 A;  2UUA O;  4ICG A;  4JGS A;  1K5Q A;  2ATK C;  2CGO A;  1GO3 F;  4O2B B;  5BY1 A;  2EIL B;  3DSQ A;  4DV0 O;  2IH1 C;  1V9P A;  1J5E B;  1S76 D;  1E44 B;  3QG5 A;  2F23 A;  4IIJ B;  2CDY A;  5KHI A;  4JI2 B;  4J11 A;  1OCZ C;  1XHZ A;  2ZXW B;  1MZF A;  4YJ3 B;  3T4D A;  1WA8 B;  1FS0 G;  4K35 A;  5FPO A;  3RN4 A;  2RMK B;  3L72 H;  2H8P C;  3F7V C;  5KHJ A;  1B04 A;  1BT8 A;  4PDM A;  4LF7 O;  1HNX B;  1SC5 B;  4BR6 A;  3K08 A;  1GAX A;  3UT5 A;  2WA3 A;  3CSX A;  3OAA G;  4GUN A;  4IL6 Z;  4BW9 A;  4R50 A;  4C7U A;  5JWP A;  4MT8 A;  1VF5 B;  4EEQ A;  4FIP C;  1VQ6 V;  2F1M A;  1PD3 A;  1S77 D;  3AG3 B;  1VQ7 V;  4J41 A;  1HNW O;  1Q6H A;  4BAY A;  1WNS A;  5BMV B;  1HWY A;  2IU0 A;  3WU2 Z;  3SYP A;  1AR4 A;  2Z3Y A;  4TSF G;  4H0L B;  4YXW G;  2ODM A;  4JI0 B;  1JFF B;  3LUT B;  2AGA A;  3OEE G;  2Q0A A;  3IC7 A;  4LWS B;  2ZR3 A;  3CRM A;  3DXR A;  1Q5O A;  1OCC B;  1YF2 A;  1XIL A;  4JI8 O;  1V55 B;  3ZJZ A;  2XT9 A;  4N23 A;  4FVM A;  5H9C A;  2X0L A;  3SPC A;  3CXH F;  4O4I B;  4NXM B;  3I5D A;  2CGN A;  3D3I A;  4MTX A;  2UUC B;  1R3J C;  4LFB O;  4MTG A;  3CC7 V;  3M8A A;  3EVK A;  2EIM B;  1ZL8 B;  4LP8 A;  2ITD C;  3ZMZ A;  2P4V A;  2D2C B;  4UVA A;  1VMG A;  2N05 A;  5JQG B;  1N32 O;  4PA6 A;  1X59 A;  3MDS A;  5LMU O;  1FJG O;  1K73 W;  4DR3 O;  3GVM A;  3RYC B;  3RYC A;  4FMT A;  3E22 B;  3CMA V;  4QIW F;  5JJN B;  3OMN B;  4ZOL B;  5LXT B;  4LC1 A;  4ZOL A;  5CB4 B;  5LXT A;  3U10 A;  5CMU A;  4LF5 B;  4CC5 A;  1YI2 V;  4O4J A;  3JSN A;  2VQE O;  2LGW A;  4JZG A;  1GM9 A;  5L3G A;  3AG3 C;  4WFA V;  4IYH A;  4YHH B;  2VQF B;  3ABL C;  1UJW B;  5C93 A;  1AB3 A;  2BE3 A;  3K5N A;  4EKW A;  2ZDI C;  5ITZ A;  4DV6 B;  4IGG A;  4MVQ A;  1GH6 A;  3ETE A;  4I50 A;  4JYA O;  4NTY A;  4I50 B;  4BIO A;  4I0X B;  4OX9 O;  5JJE B;  3FB7 C;  3JAR A;  1EFR G;  4MS2 A;  4UCO A;  3GB7 C;  3JAR B;  5J2T A;  1R3K C;  1M56 C;  1FXK A;  4H33 A;  1JJO A;  3K57 A;  3KG2 A;  4ZBM A;  3IAY A;  1IXM A;  2QDO A;  2EIL C;  5EYP B;  4LFA O;  3VQX A;  2EBO A;  1COW G;  2E5L B;  3FKS G;  3I55 V;  1RSO A;  1Y66 A;  4DR7 B;  3I56 