2BLWA

Trypsin after a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blwA02
3A8AA 1SQOA 2OBQA 2WPJS 1MAYA 9LPRA 2FEQH 2VIQA 2BD2A 1EAWA 4J2YB 4ISHH 3UREA 2BXTH 3SNBA 2ZGHA 1MBQA 1G37A 4GSOA 1C1NA 1O2HA 2CF9H 1Z8RA 3E91A 2Z9LA 1YF4A 3SNEA 2FTMA 2ZO3H 1C2HA 3I78A 1FV9A 4THNH 2FO9A 5C5OA 2ZEBA 3A82A 1EOJA 1ETSH 1TOMH 3QLPH 1EP6A 1RFNA 1OOKB 2C8XB 1A46H 2G00A 4NWLA 1MCVA 4ZHAA 4O3UA 1Z8IB 3RLWH 1C5LH 1GG6B 1O3LA 3BTTE 4I7YH 4UE7H 1LHEH 2F9BH 1G3BA 1GBEA 1UCYE 1H9IE 3U69H 1OWJA 1B0EA 4NFFA 5CHAC 1SL3A 5T6GA 1A0JA 1XUJA 1XKBC 4CRFA 2QIQA 3EE0B 2XC0A 3HK6B 3SBKA 1ZZZA 3GCOA 1DUAA 3IG6B 4H6SB 2GP9B 4YT7H 1TNLA 4JZEH 3V12A 2B8OH 3CS7A 1SOZA 2JETC 2WUBA 2R0KA 1PPHE 1DM4B 3LU9B 1EPTC 1TGCA 3UWJH 1BIOA 1FPCH 2PSYA 1AZZA 1MH0A 3SOSA 4D9RA 2P95A 1MTSA 1NFYA 4B74A 3SZNA 2ZTYA 3ITIA 3URDA 1YPGH 1BRAA 1AWFH 2FX6A 3A7ZA 4H4FA 3RXSA 4E06H 1RIWC 3LGVA 2FOHA 4GUXA 5PTPA 3UTUH 1AE8H 1D3QB 1GHWH 5DPAA 3ZZ5A 7GCHG 1MTUA 1MQ5A 2PGQB 1LVBA 1O5CB 5EXLA 3TH2H 5AFZH 5DK1A 3QN7A 1E36B 1HUTH 1SFIA 1XKAC 3QUMP 5J4SA 1DOJA 3TNTA 2AFQB 1P10A 1C1TA 4DJZB 3PTBA 4UEHH 1O3HA 3RXTA 1S85A 2QC2A 2VIPA 3VB5A 1FPHH 4I33A 1V2NT 2BMGB 4Y71A 1ANEA 1S0RA 4MNXA 3AASA 3RC4A 1GBKA 1P2IA 2O8MA 3MH4A 2P93A 1VITH 3S9CA 2PKSC 5LGOA 4MPVA 1RRKA 3P95A 4KKDA 3EA9A 5DJ7A 4IS5A 1C4Y2 1O3EA 3S7HB 2H9TH 2GDDA 1P06A 1G3CA 4U2WA 1MU6B 3KGPA 1DY8A 4TY6A 1EZQA 4KELA 3MFJA 1C5VA 1CT2E 3B23B 3BG4C 4TY7A 1AFEH 1O2ZA 1T8OA 1JXPA 2ODPA 3TH4H 3SU2A 1Z7KA 1FXYA 4K1EA 1EAIA 1DICA 2EI7A 3A7VA 2BOHB 4X2YA 1GMHF 4CRCA 1SOTA 3P8NA 3ZV8A 3LH1A 2V0BA 3BG4B 4JYUH 1HXFH 4CHAC 2Z9GA 5GCHG 3KL6A 1PQ7A 1CBWB 1N1LA 1O2RA 2XYAA 2QY0B 4Z6AH 3GCHC 4JK6A 2F9OA 2QAAA 1O3OA 1UTMA 2V35A 1O2VA 1AB9C 2ZCHP 2ZDNA 2A2XH 1SHHB 2C8ZB 1TPSA 1V2WT 3VB7A 1THRH 4F4OC 1EQ9A 1TBZH 1K1PA 1MAXA 1GMDF 4Q2KA 1BITA 1BMAA 2XRCA 2ZPSA 2P8OC 4X0WU 1SC8U 3SU1A 3FP6E 1BRBE 1C5YB 1SG8B 1GI8B 3RXFA 3WY8A 1CE5A 1QJ7B 2VWOA 5G4BA 2CHAB 4LXBH 3A89A 1WBGB 1HAXB 1F0TA 2P8OB 2QGRA 3KIDU 5GPIB 3MO6A 1KTTB 2VNTA 1DVAH 2R2WU 2TGDA 5J4QA 2FDAA 1FDPA 1C1RA 3PWBA 4UD9H 1HRTH 4SGBE 3GDVA 5FCRA 1GBCA 1G3DA 1OWHA 2ZU2A 3OSYA 1IQEA 1A1RA 2QA9E 3K6ZA 2BD3A 4X1PU 5H4IB 4Q7ZA 3GY4A 3FFGA 4I8LA 1O2OA 3EA8A 5HYOA 1AD8H 3F68H 3G01A 1O5GH 3HPTB 1GHVH 3VEQB 5E0HA 4TPYA 1HAVB 1OKXA 2AEIH 4NCYA 1T31A 1VITG 5EQRA 2YNBA 3UFAA 1SGYE 2ZC9H 4I32A 1O3PB 1TA6A 1W0ZU 4FUIA 2ZTZA 1SQTA 1HNEE 2Y81A 4Y10E 4YTAA 1ESTA 4YT6H 1HIAB 1Z1IA 4FUCA 1ZPZA 2UUYA 2XW9A 1EASA 2BZ6H 1SVPA 1TNIA 1DITH 4FVDA 3SU0A 3ESTA 1BTZA 4Z0KA 2CN0H 3PO1C 1GI6A 3RXOA 1GMCG 2AMQA 3HK3B 4OS2A 1AKSB 2O9QA 3A7TA 5DGJA 1KTSB 1B5GH 1C1MA 2PTCE 1ZTLA 2FS8A 5C1YA 2VH0A 1MU8B 2C8YB 4AGKA 3BEIB 4AYYB 1HDTH 4DOQA 1NS3A 1THSH 1XUFA 3TIUA 2NU4E 4NGAH 1Q2WA 1A7SA 1IQIA 5L6NH 1CGHA 2H9EH 1A5IA 5I46H 3E1XB 3AVZA 2Z6BD 2BD9A 2OC8A 1FJSA 1P09A 4WJG2 3EDXB 1T8MA 1S6HA 5EOKA 3SUDA 2BLOA 1CT4E 5ABWA 2G5VA 4IN2A 1HAPH 1W8BH 2TGPZ 1J8AA 4INHA 3ZYEA 3T29A 2PUQH 1WQVH 1TRYA 4I8HA 2WINI 1ZOMA 4AFZA 4INLA 3ZZ7A 4BAOB 3LOXA 1A0HB 1HBTH 1LTOA 5EQQA 1XUKA 8ESTE 4AFUA 1S82A 2FLBH 4MDSA 1ACBE 1OWIA 2Z94A 4AFSA 2PW8H 3BTEE 3SJKA 5EW1H 2PR3A 3VFEA 1SGFG 3GICB 3MNCA 3STJA 2ZG0H 4Y7AA 3KCGH 3P6ZB 5EG4A 3A8CA 1F0SA 3A85A 3O8DA 2SGEE 4NIVA 4YM9A 1Y3UA 2WPLS 2ZFRH 4KP0A 3RXQA 3NPSA 2EA3A 1N8OC 1T4UH 3V13A 1EJAA 2AIPA 3LGUA 1ELAA 3GY7A 2BYAX 4GCHG 2JH6D 5HM9A 1K2I1 2D8WA 3ZZ6A 1HGTH 1YYY1 2R3YA 3VB4A 4OGXA 1ZJDA 4RKJB 1IQJA 1YCPM 4A1TA 1O3DA 2Y5FA 3ZVDA 5DP9A 3V3MA 1TOCB 3SJIA 1PQAA 1O2PA 3GCTG 1MTVA 1LHCH 2UUJB 1MCTA 4B1TA 1QRWA 3B9FH 3O8BA 4U30A 1PYTC 2UUKB 3E0PB 1KYNA 4R0IA 1QRZA 2BD7A 3BG8A 2SGFE 2BLQA 4GAWA 1IHTH 1OSSA 4XE4A 1P03A 3C1KA 1CSOE 1GVKB 1SPJA 1LQEA 2Z9JA 3UNRA 2A32A 2HNTE 4BTUB 1GHYH 1ZHRA 2FOMB 2VU8E 2ZNKH 1GBHA 2VVVA 4AORA 2ZDMA 1GI5A 1GCTC 3SN8A 2C3SA 2IOTA 3LJJA 1UTLM 2SGDE 5JB8S 1D6WA 2GDEH 1TGTA 1UMAH 4NIXA 3R3GB 2ALVA 3Q76A 3UR9A 4D7GA 1C2KA 4Y0ZE 3RM0H 4E7NA 3M37A 1O2QA 3F9HA 1K9OE 2FOAA 1C5QA 3S9BA 2P94A 1AU8A 1NRQH 3ZZCA 2A45B 1GI9B 1DLEA 1XMNB 2NU1E 1VJ9U 5DP5A 3URCA 4MQAA 3LPRA 3HGNA 2A4QA 5JYIA 3JZ2B 1D3DB 4D7FA 2W3IA 2Q6DA 3MU4A 1M9UA 2W5EA 4HTCH 1X7AC 4X6OA 2R0LA 4J1YA 2BD4A 1BHXB 1V2QT 1Z6EA 1ETRH 1V2MT 1ELEE 1O5EH 4JCNA 4NA8A 3RXLA 2ZU3A 4B2BA 1UTKA 3DUXH 3PMAB 1C9TA 1OYTH 1AKSA 4O9VA 3BV9B 1E35B 2RG3A 1QHRB 4M7GA 1KSNA 3RXAA 2V3OH 2OQUA 1PFXC 2BDGA 1QL9A 2Y7XA 4JK5A 3TGKE 2PKAB 1XUIA 4F49A 1C5ZB 2BXUH 1ANBA 1LPZB 1LVMA 5EODA 4GPGA 3SNDA 1GBLA 5FHTA 4ZAEA 2F91A 6CHAB 1K1IA 3LJOA 2Y80A 1W12U 2OBOA 3MNBA 1TABE 3NWUA 1NFXA 4WMDA 2PV9B 2VWMA 4U32A 3D23A 5JBTA 1QBVH 1QCPA 3IWMA 5EQSA 5C3NA 4UFGH 2ANWA 2D1JA 2ZIQH 1EKBB 2ZGCA 2WV4A 2P59A 4ABAA 3CS0A 3NUMA 1W10U 1ELFA 1BBRE 5E0GA 1KXEA 1LPKB 3ATMA 3S9AA 3MMGA 2D26C 2FLRH 2XBVA 3H5CB 1GJ8B 1WTHD 2R3UA 4CH2B 1SGNE 4O3TA 3M7UA 1H8IH 1ARBA 2BVSH 3M61U 2FM2A 1NPMA 3W95A 4IMQA 1C5PA 3U98H 2ZF0H 1G2MA 3RP2A 1MD7A 2HWLB 1F5RA 1F5KU 2PWXA 1O3GA 1YPHE 1A4WH 3GY2A 3TK6A 1DLKB 2BOKA 3I77A 1B7XB 1GBBA 3SU3A 2GT7A 4DIHH 4I31A 4Y8ZA 2FZZA 3NK8A 1HJAB 1PPCE 1F7ZA 1YCPK 2Y5HA 4ISNA 1ID5H 4AGJA 1O35A 3SUGA 2R9PA 2TIOA 4DW2U 6ESTA 2HLCA 3SNCA 2Z3EA 1Z8JB 3P8FA 1KY9A 3T5FH 1ELTA 4XBBA 5SGAE 4GHTA 2AMPA 1TMBH 3M5NA 4BTIB 3SNAA 1S84A 1Z6JH 2H2ZA 2IPHA 4NIWA 2ZHFH 1O2JA 4X8SH 4NWKA 2BLWA 2P3TB 4AOQA 3A7WA 3MO9A 2F9UA 3TJVA 1A0LA 3LT3A 3VXFH 3T62A 3T28A 2Q6FA 3GY5A 4B76A 1OWDA 1SQAA 1HLTH 3UQVA 1FN8A 1Y3YA 2GV7A 4UFFH 1TRMA 1RTKA 1XXFA 4MVNA 1P57B 3PMHB 5AF9H 3RLYH 2BY7X 2XBWA 1C2EA 2B0FA 5JB9S 4K8YA 2BY5X 1SLUB 6GCHG 1O2UA 4Q7XA 4CRGA 2NU2E 5CHAB 1MTNC 1WYKA 1YPLH 5A2MH 1QL7A 1SGPE 3AAUA 1OX1A 2XC5A 2BHGA 3QTVH 4JMYA 5TCAA 1AVXA 1GBIA 1TQ0B 1H9LB 1MKWK 1BJVA 1H9HE 1PPFE 1SGFA 3FANA 7ESTE 1Y5BT 2F3CE 1HJ8A 2JETB 1K1MA 1QQUA 5CE1A 1MZAA 3AAVA 4X1RU 1EPTB 3A87A 3Q3XA 1FIWA 1JBUH 2OCVB 4WMFA 1CGIE 2ZU4A 1LHFH 1TQ7B 1EAXA 1LHDH 1QB9A 3FVFB 1TMUH 2J9NA 5F8TA 2SFAA 5EPYA 3ZYDA 1AI8H 4AYVB 1OP0A 1V2UT 1RIWB 2QYIA 1A5HA 3E3TA 2BB4A 1L2EA 2PKAA 1GI3A 1BTYA 3PLPA 1AE5A 2UWOA 4NSYA 3T25A 1EATA 1A5GH 1AN1E 3BTKE 1BB0B 9ESTA 3BTQE 8LPRA 3QTOH 1Q3XA 3TK5A 3BSQA 3UOUA 1Y5UT 1ZLRA 2BLVA 3ZZ9A 2GKVE 3A84A 3MHWU 5FX6A 3A8DA 3VB6A 1AWHB 1S81A 3PV4A 3R0FA 1NN6A 2VIVA 1BTPA 4ZUHA 1BQYA 1GCDA 3EAJA 1A61H 5T3HA 4WXIA 2ZHWH 2PKSB 5A8YA 3RU4D 3MH7A 2G4TA 3M5OA 2FPZA 2O8UA 1Y8TA 1EZUC 1W7GH 3SV7A 4DGJA 2B5TB 2O8LA 1OPHB 2A0QB 2ZDVH 1AUTC 1OP8A 1P01A 1UO6A 4INKA 2BX3A 2BD8A 3B8JA 1KDQB 5K7RA 1FY8E 4DCDA 4CBOA 3F1SB 5AFYH 1UCYH 1AO5A 1IOEA 1UK3A 1TWXB 2HNTC 1O2NA 2CXVA 3RXRA 3F9GA 2CGAA 1FY3A 2AIQA 2VB0A 1Y5AT 1UVPA 4X6NA 4CHAB 1HFDA 5A09A 2W3KA 2ZGXH 1MBMA 1XVOA 3CP7A 1NC6A 4B71A 2XWBI 2QV1A 3GCHB 3SORA 2C8WB 2GCHG 1V2TT 2ZTXA 1GI4A 1PPGE 1AB9B 3E6PH 7GCHF 1QB1A 1ANDA 3D62A 3PLBA 1O3NA 4NZQA 3U1IB 1C2IA 3LC5A 8GCHG 2XXLA 3SV6A 4AB8A 4OS4A 1NZQH 3Q77A 1C5TA 1O2WA 3LDXH 5GIBA 1C1PA 2THFB 3HGPA 3DFLA 1N6XA 2PGBB 3HATH 4AG1A 2OINA 1HAYB 2ASUB 3MYWA 1D3TB 2FOGA 1JRTA 3KEEA 2ODQA 1TNHA 1FAXA 1IAUA 3RXJA 5C67A 3ZVBA 2HPQH 5TCCA 2FYRA 2BDYA 5FXLA 2F83A 4FUGA 4Y0YE 3RU4T 2ZP0H 4QT8C 1VCPA 1C2JA 1O5FH 1L1GA 2ZQ1A 5C5NA 2FXRA 4RSPA 3D49H 1O32A 1V2RT 1QJ1B 4Y7BA 3PLKA 1TX8A 2YNAA 1EB1H 3P8GA 1SGQE 2BM2A 5BPEA 1O0DH 4B75A 2G4UA 1C2MA 3MU1A 1ESBA 1NESE 1QR3E 1PJPA 1XX9A 2FOFA 1GBJA 1GJCB 4YO9A 3UIRA 3OU0A 2FOBA 1GI7B 3MO3A 1ZGVA 2OC1A 1YGCH 3AW0A 1T8LA 2AH4X 1P3CA 1ELBA 1KXCA 2HOBA 3GISB 1HAOH 2DE8A 1O2IA 1TMTH 3ATIA 1K21H 3BTDE 3E16B 2O8WA 2Y5GA 1UTQA 1O3JA 1GVZA 1FY4A 3P92A 1EUFA 3A86A 4AN7A 1P3EA 2Q1JA 2OTVA 3RXKA 2ZHDA 3FAOA 2VWNA 4NIYA 1AUJA 1T32A 1DWDH 5EW2H 1ZJKA 2QCYA 4H6TA 1WOFA 1EPTA 3SV9A 1GHBG 1D4PB 2STBE 4LZ4B 3PO1B 2J95A 3E8LA 1GI0A 2V3HH 1UTNA 4BXSA 4ZXXH 1MD8A 2G81E 3KHVA 1WSSH 3PYHA 1ZR0A 3SGQE 3T27A 2J92A 3OY5U 2W26A 3BTHE 2Z9IA 2A5AA 4AFQA 5E8EH 5FBIA 2VIDA 4CREA 1P12E 1JMOH 2A7CA 2H6MA 5F03A 3DA9B 1QA7A 2ZECA 4YOGA 4B73A 2ILNA 4XFQA 5IYTA 1D6RA 3RXHA 4A5TS 1IHSH 4CR9A 4I8GA 1GJ4H 1YPHC 1P05A 1C1WH 