V;  4GKJ B;  2PI5 A;  2IW5 A;  1XBL A;  4FLU A;  5KUK A;  4I5S A;  2C2A A;  3OM3 B;  4WFE A;  4DK1 A;  2ADP A;  4PJ0 Z;  3B8M A;  1I08 A;  2EIK C;  3H1L H;  5B3S B;  4JTC B;  4B7E A;  5IWA B;  3FYI B;  3CCS V;  5H6Q A;  2L6L A;  1FXK C;  1NQT A;  2OWO A;  4EFB A;  5KX5 A;  3KZI Z;  5KX5 B;  3G67 A;  5LGT A;  4H44 B;  3L9D A;  2MW2 B;  5LOV B;  3EHB B;  3E35 A;  4K3A A;  3ZCC A;  2Q7E A;  1M93 A;  4WFB V;  4DV0 B;  5KLV H;  4CC6 A;  4OPH A;  2PF4 E;  1OCO B;  1QLN A;  3RBZ A;  2LW1 A;  1NJI W;  3G6E V;  2FYU H;  4DR2 O;  5LHI A;  2DQ0 A;  4ZI7 A;  1Q90 D;  1TUE B;  4DRX B;  1NS1 A;  3KCY A;  1PP9 H;  1VF7 A;  2V7Q G;  2GHY A;  4TWK A;  3ASO B;  2XAH A;  4RQE A;  4K8X A;  3AK1 A;  4LFC O;  3S3X A;  1GN3 A;  4AIL C;  2E75 B;  3OGC C;  2E74 B;  2ZQM A;  4J10 A;  1EZV H;  4DR1 B;  3ZMS A;  3HKB A;  2HJF C;  4FLY A;  2ZNJ A;  3HKB B;  4JV5 B;  3HB3 B;  1BL8 A;  3IGA C;  3ZIA G;  2YXY A;  2ZCE A;  1THZ A;  3ZED A;  3DC6 A;  2JVD A;  1EM1 A;  3F7Y C;  2UXX A;  5HFM A;  1Y67 A;  4DR5 O;  1FXH A;  1K8A W;  2F4V O;  4JAV A;  1IBM O;  4MTO A;  3GWO A;  4R8C A;  4XDL A;  2ITC C;  1DK1 A;  3J7A U;  5KAI Z;  4LFB B;  3CCM V;  5AG2 A;  2XAJ A;  3QF7 A;  3N27 A;  2UXB B;  3SYQ A;  2HFE C;  3ABU A;  2CTP A;  3KKY A;  3K0G A;  1ZWI C;  3O65 A;  4Z1V A;  4MVR A;  1D5A A;  3CCR V;  1SQQ H;  1GM8 A;  1S72 V;  2Q4P A;  3ASN C;  2RJZ A;  4UUJ C;  1Z2G A;  1RPO A;  1D2D A;  4RUF A;  4I9Q A;  1W0K G;  1T5E A;  4Q20 A;  4ZHQ A;  1N4C A;  2OT5 A;  1YIT V;  3QO5 A;  2OYQ A;  1AJN A;  5GW7 A;  4FLX A;  2K1E A;  2Q7G A;  1BHB A;  4R6Z A;  3HKE A;  1S5L Z;  3PJS K;  3ABL B;  1L1F A;  2F66 C;  4W4K A;  5JH7 B;  2RNB A;  3L73 H;  2UXC O;  4LBE C;  4JV5 O;  2XOK G;  5K1P A;  4KXR A;  4P30 A;  2OTJ V;  4HAM A;  4TV9 A;  1Y4M A;  2GSM B;  1K9M W;  4JI5 B;  1IXB A;  2DOS A;  3ABM B;  3ZRS A;  1XMO O;  4DV3 O;  2UU9 O;  1G8M A;  4B3M O;  4GX5 A;  1VQL V;  1A32 A;  4JAS A;  4DRX A;  1K4D C;  2EIJ B;  3N2G A;  3RWR D;  1XI1 A;  3D36 A;  1CXZ B;  4TV8 A;  3CHX A;  1PL0 A;  5IJ9 A;  5EIB D;  1V54 C;  1CEZ A;  4DUZ O;  1HNZ O;  2PGG A;  1DF4 A;  1CPY A;  1MZE