4FU9A 2WYJA 1P2NA 2IJOB 4FUBA 1LHGH 2BVXH 1SGEE 1YC0A 4ZKOU 3V7TA 1RTLA 2ZHQH 1BMNH 2F9NA 4IN1A 1C2GA 1HAIH 4ZMAH 1VITF 4IMZA 1O3IA 2AGIX 2GVFA 4KTCA 3U8RH 4UONA 5BRRE 2GTBA 4YLUA 3O8RA 1C1SA 1TB6H 4ESTE 1P2OA 4D76A 4IC6A 1BTHH 2H9HA 2HPPH 1NU7B 2J94A 1YKTA 4ABDA 1KDQA 1RJXB 3M3VA 3MU0A 1UCYK 2PSXA 4X6PA 1OWEA 4AB9A 1ETTH 3W94A 4MPXA 2ULLA 2OUAA 3QGJA 2EI8A 3O8CA 1GMCF 3BIVH 1JIMA 1DFPA 3HKIB 4OS7A 2ZFTA 2SGAA 1N8OB 1GBMA 1O34A 4YLQH 1C4V2 2FYQA 3ZZBA 4HI3A 1QQ4A 1O3CA 4A1VA 1QY6A 3RXPA 4CRAA 2A4OA 1C5MD 1GDUA 4JZ1A 2GMTC 3SW2B 4MPUA 2FS9A 1AMHA 5ETXA 4KGAA 5DO4H 1UJ1A 3ZZ8A 3RXBA 3A8BA 1GJ5H 3SHAH 2K1QA 4BTTB 1NRNH 1QJ6B 1N6YA 4K60A 3RXVA 1EZSC 2XBYA 1ZMLA 1LKBA 3LH3A 4OGYA 5DP3A 1HCGA 1XM1A 1ELDE 1P8VC 2A31A 3SU4A 1YP9A 3Q3KA 3STIA 3RMLH 1WU1A 1Y59T 4AX9H 1C5SA 4IW4E 5FPSA 1FNIA 1DS2E 1J9CH 4O97A 1FUJA 1GCTB 2RDLA 3LGYA 1GHAG 1HPGA 1QBOA 5C2ZA 4A1XA 5A8ZA 4SGAE 2R2MB 1C1OA 2J4IA 2Y6TA 2RA3A 2B7DH 1ZSKA 4XSKU 1O39A 1TLDA 2VJ1A 4YESB 3SU6A 2QXIA 4JZIA 2ZFFH 1EZXC 1C1UH 4DG4A 4ZHMU 3LGWA 2Y7ZA 1BHXF 2ZU1A 2FOEA 3F9FA 7KMEH 2P16A 1Q31A 1CO7E 1UVOA 3Q00A 5L2YH 2G51A 2NWNA 4YOIA 1ABIH 3BIUH 1VGCC 1ZRKA 1WUNH 3NCLA 1CHOG 3UR6A 1DT2A 1MQ6A 1O3MA 1GBTA 4UFDH 2ZCKP 3M7TA 4GCHF 4IGDA 1K28D 2A1DB 2Z3CA 5JBBS 5IDKA 1AQ7A 3MI4A 2XNIA 3ATWA 3MNSA 5EXNA 2FESH 1GWAA 3QZQA 1O2LA 2FOCA 2OC7A 1RTFB 1SGRE 1H8DH 3MH6A 3LKWA 1IQFA 4ZROA 1UVSH 1TRNA 3ZVFA 3MU8A 3GCTF 5HGGA 2CMYA 2WPKS 1SSXA 2ANKH 1SB1H 3GDUA 5E0JA 4DT7B 1BTXA 1VZQH 2Y82A 3VPKA 2VVUA 1FLEE 4WVPE 5ESBA 4E7RG 1V2LT 4WH8A 4NG9H 3TVJB 3KQCA 1IQLA 1O3KA 3ELAH 1JOUB 2ZFSA 3H7OA 2BY8X 3FZZA 4IBLH 1ZMJA 2C93B 5EU8A 4VGCC 1KXFA 1F0RA 1SLVB 5C1UA 1J14A 2PHBA 3RDZA 4BAKB 7LPRA 4ZKSU 2VIOA 3JZ1B 2GCTC 1YLDA 2FMJA 1ANCA 5GXPA 4K2YA 4MLFB 4WY3A 2XC4A 4BANB 4Y79A 1GL1A 1ZPCA 1MZDA 2M5TA 1IQHA 1G2LA 1G30B 1O3AA 2HALA 1PQ5A 3U9AH 5EGMA 1KLJH 4X2WA 1E0FD 1CA0C 1QA0A 2ZHEH 1CT0E 1Z8GA 3RXMA 3RXGA 4DURA 1NO9H 4ABEA 1GJ9B 1J16A 1SI5H 1UHBA 1KIGH 4GHQA 1CHGA 1GJ6A 1V2VT 1UVUH 1GGDC 1WTGH 2VGCC 4ABHA 4NA7A 2ODYB 3TPIZ 1SLXB 3RC5A 1AFQC 2TRMA 1DSTA 3ZZ3A 3I29A 1TX7A 2SNWA 4O03A 3QZRA 1KLTA 1VJAU 1SR5C 1CQQA 1L1NA 1O2KA 2A7HA 4ZKRU 5K0HA 3ZVGA 2HGTH 1S0QA 1SGDE 1JRSA 1V3XA 2A5KA 2ZGJA 3ZZAA 4KTSA 3AW1A 3PWCA 1FQ3A 1QURH 5B6OA 4WH6A 2ESTE 1K22H 5GWZA 2WUCA 3VGCC 1KXAA 1QRXA 1GJ7B 1RGQA 4CR5A 3Q3YA 2G52A 3EA7A 1BRCE 1VCWA 4TWYA 4HGCA 4K1TA 3P70B 4ISLA 1TNKA 4X8UH 2CJIA 1FI8A 2ZU5A 1A3BH 2BDBA 4K3JA 5T6FA 2AGGX 2GX4A 2GZ7A 2H5DA 3RC6A 2ZFQH 3BEUA 1IQNA 5DP7A 1DWBH 1L4DA 4YZUA 1S83A 2VVCA 2UWLA 4PROA 1C5RA 1A3EH 1YPKH 1UK2A 3RXCA 1TPPA 4GVUA 1V2OT 1LQDB 1BUIA 1ESAA 5T6DA 1HAZB 1W0YH 1P2KA 4JYVH 1CU1A 2FWWA 1P9SA 1BTUA 1OWKA 2FX4A 3BTFE 4X1NU 4BNRA 3KQBA 1C2DA 4X1QU 1DWEH 1ELVA 1ZMNA 3BTGE 1UK4A 1EJNA 1P9UA 2LNCA 1TGNA 4HFPB 1XUGA 1GG6C 2KAIA 3F9EA 2RCEA 1W2KH 1GHXH 3QDZB 4KTUA 1EB2A 2BVRH 1BDAA 3TH3H 2O8TA 4YOJA 1Y3WA 1HYLA 2BQWB 1DANH 5LPFA 2ZI2H 4X8VH 1O2TA 3L6PA 4XOJA 3VXEH 1XUHA 1BMMH 1LVOA 1TGBA 2VH6A 3T2NA 1BBRH 1F5LA 4RKOB 1UTPA 5I25A 3OTJE 3LGIA 5LPRA 1GMHG 3PMJA 1MTNB 1V2JT 2C90B 2ZA5A 3ZZDA 1ZTJA 3UWIA 3M3TA 5L2ZH 1D3PB 1NTPA 1PQ8A 3GOVB 3RU4E 5FPYA 1HAHH 1O30A 3BN9A 1C2FA 2B9LA 1FMGA 1YPEH 3PM3A 3M35A 3S7KB 2G8TA 1P11E 3BF6H 3GYLB 2XCFA 3N7OA 1GMDG 1SMFE 4MNYA 1HV7A 3ODFA 2UUFB 2VIWA 1BRUP 1PYTD 6LPRA 1V2PT 4CBNA 1XXDA 4FU7A 3RMMH 1KXDA 4NA9H 1K1LA 1SGIB 2FP7B 3RXEA 2H1UA 3QWCH 4BAQB 1QB6A 2WPMS 1TYNA 3DFJA 5DP4A 3RXUA 5FBEA 1AZ8A 4NZLA 1C2LA 4ZHLU 5ESTE 4ABGA 2GZ8A 2FIRH 4X2XA 2D2DA 3M5LA 1NFWA 1E38B 1AIXH 2EC9H 1Y3XA 1YPMH 3U1JB 1O31A 3ZV9A 3ODDA 2BDHA 4K1SA 1O5AB 4TWWA 3ATKA 1O33A 3RUOA 1YLCA 6GCHF 4NSVA 3SGBE 3U8OH 3ZVEA 4TYDA 2ZDAH 1LVYA 4UFEH 2QN5T 4MNWA 3QGNB 4Y8YA 3TGIE 2GGVB 4WXVA 2ZGBH 5A0AE 2H5CA 3SI4H 3M7QA 5HMAA 3RMNH 1F0UA 1FZZA 2HNTF 1UTOA 1C5UA 1O2YA 1CBWC 1OYQA 2JH5D 1G32B 1YM0A 3RXIA 1ZRBA 2SGPE 1DXPA 1O5BB 1K1OA 2BY9X 1L0ZA 1BMLA 1T4VH 5JBCS 4ISOA 1GPZA 2ZPRA 1E37B 4A7IB 4I8JA 1TX6A 4CRDA 4ABJA 1UVTH 1FONA 2ZDLA 4ZKNU 1GDQA 4Y8XA 4D9QA 3NZIA 3M3SA 3VB3A 5DKMA 1GBFA 1H4WA 5C20A 1SHYA 2CHAC 3KQEA 1MKXH 4I8KA 1P2QA 1V2KT 3KN2A 1NRRH 3F6UH 3SHCH 1C4U2 3ZVAA 1CGJE 8KME2 3RMOH 1SGCA 1O2XA 1MMJN 2ZFPH 2J38A 3SUEA 3LC3A 4JZFH 2I6QA 3CENA 1PPEE 2FI5E 5F8XA 2BTCE 3TGJE 2OC0A 4ABBA 2LPRA 3ZZ4A 4K69A 1QNJA 1Y3VA 1Z71A 1KXBA 3MU5A 1ABJH 4X1SU 3S69A 2G55A 4D8NA 1B0FA 1C5XB 3A83A 2TBSA 1DDJA 1ELGA 2RA0A 4ZH8A 2PLXA 4CRBA 2BD5A 2IN2A 2P3UB 1HAGE 1GVLA 1UTJA 3FP7E 1GI2A 2Z9KA 1ZYOA 2F9VA 2ZDKA 1INCA 5EXMA 2AYWA 2BQ7B 2EEKA 5DP8A 1RD3B 2ZWLH 2ZQ2A 4BAHB 5AHGH 5GCHF 1H1BA 1TFXA 3IITA 4DIIH 4MG3A 3A7YA 3SJ8A 1BBRK 3LIWA 5JPMH 2YOLA 4WF8A 3UOPA 5GDSH 1J15A 4X2VA 3GY8A 1TBQH 2BX4A 1P2JA 2A4RA 1GBAA 4FUFA 1D9IA 1JWTA 1SGTA 2HVXA 2GCHF 2A7JA 3MTYA 3ZVCA 1PPBH 3H7TA 4K5ZA 1ORFA 2QXJA 1GDNA 1W7XH 1TIOA 3GY3A 3QO6A 2ANMH 1GHZA 2BZAA 8GCHF 3OY6U 1IQGA 1HB0B 1P2MA 3D65E 3SGAE 4XDEA 3SQEE 4AG2A 1XVMA 1O36A 3NKKA 1AGJA 1GL0E 2BQ6B 3KF2A 4LZ1H 2TGTA 1VCQA 2FI3E 1AHTH 2Z3DA 1NRPH 2Q6GA 3FZDA 4OS5A 4JZDH 3RM2H 3SI3H 2GD4B 5LPEA 1TONA 1TNJA 1GJDB 2JKHA 5JBAS 5GJ4B 4FUJA 1IQMA 1TAWA 1ZSJA 1J17T 4Q7YA 4Y6DA 1EXFA 3OX7U 5TJXA 1SBWA 4A6LA 1NROH 2BDAA 1QFKH 2G5NA 1V2ST 2XWAA 3ENSB 3TU7H 1JIRA 3SJOA 2QF3A 3SUFA 5DG6A 2AMDA 3SJ9A 4U01A 1ZHMA 5A8XA 1SFQB 3S0NA 3L33A 3K65B 1DWCH 1UHBB 4FVBA 4A92A 2PUXB 3ATLA 5C1XA 2TGAA 5AVDA 2J34A 4BOHA 2XBXA 3DT0H 3LONA 3EYDA 3TITA 3E0NB 1FAKH 4XBCA 1TNGA 1EP5A 1FIZA 2STAE 3UQOA 1GBDA 2CV3A 1BOQA 1DXWA 2JH0D 1P02A 1T7CA 4X6MA 3E90B 4MNVA 5CMXH 1AY6H 4Y11E 2A4GA 2PFEA 1S6FA 4H42U 1FN6A 4LK4A 1LKAA 3GDSA 3P17H 1Z1JA 1F2SE 5FPTA 1V6DA 3EGKH 2P3FH 1AVWA 4NFEA 5HM2A 4ABFA 1O37A 2TPIZ 1DPOA 1DE7H 1TE0A 4MTBA 3M36A 1GHBF 2Z7FE 4WWYA 1ARCA 3TJUA 4LOYH 3UY9A 5FCKA 4ASHA 4OS1A 3P8OA 2FTLE 1EOLA 5DP6A 1MKXK 2C4FH 3GCNA 2FI4E 2PTNA 4B2CA 1YCPH 1S5SA 1RS0A 3LGTA 1MUEB 2BDIA 2XCNA 2GMTB 4FUDA 3BEFB 1DX5M 2VINA 2ZPQA 1C5OH 1WAYB 4UDWH 2GV6A 1C5NH 1O2SA 1ZTKA 1U6QA 3M5MA 5EPNA 2DUCA 1QIXB 1KLIH 5LH8A 1E34B 2ANYA 1ZGIA 3UUZA 5E2OA 2W7SA 1LCYA 3TK9A 2CF8H 1EJMA 2KAIB 2UWPA 1LO6A 1BTWA 2AERH 3DD2H 1C5WB 3SV8A 3K9XB 2V6NA 1LPGB 1NRSH 2GZ9A 5F8ZA 4IC5A 5F6MA 4XBDA 2NU0E 3HKJB 1O5DH 3K6YA 4DY7B 4R8TB 2W7UA 2QXHA 3KQDA 2DE9A 1C1VH 3NXPA 1G36A 1A2CH 1NU9A 2QXGA 2WPHS 1GJBB 2OQ5A 3FP8E 2WYGA 2OP9A 1GJAB 4FUEA 1AVGH 2GT8A 4AZ2B 5FAHA 5L30H 4Q80A 1ELCA 3A88A 5A0CA 1HAVA 3OYPA 1O38A 3KNXA 4Y76A 5A0BA 1DY9A 2FODA 5FX5A 1TGSZ 1VGCB 1O3BA 1YBWA 3MWIU 1CVWH 4HZHA 2WPIS 4JYTA 1HIAA 4FXGH 4B2AA 3TLOA 5JDUB 4ABIA 1EAUA 3QX5H 1MKWH 1G9IE 1LDTT 4RN6A 3V0XA 4FUHA 2WV5A 3BTWE 1G3EA 3MOCA 1ZHPA 3SV2H 2OLGA 3PROA 1K1JA 4BXWA 1WCZA 3TNSA 1GI1A 5HXFA 1TALA 1L4ZA 3PMBB 1F92A 1QBNA 1TA2A 4ZXYH 4WMEA 4E05H 4BAMB 6CHAC 2HRVA 2ALPA 3A7XA 3A81A 4GLYA 1NY22 1P04A 2ZKSA 1PPZA 1O2MA 3UNQA 4MPWA 3MH5A 1TBRH 1HXEH 2A2QH 4VGCB 1GHAF 2VWLA 1O2GH 2OXSA 2XTTB 1L1JA 2J2UA 1QL8A 1K1NA 2GCTB 1MTWA 1DSUA 4DVAU 1W3CA 2SGQE 3QK1A 2ZZUH 1OP2A 1OXGA 2ZCLP 4FU8A 1WV7H 2EI6A 1WQSA 2QF0A 3GY6A 4ISIH 3U8TH 1VR1H 4X8TH 1CA0B 3EQ0H 1QGFA 1O3FA 2BY6X 3TJNA 1SLWB 1W13U 2SNVA 3MNXA 3RXDA 3A80A 1NFUA 3UPEA 3C27B 4TPIZ 4CH8B 1CHOF 3DHKH 3UNSA 5E2PA 1YPJH 1TPOA 4OS6A 1GGDB 2VGCB 2NU3E 3SU5A 3T26A 1CA8B 1BCUH 3K2UA 1AFQB 1HJ9A 1ZPBA 2I6SA 3L3TA 1W14U 2BDCA 2F9PA 1W11U 3PB1E 3SQHE 1FY1A 1OS8A 1P0SH 1FY5A 1HJAC 2AGEX 3BTME 4K8BA 3SO3A 1ZSLA 1C1QA 1RXPA 2A5IA 1NT1A 1LMWB 1BT7A 1THPB 2OD3B 1EX3A 1NM6A 1T8NA 2AS9A 3VGCB 3PTNA 1TPAE 1BJUA 1QTFA 1IQKA 3GYMA 1BA8B 1BZXE 3TJOA 1C9PA 1DUEA
chains in the Genus database with same CATH superfamily