A;  4JI0 O;  4DXW A;  1WP8 A;  2GV9 A;  4CS4 A;  1RP3 B;  5KA6 A;  1IBL O;  1R6T A;  1H2M A;  3ZRV A;  1PM9 A;  1M56 B;  3RVY A;  2XAG A;  4TOI A;  3OTO B;  2DYS B;  4QE7 A;  4X1I A;  2DWD C;  4L87 A;  1LUW A;  1Q3E A;  2CE4 A;  4JI7 B;  1H2K A;  2NLJ C;  1K3E A;  4O4L A;  1LR1 A;  1PNL A;  1V55 C;  3AG7 A;  1RM1 C;  1G4Y B;  2ZDI A;  1N0N A;  1JFF A;  1NVP B;  2QEX V;  1O9G A;  1TGO A;  3RVZ A;  2PYL A;  1SET A;  1GK9 A;  2KB1 A;  2HP8 A;  4FFB A;  4O2A A;  3CJH B;  2ZE7 A;  3HPL C;  3LSU A;  2BTQ A;  2GTS A;  5BZB A;  4LF6 O;  3OMA B;  5EIB C;  3CRQ A;  4JI6 B;  3K5O A;  4DW0 A;  2HR3 A;  1M9N A;  3ZRW A;  1P84 F;  2B1I A;  2CTW A;  3QNE A;  5EBW C;  2H94 A;  4PDR A;  1MA1 A;  5EBM C;  1Q6I A;  1E1Q G;  2JS3 A;  2YI8 A;  2ZIM A;  4NYK A;  2ZM6 O;  5JQG A;  5EK0 A;  2WLL B;  4UCS A;  5D5Q A;  1EBO A;  2A79 B;  2P06 A;  3ZBH A;  3CXC U;  1Q8I A;  4DV4 B;  3LDD A;  3AG1 C;  3JAS B;  2RQ6 A;  2WA4 A;  1WA8 A;  4JI3 O;  2ZR2 A;  3T1H O;  5BXZ A;  4LF5 O;  3BA9 A;  2YXH A;  3F5T A;  1SQX H;  2H3O A;  2K9P A;  2VS0 A;  3RT3 C;  4HBN A;  1FKA O;  5JVD B;  3STZ C;  4EB6 B;  2BCC H;  4EB6 A;  2JEU A;  1GM7 A;  4LH7 A;  4MVU A;  4XDJ A;  1IVS A;  4X66 O;  3AG2 B;  1SA0 B;  2NR5 A;  4FM2 A;  4CBC A;  1I94 B;  1MAB G;  3TCU A;  3P32 A;  3FB5 C;  2XHB A;  4RQF A;  5IY5 C;  2Q7H A;  3JAL A;  2CH7 B;  4DO2 A;  2CH7 A;  3OR7 C;  2BSK A;  4DR3 B;  2IU3 A;  4O4L B;  2BOB C;  1SQF A;  4LNU A;  3BA8 A;  1M1K W;  2QM8 A; 
#chains in the Genus database with same CATH homology
 1GM9 A;  1KP2 A;  4MVM A;  5L3G A;  3K04 A;  1KP3 A;  5L3D A;  3AG3 C;  4WFA V;  2XAS A;  1OCO C;  1K92 A;  4G27 B;  2IJH A;  3LSS A;  4X89 A;  5CBF A;  4MVZ A;  3ABL C;  1VQP V;  1E79 G;  1UJW B;  5C93 A;  1VQ5 V;  4EKW A;  3K3W A;  3VOU A;  2HLD G;  2ZDI C;  2OCC B;  3CCL V;  2DQ3 A;  3VBB A;  4PA4 A;  1NKD A;  4CZZ A;  4MVQ A;  3CP1 A;  2Y69 B;  1W2B U;  3ETE A;  3CD6 V;  2NNU A;  1BMF G;  4R7C A;  2Q68 A;  5L3B A;  2QTO A;  3ASN B;  4J9Y B;  2EJR A;  1NH2 D;  2JJ1 G;  3OFN G;  4PA9 A;  3FB7 C;  4HZ3 A;  4MS2 A;  1EFR G;  5LBQ A;  3GB7 C;  1JQ0 A;  1YHQ V;  2EIN