3A8AA 1SQOA 2OBQA 2WPJS 1MAYA 9LPRA 1OHHD 2FEQH 2VIQA 2BD2A 1EAWA 4J2YB 4ISHH 1NBMD 3UREA 2BXTH 3SNBA 2ZGHA 1MBQA 1G37A 4GSOA 1C1NA 1O2HA 2CF9H 1Z8RA 3E91A 2Z9LA 1YF4A 3SNEA 2FTMA 2ZO3H 1C2HA 3I78A 1FV9A 4THNH 2FO9A 5C5OA 2ZEBA 3A82A 1EOJA 1ETSH 1TOMH 3QLPH 1EP6A 2WV9A 4I86A 1RFNA 1OOKB 2C8XB 3AK5A 1A46H 2G00A 4NWLA 1MCVA 4ZHAA 4O3UA 1Z8IB 3RLWH 1C5LH 1GG6B 1O3LA 3BTTE 4I7YH 4UE7H 1LHEH 2F9BH 1G3BA 1GBEA 1UCYE 1H9IE 3U69H 1OWJA 1B0EA 4NFFA 5CHAC 1SL3A 5T6GA 1A0JA 1XUJA 4TSFD 1XKBC 4CRFA 2QIQA 3EE0B 2XC0A 3HK6B 3SBKA 1ZZZA 3GCOA 1DUAA 3OE7D 3IG6B 4H6SB 2GP9B 4YT7H 1TNLA 4JZEH 3V12A 2B8OH 3CS7A 1SOZA 2JETC 2WUBA 2R0KA 1PPHE 1DM4B 3LU9B 1EPTC 1TGCA 3UWJH 1BIOA 1FPCH 2PSYA 1AZZA 1MH0A 3SOSA 4D9RA 2P95A 1MTSA 1NFYA 4B74A 3SZNA 2ZTYA 3ITIA 3URDA 1YPGH 3PV2A 1BRAA 1AWFH 2FX6A 3A7ZA 4H4FA 3RXSA 4E06H 1RIWC 3LGVA 3PV5A 2FOHA 4GUXA 5PTPA 3UTUH 1AE8H 1D3QB 1GHWH 5DPAA 3ZZ5A 7GCHG 1MTUA 1MQ5A 2PGQB 1LVBA 1O5CB 5EXLA 3TH2H 5AFZH 5DK1A 3QN7A 1E36B 4B6FA 1SFIA 1XKAC 3QUMP 2KR7A 5J4SA 1DOJA 1HUTH 3TNTA 2AFQB 1P10A 1C1TA 4DJZB 3PTBA 4UEHH 1O3HA 3RXTA 1S85A 2QC2A 2VIPA 3VB5A 1FPHH 4I33A 1V2NT 2BMGB 4Y71A 1ANEA 1S0RA 2LELA 4MNXA 3AASA 3RC4A 1GBKA 1P2IA 2O8MA 3MH4A 2P93A 1VITH 3S9CA 2PKSC 5LGOA 4MPVA 1RRKA 3P95A 4KKDA 3EA9A 5DJ7A 4IS5A 1C4Y2 1O3EA 1KMHB 3S7HB 2H9TH 2WHXA 2GDDA 1P06A 1G3CA 4U2WA 1MU6B 3KGPA 2L74A 1DY8A 4TY6A 1EZQA 4KELA 3MFJA 1C5VA 1CT2E 3B23B 3BG4C 1K0HA 4TY7A 1AFEH 1O2ZA 1T8OA 4XD7D 1JXPA 2ODPA 3TH4H 3OEHD 1Z7KA 3SU2A 1FXYA 4K1EA 1EAIA 1DICA 1VKYA 2EI7A 3A7VA 2BOHB 4X2YA 1GMHF 4CRCA 1SOTA 3P8NA 3ZV8A 3LH1A 2V0BA 3BG4B 2JIZD 3DSPA 4JYUH 1HXFH 4CHAC 2Z9GA 3F2HA 5GCHG 3KL6A 1PQ7A 1CBWB 1N1LA 1O2RA 2XYAA 2JJ1D 2QY0B 4Z6AH 3GCHC 4JK6A 2F9OA 2QAAA 1O3OA 1UTMA 2V35A 1O2VA 1AB9C 2ZCHP 2ZDNA 2A2XH 4B6EA 1SHHB 2C8ZB 1TPSA 1V2WT 3VB7A 1THRH 4F4OC 1EQ9A 1TBZH 1K1PA 1EFRD 1MAXA 1GMDF 4Q2KA 1BITA 1BMAA 2XRCA 2ZPSA 2P8OC 4X0WU 1SC8U 3SU1A 3FP6E 1BRBE 1C5YB 1SG8B 1GI8B 3RXFA 3WY8A 1CE5A 1QJ7B 2VWOA 3DSGA 5G4BA 2CHAB 4LXBH 3A89A 1WBGB 1HAXB 1SKYE 1F0TA 2P8OB 2QGRA 3KIDU 5GPIB 3MO6A 1KTTB 2VNTA 1DVAH 2R2WU 2TGDA 4Z1MD 5J4QA 2FDAA 1FDPA 1C1RA 3PWBA 4UD9H 1HRTH 2KX4A 4SGBE 3GDVA 5FCRA 4F48B 1GBCA 1G3DA 1OWHA 2ZU2A 3OSYA 5F53A 1IQEA 1A1RA 2QA9E 3K6ZA 2BD3A 4X1PU 5H4IB 4Q7ZA 3GY4A 4TT3D 3FFGA 4I8LA 1O2OA 3EA8A 3SYJA 2VBCA 5HYOA 1AD8H 3F68H 3G01A 1O5GH 3HPTB 1GHVH 3VEQB 5E0HA 4TPYA 1HAVB 1OKXA 2AEIH 2KM0A 4NCYA 1T31A 1VITG 5EQRA 2YNBA 3UFAA 1SGYE 2ZC9H 4I32A 1O3PB 1TA6A 2KFWA 1W0ZU 4FUIA 2ZTZA 1SQTA 1HNEE 2Y81A 4Y10E 4YTAA 1ESTA 4YT6H 1HIAB 1Z1IA 4FUCA 4DT4A 1ZPZA 1YLNA 2UUYA 2XW9A 1EASA 2BZ6H 1SVPA 1TNIA 1DITH 4FVDA 3SU0A 3ESTA 1BTZA 4Z0KA 2CN0H 3PO1C 1GI6A 3RXOA 1GMCG 2AMQA 3HK3B 4OS2A 1AKSB 2O9QA 3A7TA 5DGJA 1KTSB 1B5GH 1C1MA 2PTCE 1ZTLA 2FS8A 5C1YA 2VH0A 1MU8B 2C8YB 4AGKA 3BEIB 4AYYB 1HDTH 4DOQA 1NS3A 1THSH 1XUFA 3TIUA 2J98A 2NU4E 4NGAH 2QF4A 1Q2WA 1A7SA 1IQIA 5L6NH 1CGHA 2H9EH 1A5IA 5I46H 3E1XB 3AVZA 2Z6BD 2BD9A 2WPDD 2OC8A 1FJSA 1P09A 4WJG2 3EDXB 1T8MA 1S6HA 5EOKA 3SUDA 2BLOA 1CT4E 5ABWA 2G5VA 4IN2A 1HAPH 1W8BH 2TGPZ 1J8AA 4INHA 3ZYEA 3T29A 2PUQH 1WQVH 1TRYA 4I8HA 2WINI 1ZOMA 4AFZA 4INLA 3ZZ7A 4BAOB 3LOXA 1A0HB 1HBTH 1LTOA 5EQQA 1XUKA 8ESTE 4AFUA 1S82A 2FLBH 4MDSA 1ACBE 1OWIA 2Z94A 4AFSA 2PW8H 3BTEE 5C0UA 3SJKA 5EW1H 2PR3A 3VFEA 1SGFG 3GICB 3MNCA 3N7DA 3STJA 2ZG0H 4Y7AA 3KCGH 3P6ZB 5EG4A 3A8CA 1F0SA 3A85A 3O8DA 2SGEE 4NIVA 4YM9A 1Y3UA 2WPLS 2ZFRH 2XNDD 4KP0A 3RXQA 4F55A 3NPSA 2EA3A 1N8OC 1T4UH 3V13A 1EJAA 2AIPA 3LGUA 1ELAA 3GY7A 2BYAX 4GCHG 3OEED 2JH6D 5HM9A 1K2I1 2D8WA 3ZZ6A 1HGTH 1YYY1 2R3YA 3VB4A 4OGXA 1ZJDA 4RKJB 1IQJA 4ACAA 1YCPM 4A1TA 1O3DA 2Y5FA 3ZVDA 5DP9A 3V3MA 3NRLA 1TOCB 3SJIA 1PQAA 1O2PA 3GCTG 1MTVA 1LHCH 2UUJB 1MCTA 4B1TA 1QRWA 3B9FH 3O8BA 4U30A 2W6ID 1PYTC 2UUKB 3E0PB 1KYNA 4R0IA 1QRZA 2BD7A 3BG8A 2SGFE 2BLQA 4GAWA 1IHTH 1OSSA 4XE4A 1P03A 3C1KA 3WWFA 1CSOE 1GVKB 1SPJA 1LQEA 2Z9JA 3UNRA 2A32A 2HNTE 4BTUB 1GHYH 1ZHRA 2FOMB 2VU8E 2ZNKH 1GBHA 2VVVA 1UW7A 4AORA 2ZDMA 1GI5A 1GCTC 3SN8A 3U28C 2C3SA 2IOTA 3LJJA 1UTLM 2SGDE 4AC9A 5JB8S 1D6WA 2GDEH 1TGTA 1UMAH 4NIXA 2OK5A 3R3GB 2ALVA 3Q76A 3UR9A 4D7GA 1C2KA 1SQRA 4Y0ZE 3RM0H 4E7NA 3M37A 1O2QA 3F9HA 1K9OE 2FOAA 1C5QA 3S9BA 2P94A 1AU8A 1NRQH 3ZZCA 2A45B 1GI9B 1DLEA 1XMNB 2NU1E 1VJ9U 5DP5A 3URCA 4MQAA 3LPRA 3HGNA 2A4QA 5JYIA 3JZ2B 1D3DB 4D7FA 2W3IA 2Q6DA 3MU4A 1M9UA 2W5EA 2HVYB 5EJ1A 4HTCH 1X7AC 4X6OA 2R0LA 4J1YA 2BD4A 1BHXB 5T1VA 1V2QT 1Z6EA 1ETRH 1V2MT 1ELEE 1O5EH 4JCNA 4NA8A 3RXLA 2ZU3A 4B2BA 1UTKA 3DUXH 3PMAB 1C9TA 1OYTH 1AKSA 4O9VA 3BV9B 1E35B 2RG3A 1QHRB 4M7GA 1KSNA 3RXAA 2V3OH 3WW7A 2OQUA 1PFXC 2BDGA 1QL9A 2Y7XA 4JK5A 3TGKE 2PKAB 1XUIA 4F49A 1C5ZB 2BXUH 1ANBA 1LPZB 1LVMA 5EODA 4GPGA 3SNDA 1GBLA 5FHTA 4ZAEA 2F91A 6CHAB 1K1IA 3LJOA 2Y80A 1W12U 2OBOA 3MNBA 1TABE 3NWUA 1NFXA 4WMDA 2PV9B 2VWMA 4U32A 3D23A 5JBTA 1QBVH 1QCPA 3IWMA 5EQSA 5C3NA 1YWUA 4UFGH 2ANWA 2D1JA 2ZIQH 1EKBB 2ZGCA 2WV4A 2P59A 4XRNA 3CS0A 4ABAA 3NUMA 1W10U 1ELFA 1BBRE 5E0GA 1KXEA 1LPKB 3ATMA 3S9AA 3ZIAD 3MMGA 2D26C 2FLRH 2XBVA 3H5CB 1GJ8B 1WTHD 2R3UA 4CH2B 1SGNE 4O3TA 1NBME 3M7UA 1H8IH 1ARBA 2BVSH 3M61U 2FM2A 1NPMA 3W95A 4IMQA 1C5PA 3U98H 2ZF0H 1G2MA 3RP2A 1MD7A 2HWLB 2QF5A 1F5RA 1F5KU 2PWXA 1O3GA 1YPHE 1A4WH 3GY2A 3TK6A 1DLKB 2BOKA 3OFND 3I77A 1B7XB 1GBBA 3SU3A 2GT7A 4DIHH 5C17A 4I31A 4Y8ZA 2FZZA 3NK8A 1HJAB 1PPCE 1F7ZA 1YCPK 2Y5HA 4ISNA 1ID5H 4AGJA 1O35A 3F2FA 3SUGA 2R9PA 2TIOA 4DW2U 6ESTA 2HLCA 3SNCA 3MQKC 2Z3EA 1FX0B 1Z8JB 3P8FA 1KY9A 3T5FH 1ELTA 2K8IA 4XBBA 5SGAE 4GHTA 2AMPA 1TMBH 3M5NA 4BTIB 3SNAA 1S84A 1Z6JH 2H2ZA 2QE7D 3OTPA 2IPHA 4NIWA 2ZHFH 1O2JA 4X8SH 4NWKA 2BLWA 2P3TB 4AOQA 3A7WA 3MO9A 2F9UA 3TJVA 1A0LA 3LT3A 3VXFH 3W1EA 3T62A 3T28A 4OM9A 2Q6FA 3GY5A 4B76A 3H09A 1OWDA 1SQAA 1HLTH 3UQVA 1FN8A 1Y3YA 3FN8A 5DSFA 2GV7A 4UFFH 1TRMA 1RTKA 1XXFA 4MVNA 1P57B 3PMHB 5AF9H 3RLYH 2BY7X 2XBWA 1C2EA 2B0FA 5JB9S 4K8YA 2BY5X 1SLUB 6GCHG 1O2UA 4Q7XA 4CRGA 2NU2E 5CHAB 1MTNC 1WYKA 1YPLH 5A2MH 1QL7A 1SGPE 3AAUA 1OX1A 2XC5A 2BHGA 3QTVH 4JMYA 5TCAA 1AVXA 1GBIA 1TQ0B 1QZ8A 1H9LB 1MKWK 1BJVA 1H9HE 1PPFE 1SGFA 3FANA 7ESTE 1Y5BT 2F3CE 1HJ8A 2JETB 1K1MA 1QQUA 5CE1A 1MZAA 3AAVA 4X1RU 1EPTB 3A87A 3Q3XA 1FIWA 1JBUH 2OCVB 4WMFA 1CGIE 2ZU4A 1LHFH 1TQ7B 1EAXA 1LHDH 1QB9A 3FVFB 1TMUH 2J9NA 5F8TA 2SFAA 5EPYA 2J98B 3VG8A 3ZYDA 1AI8H 4AYVB 1OP0A 1V2UT 1RIWB 2QYIA 1A5HA 3E3TA 2BB4A 1L2EA 2PKAA 1GI3A 1BTYA 3PLPA 1AE5A 2UWOA 4NSYA 3T25A 2JJ2D 1EATA 1A5GH 1AN1E 3BTKE 1BB0B 9ESTA 2YMSC 3BTQE 8LPRA 3QTOH 1Q3XA 3TK5A 3BSQA 3UOUA 1Y5UT 1ZLRA 2BLVA 3ZZ9A 2GKVE 3A84A 3MHWU 2F43B 3A8DA 5FX6A 1AWHB 1S81A 3PV4A 3VB6A 3R0FA 1NN6A 2VIVA 1BTPA 4ZUHA 1BQYA 1GCDA 3EAJA 1A61H 5T3HA 4WXIA 2ZHWH 2PKSB 5A8YA 3RU4D 3MH7A 2G4TA 3M5OA 2FPZA 2O8UA 1Y8TA 1EZUC 1W7GH 3SV7A 4DGJA 2B5TB 2O8LA 1OPHB 2A0QB 2ZDVH 1AUTC 1OP8A 1P01A 1UO6A 4INKA 2BX3A 2BD8A 3B8JA 1KDQB 5K7RA 3N7EA 4P02A 1FY8E 2RDEA 4DCDA 4CBOA 3F1SB 5AFYH 2PP6A 1UCYH 1AO5A 1IOEA 1UK3A 1TWXB 2HNTC 1O2NA 2CXVA 3RXRA 2F4LA 3F9GA 2CGAA 1FY3A 2AIQA 2VB0A 3DCLA 1Y5AT 1UVPA 4X6NA 4CHAB 1HFDA 5A09A 2W3KA 2ZGXH 1MBMA 1XVOA 3CP7A 1NC6A 4B71A 2XWBI 2QV1A 3GCHB 3SORA 2C8WB 2GCHG 1V2TT 2ZTXA 1GI4A 1PPGE 1AB9B 3E6PH 7GCHF 1QB1A 1ANDA 3D62A 3PLBA 1O3NA 4NZQA 3U1IB 1C2IA 3LC5A 8GCHG 2XXLA 3SV6A 4AB8A 4OS4A 1NZQH 3Q77A 1C5TA 1O2WA 3LDXH 5GIBA 1C1PA 2THFB 3HGPA 3DFLA 1N6XA 2PGBB 3HATH 4AG1A 2HLDD 2OINA 1HAYB 2ASUB 3MYWA 1D3TB 3KYGA 2FOGA 1JRTA 3KEEA 3SZEA 2ODQA 1TNHA 1FAXA 1IAUA 3RXJA 5C67A 3ZVBA 2HPQH 5TCCA 2FYRA 2BDYA 5FXLA 2F83A 4FUGA 4Y0YE 3RU4T 2ZP0H 4QT8C 1VCPA 1C2JA 1O5FH 1L1GA 2ZQ1A 5C5NA 2FXRA 4RSPA 3D49H 1O32A 1V2RT 1QJ1B 4Y7BA 3PLKA 1TX8A 2YNAA 1EB1H 3P8GA 1SGQE 2BM2A 5BPEA 1O0DH 4B75A 2G4UA 1C2MA 3MU1A 1ESBA 1NESE 1QR3E 1PJPA 1XX9A 2FOFA 1GBJA 1GJCB 2IPQX 4YO9A 3UIRA 3OU0A 2FOBA 1GI7B 3MO3A 1ZGVA 2OC1A 1YGCH 3AW0A 1T8LA 2AH4X 1P3CA 1ELBA 1KXCA 2HOBA 3GISB 1HAOH 2DE8A 1O2IA 1TMTH 3ATIA 1K21H 3BTDE 3E16B 2O8WA 2Y5GA 1UTQA 1O3JA 1GVZA 1FY4A 3P92A 1EUFA 3A86A 4AN7A 1P3EA 2Q1JA 2OTVA 3RXKA 2ZHDA 3FAOA 2VWNA 4NIYA 1AUJA 1T32A 1DWDH 5EW2H 1ZJKA 2QCYA 4H6TA 1WOFA 1EPTA 4HG6A 3SV9A 1GHBG 1D4PB 2STBE 4LZ4B 3PO1B 2J95A 3E8LA 1GI0A 2V3HH 1UTNA 4BXSA 4ZXXH 1MD8A 2G81E 3KHVA 1WSSH 3PYHA 1ZR0A 3SGQE 3T27A 2J92A 3OY5U 2W26A 3BTHE 2Z9IA 2A5AA 4AFQA 5E8EH 5FBIA 2VIDA 