B;  3A0R A;  2EZP A;  2QE7 G;  4WCE V;  5B1O A;  1R3K C;  2WLN A;  3ZRW B;  1M56 C;  1DF5 A;  2P67 A;  1FXK A;  4H33 A;  1AI5 A;  5FL7 G;  4GCZ A;  1K4C C;  1F23 A;  1BHA A;  3OUS A;  3OEH G;  3KG2 A;  4ZBM A;  2Q67 A;  2WLI B;  1IXM A;  3B8N A;  3F5W C;  2EIL C;  2JEX A;  1SRY A;  5IYC O;  2EBO A;  1YTF B;  1Q7Y W;  2P6J A;  1K97 A;  1COW G;  3OMI B;  3ZN1 A;  2YEV B;  3FKS G;  2AHZ A;  2LFS A;  2XND G;  3I55 V;  3CC4 V;  3LNM B;  1OCZ B;  3AG1 B;  1ORQ C;  1Y66 A;  3BEH A;  2WSS G;  3JD0 A;  4KFM A;  1JVM A;  3I56 V;  1E1R G;  2Y69 C;  4KP4 A;  4QNH B;  3SPH A;  1S3J A;  3LSQ A;  1K5S A;  2PI5 A;  2IW5 A;  3K03 A;  1VQN V;  2XAQ A;  5LGU A;  5KUK A;  1KKD A;  1H2G A;  4I5S A;  1PNK A;  2C2A A;  1F4N A;  1Q81 W;  1B6Q A;  2Q6A A;  3OM3 B;  2WLH A;  4WFE A;  3T4Z A;  2JDI G;  1JCH A;  3P30 A;  4P2Z A;  2R9I A;  3B8M A;  1YJW V;  2EIK C;  5B3S B;  3ABM C;  3E8B A;  4JTC B;  3FYI B;  3CCS V;  5H6Q A;  3CYO A;  2WLJ A;  1I5X A;  3ZN0 A;  1FXK C;  1NQT A;  2OTL V;  1MG1 A;  3WG7 C;  2W6J G;  1K33 A;  1AJP A;  5B1A B;  3SPJ A;  4FJC C;  5LGT A;  3OUF A;  3WG7 B;  3ABK B;  1K34 A;  3ASO C;  2B5U A;  1MSW D;  1F51 A;  3EHB B;  3CPW U;  4FPP A;  3E35 A;  1S5H C;  3ZCC A;  4TT3 G;  3JD1 A;  2Z5U A;  4PA7 A;  2DYR C;  5L3E A;  4MVS A;  4UVB A;  1M90 W;  4WFB V;  2JJ2 G;  3CME V;  3E8F A;  1ARO P;  1R6K A;  5IDJ A;  2EIJ C;  2DYR B;  4GT1 A;  4JYC A;  1J95 A;  4UV8 A;  2PI4 A;  1OCO B;  5CN0 A;  1QLN A;  4ZKI A;  2XAF A;  3RBZ A;  3W7T A;  1NJI W;  3G6E V;  4G2K A;  5LHI A;  2DW4 A;  1VQ4 V;  1VQK V;  3R65 A;  2DQ0 A;  1YJN V;  4LCU C;  3JCZ A;  1FXK B;  1R73 A;  4JYB A;  1ROP A;  5EBL C;  5B1B C;  4XBF A;  1OHH G;  1TUE B;  4J9Z B;  3OW2 U;  3OE7 G;  2X6B A;  2V7Q G;  2EIK B;  2GHY A;  4TWK A;  3ASO B;  2XAH A;  4E2L A;  4RQE A;  1LNQ A;  3W7X A;  3BY6 A;  2DYS C;  5CBH A;  4XDK A;  2W6I G;  4UXN A;  3K0D A;  2QKS A;  4MSW C;  3OGC C;  3FB8 C;  2ZQM A;  3ZMS A;  2HJF C;  2LP7 A;  4JF3 A;  1YTF D;  3HB3 B;  1BL8 A;  4N21 A;  3IGA C;  3B77 A;  4WFH A;  3ZIA G;  5CBG A;  1THZ A;  5LHH A;  1M57 B;  2X6C A;  2A0L A;  3ETG A;  4WF9 V;  3F7Y C;  2UXX A;  4G28 B;  2QM7 A;  5HFM A;  5IYB O;  4RO2 A;  2IH3 C;  1FXH A;  3JD4 A;  1K8A W;  4JAV A;  1NR1 A;  3NXS A;  4MTO A;  2Y48 A;  2Q69 A;  5LGN A;  3GWO A;  4R8C A;  3T1C A;  4XDL A;  4QJF B;  2ITC C;  2W0F C;  4P9O A;  5H6R A;  3CCM V;  2XAJ A;  1EZJ A;  4RUE A;  2WAM A;  3E8H A;  3SYQ A;  3CCQ V;  2JIZ G;  1NVP D;  5EC2 C;  2HFE C;  1WPX A;  3ABU A;  5EC1 C;  1H8E G;  2OCC C;  2YSU B;  4F4L A;  3QO7 A;  4PDV A;  3JD3 A;  1DLB A;  3K0G A;  1JJ2 U;  2EIN C;  1VQ9 V;  1OCR C;  2MK3 A;  1ZWI C;  2M7W A;  2FTK A;  5IYD O;  4MVR A;  3CCR V;  1NH2 B;  1GM8 A;  1S72 V;  1JOY A;  3ASN C;  1OCR B;  4UUJ C;  4U7N A;  3SYO A;  1RPO A;  4RUF A;  1QBZ A;  2DWE C;  1VQO V;  3AEI A;  3SYA A;  1AJQ A;  2V1D A;  4X8A A;  1W0K G;  4JPR A;  4Q20 A;  1YSC A;  1GMG A;  2OT5 A;  3FB6 C;  5HFL A;  1YIT V;  3QO5 A;  3E2E A;  1S0V A;  1AJN A;  5GW7 A;  2EIM C;  4GX2 A;  2AHY A;  4P9P A;  3ZMV A;  4BIZ A;  2K1E A;  3K06 A;  1OZ0 A;  4UV9 A;  4BW5 A;  1K7D A;  4R6Z A;  1BHB A;  1GTO A;  4U7O A;  3CCU V;  3ZRX A;  1KQS U;  3PJS K;  4I9W A;  3SYC A;  3ABL B;  1L1F A;  4WFF A;  3AG2 C;  4MTF A;  4QPK A;  3MHS C;  5B3S C;  4PDL A;  1P7B A;  1I5Y A;  3STL C;  2JK5 C;  1CP9 A;  4LBE C;  3SPG A;  2P7T C;  1XL6 A;  3E86 A;  3K9A A;  2XOK G;  3X2Q C;  1QVG U;  2WWW A;  1OCC C;  1KC8 W;  1PNM A;  2WPD G;  4P30 A;  2OTJ V;  2D3O W;  4HAM A;  2X7R B;  2IJK A;  1Y4M A;  2GSM B;  3X2Q B;  1K9M W;  3ABK C;  3G71 V;  3ZRS A;  3ABM B;  2R9R B;  3JYC A;  1YIJ V;  2HG5 C;  4GX0 A;  1P4R A;  1G8M A;  3TET A;  3M99 B;  2EZO A;  4UDM B;  4GX5 A;  1VQL V;  1M1K W;  4H37 A;  1W0J G;  4JAS A;  3CCV V;  1K4D C;  4JGS A;  1K5Q A;  2EIJ B;  2ATK C;  3D36 A;  5J9P C;  2BOC C;  1GO3 F;  4MW3 A;  1QLE C;  1PL0 A;  2EIL B;  1N8R W;  2IH1 C;  1V54 C;  3WFV A;  1S76 D;  2ZD9 A;  2HVJ C;  1E44 B;  1CEZ A;  1JPX A;  1RPR A;  3FYE B;  3ZMT A;  1AI6 A;  3UM7 A;  4JAU A;  2WLI A;  4Z1M G;  3CCE V;  1DF4 A;  1OCZ C;  1SZT A;  1CPY A;  1NR7 A;  2ZXW B;  4HYO A;  3T4D A;  3AG4 C;  4DXW A;  1FS0 G;  4MW8 A;  2X6A A;  3MHH C;  4JTD B;  5KA6 A;  2H8P C;  3F7V C;  3SPI