4CREA 1P12E 1JMOH 2A7CA 2H6MA 5F03A 3DA9B 1QA7A 2ZECA 4YOGA 4B73A 2ILNA 4XFQA 5IYTA 1D6RA 3RXHA 4A5TS 1IHSH 4CR9A 4I8GA 1GJ4H 1YPHC 1P05A 1C1WH 2K0QA 5KECA 4FU9A 2WYJA 1P2NA 2IJOB 4FUBA 1LHGH 2BVXH 1SGEE 1YC0A 4ZKOU 5C94A 3V7TA 1RTLA 2ZHQH 3F2GA 1BMNH 2F9NA 4IN1A 1C2GA 5EJLA 1HAIH 4ZMAH 1VITF 4IMZA 4Q63A 1O3IA 2AGIX 2GVFA 4KTCA 3U8RH 4UONA 5BRRE 2GTBA 4YLUA 2W6JD 3O8RA 1C1SA 1TB6H 4ESTE 1P2OA 4D76A 4IC6A 1BTHH 2H9HA 2HPPH 1NU7B 2J94A 1YKTA 4ABDA 5EIYA 1KDQA 1RJXB 3M3VA 3MU0A 1UCYK 2PSXA 4X6PA 1OWEA 2WSSD 4AB9A 3WWBA 1ETTH 3W94A 4MPXA 2ULLA 2OUAA 3QGJA 2EI8A 3FO8D 3O8CA 1GMCF 3BIVH 1JIMA 1DFPA 3HKIB 4OS7A 2ZFTA 2SGAA 1N8OB 1GBMA 1O34A 4YLQH 5FL7D 1C4V2 2FYQA 3ZZBA 4HI3A 1QQ4A 1O3CA 4A1VA 1QY6A 3RXPA 4CRAA 2A4OA 1C5MD 1GDUA 4JZ1A 2GMTC 3SW2B 4MPUA 2FS9A 1AMHA 5ETXA 2KCOA 4KGAA 5DO4H 1UJ1A 3ZZ8A 3PRBA 3RXBA 3A8BA 1GJ5H 3SHAH 2K1QA 4BTTB 1NRNH 1QJ6B 1N6YA 4K60A 3RXVA 1EZSC 2XBYA 1ZMLA 1LKBA 3LH3A 4OGYA 3N99A 5DP3A 1HCGA 1XM1A 1ELDE 1P8VC 2A31A 3SU4A 1YP9A 3Q3KA 3STIA 3RMLH 1WU1A 1Y59T 2KCPA 4AX9H 1C5SA 4IW4E 5FPSA 1FNIA 1DS2E 1J9CH 4O97A 1FUJA 1GCTB 2RDLA 3LGYA 1GHAG 1HPGA 1QBOA 5C2ZA 4A1XA 5A8ZA 4SGAE 2R2MB 1C1OA 2J4IA 2Y6TA 2RA3A 2B7DH 1ZSKA 4XSKU 1O39A 1TLDA 2VJ1A 4YESB 3SU6A 2QXIA 4JZIA 2ZFFH 1EZXC 1C1UH 4DG4A 4ZHMU 3LGWA 2Y7ZA 1BHXF 2ZU1A 2FOEA 3F9FA 7KMEH 2P16A 1Q31A 1CO7E 1UVOA 3Q00A 5L2YH 2G51A 2NWNA 4YOIA 1ABIH 3BIUH 1VGCC 1ZRKA 1WUNH 3NCLA 1CHOG 3UR6A 1DT2A 1MQ6A 1O3MA 1GBTA 4UFDH 2ZCKP 3M7TA 4ZCNA 4GCHF 4IGDA 1K28D 2A1DB 1WXRA 2Z3CA 5JBBS 5IDKA 1AQ7A 3MI4A 2XNIA 3ATWA 3MNSA 5EXNA 2FESH 1GWAA 2EY4C 3QZQA 1O2LA 2FOCA 2OC7A 1RTFB 1SGRE 1H8DH 3MH6A 5B6LA 3LKWA 1IQFA 4ZROA 1UVSH 1TRNA 3ZVFA 2J5UA 3MU8A 3GCTF 5HGGA 2CMYA 2WPKS 1SSXA 2ANKH 1SB1H 3GDUA 5E0JA 4DT7B 1BTXA 1VZQH 2Y82A 3VPKA 2VVUA 1FLEE 4WVPE 5ESBA 4E7RG 1V2LT 4WH8A 4NG9H 3TVJB 3KQCA 1IQLA 1O3KA 3ELAH 1JOUB 2ZFSA 3H7OA 2BY8X 3FZZA 4IBLH 1ZMJA 2C93B 5EU8A 3DSOA 4VGCC 1KXFA 1F0RA 1SLVB 5C1UA 1J14A 2PHBA 3RDZA 4BAKB 7LPRA 4ZKSU 2VIOA 3JZ1B 2GCTC 1YLDA 2FMJA 1ANCA 5GXPA 4K2YA 4MLFB 4WY3A 2J97A 2XC4A 4BANB 4Y79A 1GL1A 1ZPCA 1MZDA 2M5TA 1IQHA 1G2LA 1G30B 1O3AA 2KZ4A 2HALA 1PQ5A 3U9AH 5EGMA 1KLJH 4X2WA 1E0FD 1CA0C 1QA0A 2ZHEH 1CT0E 1Z8GA 4M9FA 3RXMA 1COWD 3RXGA 4DURA 1NO9H 4ABEA 1GJ9B 1J16A 1SI5H 1UHBA 1KIGH 5CDFE 4GHQA 1CHGA 1GJ6A 1V2VT 1UVUH 1GGDC 1WTGH 2VGCC 4ABHA 4NA7A 2ODYB 5CHBA 3TPIZ 1SLXB 3RC5A 1AFQC 2TRMA 1E1RD 1DSTA 2XOKD 3ZZ3A 3KQ5A 4P00A 3I29A 1TX7A 2SNWA 4O03A 3QZRA 3UAIC 1KLTA 1VJAU 1SR5C 1CQQA 1L1NA 1O2KA 2A7HA 4ZKRU 5K0HA 3ZVGA 2HGTH 1S0QA 1SGDE 1JRSA 1V3XA 2A5KA 2ZGJA 3ZZAA 4KTSA 3AW1A 3PWCA 1FQ3A 1QURH 5B6OA 4WH6A 2ESTE 1K22H 5GWZA 2WUCA 3VGCC 1KXAA 1QRXA 1GJ7B 1RGQA 2KCAA 4CR5A 3Q3YA 2G52A 3EA7A 1BRCE 1VCWA 4Q4LA 4TWYA 4HGCA 4K1TA 3P70B 4ISLA 1TNKA 4X8UH 2CJIA 1FI8A 2ZU5A 1A3BH 2BDBA 4K3JA 5T6FA 2JDID 2LP6A 2AGGX 2GX4A 2GZ7A 2H5DA 3RC6A 2ZFQH 3BEUA 1IQNA 5DP7A 1DWBH 1L4DA 4YZUA 1S83A 2VVCA 2UWLA 4PROA 1C5RA 1A3EH 1YPKH 1UK2A 3RXCA 1TPPA 4GVUA 1V2OT 1LQDB 1BUIA 2L6OA 1ESAA 5T6DA 1HAZB 1W0YH 1P2KA 1E79D 4JYVH 1H8ED 1CU1A 2FWWA 1P9SA 1BTUA 1OWKA 2FX4A 3BTFE 4X1NU 4BNRA 3KQBA 1C2DA 4X1QU 1DWEH 1ELVA 1ZMNA 3BTGE 1UK4A 1EJNA 1P9UA 2LNCA 1TGNA 4HFPB 1XUGA 1GG6C 2KAIA 3F9EA 2RCEA 1W2KH 1GHXH 3QDZB 4KTUA 1EB2A 2BVRH 1BDAA 3TH3H 2O8TA 4YOJA 1Y3WA 1HYLA 2BQWB 1DANH 5LPFA 2ZI2H 4X8VH 1O2TA 3L6PA 4XOJA 1H8HD 4FOUC 3VXEH 1XUHA 1BMMH 1LVOA 1TGBA 2VH6A 3T2NA 1BBRH 1F5LA 4RKOB 1UTPA 5EJZA 5I25A 3OTJE 3LGIA 5LPRA 1GMHG 2M2AA 3PMJA 1MTNB 1V2JT 2C90B 2ZA5A 3ZZDA 2V7QD 1ZTJA 3UWIA 3M3TA 1WDIA 5GNDA 1D3PB 5L2ZH 1NTPA 1PQ8A 3GOVB 3RU4E 5FPYA 1HAHH 1O30A 3BN9A 1C2FA 2B9LA 1FMGA 1YPEH 3PM3A 3M35A 3S7KB 2G8TA 2IJD1 1P11E 3BF6H 3GYLB 3OAAD 2XCFA 3N7OA 1GMDG 1SMFE 4MNYA 1HV7A 3ODFA 2UUFB 2RFKC 2VIWA 1BRUP 1PYTD 6LPRA 1V2PT 4CBNA 1XXDA 2AHME 4FU7A 3RMMH 1KXDA 4NA9H 1K1LA 1SGIB 2FP7B 3RXEA 2H1UA 2YMSB 3QWCH 4BAQB 1QB6A 2WPMS 1TYNA 3DFJA 5DP4A 3RXUA 5FBEA 1AZ8A 2WZQA 4NZLA 