A;  3ZRV A;  4PDM A;  1VQ8 V;  3RVY A;  1M56 B;  2XAG A;  2WLL A;  3W7S A;  2IJJ A;  2CK3 G;  2DYS B;  3IFX A;  4QPJ A;  4QE7 A;  2LFR A;  5DN6 G;  4GX1 A;  2DWD C;  3K08 A;  3MD0 A;  4L87 A;  3SJQ C;  1H38 A;  5DM6 V;  1WLE A;  1KD1 W;  3W7W A;  2NLJ C;  3CC2 V;  1K3E A;  1SES A;  3OAA G;  5KA5 A;  2HVK C;  3LDE A;  1QR9 A;  5LHG A;  2A9H A;  3OR6 C;  1PNL A;  1V55 C;  1RM1 C;  4R50 A;  1G4Y B;  2ZDI A;  4MT8 A;  3T2M A;  4FIP C;  1VQ6 V;  2IJI A;  1NVP B;  2QEX V;  1PD3 A;  1S77 D;  3AG3 B;  1VQ7 V;  1Q86 W;  4PEL A;  3AG4 B;  1R3I C;  4BAY A;  3H01 A;  3ETD A;  2P90 A;  3RVZ A;  4BIU A;  3CCJ V;  2QA4 V;  1SET A;  1R6N A;  1GK9 A;  3ML0 A;  2KB1 A;  1HWY A;  2IU0 A;  4ASU G;  3SYP A;  2Z3Y A;  4TSF G;  3E83 A;  2UXN A;  4YXW G;  3HPL C;  1PKX A;  4X88 A;  3G4S V;  5BZB A;  2WLK A;  4WFG A;  3DGE A;  3LUT B;  3OEE G;  3IC7 A;  3OMA B;  1AR1 B;  2ZR3 A;  3K79 A;  3E89 A;  1FXV A;  1OCC B;  5L3F A;  2HR3 A;  1M9N A;  3ZRW A;  1V55 B;  3ZJZ A;  2B1I A;  1AI4 A;  2HKO A;  4N23 A;  2X0L A;  1XL4 A;  3JD2 A;  5H9C A;  3SPC A;  3QNE A;  5EBW C;  2H94 A;  4PDR A;  5EBM C;  1E1Q G;  1VQM V;  3D3I A;  4MTX A;  1R3J C;  4MTG A;  3TK1 A;  3ZMU A;  3CC7 V;  1RM1 B;  3E8G A;  5EK0 A;  5CA3 A;  1QCE A;  2WLL B;  1ENV A;  1FFT B;  1EBO A;  2A79 B;  2EIM B;  1QLE B;  3CXC U;  4LP8 A;  2ITD C;  5B1B B;  1DTO A;  3DTU B;  2F43 G;  1H8H G;  3RW0 A;  3LDD A;  3AG1 C;  3EFF K;  1GKF A;  3ZMZ A;  1V54 B;  2B1G A;  4UVA A;  2ZR2 A;  2YEV A;  3LDC A;  4JTA B;  4UVC A;  4PA6 A;  2ZXW C;  3STZ C;  1MOF A;  2WLM A;  1SER A;  1NBM G;  1K73 W;  2JEU A;  1GM7 A;  4MVO A;  5KUM A;  1Q82 W;  4MVU A;  4FMT A;  4XDJ A;  4FK5 C;  5IY5 B;  3W7U A;  3AG2 B;  1R3L C;  4KUM A;  1M57 C;  3CMA V;  5B1A C;  4QIW F;  4OXS A;  3OMN B;  4CBC A;  1MAB G;  3TCU A;  3P32 A;  3FB5 C;  4LC1 A;  4PA3 A;  4RQF A;  5IY5 C;  1JX9 A;  4QE9 A;  5CMU A;  4RAI A;  3UKM A;  4DO2 A;  3ABT A;  3OR7 C;  1YI2 V;  1QR8 A;  1AI7 A;  1KEC A;  2IU3 A;  2BOB C;  5L3C A;  1F4M A;  1YJ9 V;  5B1N A;  1QVF U;  2QM8 A;  3QO8 A;  5E1A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...