1C2LA 4FETA 4ZHLU 5ESTE 4ABGA 2GZ8A 2FIRH 4X2XA 5KGOA 2D2DA 3M5LA 1NFWA 1E38B 1AIXH 2EC9H 1Y3XA 1YPMH 3U1JB 1O31A 3ZV9A 3ODDA 2BDHA 5HIYA 4K1SA 1O5AB 4TWWA 3ATKA 1O33A 3RUOA 1YLCA 6GCHF 4NSVA 3SGBE 3U8OH 3ZVEA 4TYDA 3F0PA 2ZDAH 1LVYA 4UFEH 2QN5T 4MNWA 3QGNB 4Y8YA 3TGIE 2GGVB 4WXVA 2ZGBH 5A0AE 2H5CA 3SI4H 3M7QA 5HMAA 3RMNH 1F0UA 1FZZA 2HNTF 1UTOA 1C5UA 1O2YA 1CBWC 1OYQA 2JH5D 1G32B 1YM0A 5HKKD 3RXIA 1ZRBA 2SGPE 1DXPA 1O5BB 1K1OA 2BY9X 1W0JD 1L0ZA 1BMLA 1T4VH 5JBCS 4ISOA 1GPZA 2ZPRA 1E37B 4A7IB 4I8JA 1TX6A 4CRDA 4ABJA 3F3BA 1UVTH 1FONA 2ZDLA 4ZKNU 1GDQA 4Y8XA 4D9QA 3NZIA 3M3SA 3VB3A 5DKMA 1GBFA 1H4WA 5C20A 1SHYA 5IK2D 2CHAC 3KQEA 1MKXH 4I8KA 1P2QA 1V2KT 3KN2A 1NRRH 3F6UH 3SHCH 1C4U2 5C0TA 3ZVAA 1CGJE 8KME2 3RMOH 1SGCA 1O2XA 1MMJN 2ZFPH 2J38A 3SUEA 3LC3A 3EE7A 4JZFH 2I6QA 3CENA 1PPEE 2FI5E 5F8XA 2BTCE 3TGJE 2OC0A 4ABBA 2LPRA 3ZZ4A 4K69A 1QNJA 1Y3VA 1Z71A 1KXBA 3MU5A 1ABJH 4X1SU 3S69A 2G55A 4D8NA 1B0FA 1C5XB 3A83A 2TBSA 1DDJA 1ELGA 2RA0A 2KCYA 4ZH8A 2PLXA 4CRBA 2BD5A 2IN2A 4YXWD 2P3UB 1HAGE 1GVLA 1UTJA 3FP7E 1GI2A 2Z9KA 1ZYOA 2F9VA 2ZDKA 1INCA 5EXMA 2AYWA 2BQ7B 2EEKA 5DP8A 1RD3B 2ZWLH 2ZQ2A 4BAHB 2EQNA 5AHGH 5GCHF 1H1BA 1TFXA 3IITA 4DIIH 4MG3A 3UB0A 4RT0A 3A7YA 3SJ8A 1BBRK 3LIWA 5JPMH 2YOLA 4WF8A 3UOPA 5GDSH 1J15A 4X2VA 3GY8A 1TBQH 2BX4A 1P2JA 2A4RA 3FKSD 1GBAA 4FUFA 1D9IA 1JWTA 1SGTA 2HVXA 2GCHF 2A7JA 3MTYA 3ZVCA 4RI0A 1PPBH 3H7TA 4K5ZA 1ORFA 2QXJA 1GDNA 1W7XH 1TIOA 3GY3A 3QO6A 2ANMH 1GHZA 2BZAA 8GCHF 3OY6U 1IQGA 1HB0B 1P2MA 3D65E 3SGAE 4XDEA 3SQEE 4AG2A 1XVMA 1O36A 3NKKA 1AGJA 1GL0E 2BQ6B 1E1QD 3KF2A 4LZ1H 2TGTA 1VCQA 2FI3E 1AHTH 2Z3DA 1NRPH 2Q6GA 3FZDA 4OS5A 4JZDH 3RM2H 3SI3H 2GD4B 5LPEA 1TONA 1TNJA 1GJDB 2JKHA 1W0KD 5JBAS 5GJ4B 4FUJA 1IQMA 1TAWA 1ZSJA 3CNRA 1J17T 4Q7YA 4Y6DA 1EXFA 3OX7U 5TJXA 1SBWA 4A6LA 1NROH 3FOAA 2BDAA 1QFKH 2G5NA 1V2ST 2XWAA 3ENSB 3TU7H 1JIRA 3SJOA 2QF3A 3SUFA 5DG6A 2AMDA 3SJ9A 4U01A 1ZHMA 5A8XA 1SFQB 3S0NA 3L33A 3K65B 1DWCH 1UHBB 4FVBA 4A92A 2PUXB 3ATLA 5C1XA 2TGAA 5AVDA 2J34A 4BOHA 2XBXA 3DT0H 3LONA 3EYDA 3TITA 3E0NB 1FAKH 4XBCA 1TNGA 1EP5A 1FIZA 2STAE 3F0OA 3UQOA 1GBDA 2CV3A 1BOQA 1DXWA 2JH0D 1P02A 1T7CA 4X6MA 3E90B 4MNVA 5CMXH 1AY6H 4Y11E 2A4GA 2PFEA 1S6FA 4H42U 1FN6A 4LK4A 1LKAA 3GDSA 3P17H 1Z1JA 1F2SE 5FPTA 1V6DA 3EGKH 2P3FH 1AVWA 4NFEA 3PRDA 5HM2A 4ABFA 1O37A 2TPIZ 1DPOA 1DE7H 1TE0A 4MTBA 3M36A 1GHBF 2Z7FE 4WWYA 1ARCA 5HIZA 3TJUA 4LOYH 3UY9A 5FCKA 4ASHA 4OS1A 3P8OA 2FTLE 1EOLA 5DP6A 1MKXK 2C4FH 2V3MA 2FI4E 2PTNA 3GCNA 4B2CA 1YCPH 1S5SA 1RS0A 3LGTA 1MUEB 2BDIA 2XCNA 2GMTB 4FUDA 3BEFB 1DX5M 2VINA 2ZPQA 1C5OH 1WAYB 4UDWH 1S6LA 2GV6A 1C5NH 1O2SA 1ZTKA 1U6QA 3M5MA 5EPNA 2DUCA 1QIXB 1KLIH 5LH8A 1E34B 2ANYA 2YMSD 1ZGIA 3UUZA 5E2OA 2W7SA 1LCYA 2CK3D 3TK9A 2CF8H 1EJMA 2KAIB 2UWPA 1LO6A 1BTWA 2AERH 3DD2H 1C5WB 3SV8A 3K9XB 2V6NA 1LPGB 1NRSH 2GZ9A 5F8ZA 4IC5A 5F6MA 4XBDA 2NU0E 3HKJB 1O5DH 3K6YA 4DY7B 4R8TB 2W7UA 2QXHA 3KQDA 2DE9A 1C1VH 4RT1A 3NXPA 1G36A 1A2CH 1NU9A 2QXGA 2WPHS 1GJBB 2OQ5A 3FP8E 2WYGA 2OP9A 1GJAB 4FUEA 1AVGH 2GT8A 4AZ2B 5FAHA 5L30H 4Q80A 1ELCA 3A88A 5A0CA 1HAVA 3OYPA 1O38A 3KNXA 1BMFD 4Y76A 5A0BA 1DY9A 2FODA 5FX5A 3GS9A 1YY3A 1TGSZ 4ACBA 1VGCB 1O3BA 1YBWA 3MWIU 1CVWH 4HZHA 2WPIS 4JYTA 1HIAA 4FXGH 4B2AA 3TLOA 5JDUB 4ABIA 1EAUA 3QX5H 1MKWH 4ASUD 1G9IE 1LDTT 4RN6A 3V0XA 4FUHA 2WV5A 3BTWE 5KEDA 1G3EA 3MOCA 1ZHPA 3SV2H 2OLGA 3PROA 1K1JA 4BXWA 1WCZA 3TNSA 1GI1A 5HXFA 1TALA 1L4ZA 3PMBB 1F92A 1QBNA 1TA2A 4ZXYH 4WMEA 4E05H 4BAMB 6CHAC 2HRVA 2ALPA 3A7XA 3A81A 1MABB 4GLYA 1NY22 1P04A 2ZKSA 1PPZA 1O2MA 3UNQA 4MPWA 3MH5A 1TBRH 1HXEH 2A2QH 4VGCB 1GHAF 2VWLA 1O2GH 2OXSA 2XTTB 1L1JA 2J2UA 1QL8A 1K1NA 2GCTB 1MTWA 5DN6D 1DSUA 4DVAU 1W3CA 2SGQE 3QK1A 2ZZUH 1OP2A 1OXGA 2ZCLP 4FU8A 1WV7H 2EI6A 1WQSA 2QF0A 3GY6A 4ISIH 3U8TH 1VR1H 4X8TH 1CA0B 3EQ0H 1QGFA 1O3FA 2BY6X 3TJNA 1SLWB 1W13U 2SNVA 3MNXA 3RXDA 3A80A 1NFUA 3UPEA 3C27B 4TPIZ 4CH8B 1CHOF 3DHKH 3UNSA 5E2PA 1YPJH 1TPOA 4OS6A 1GGDB 2VGCB 2NU3E 3SU5A 3T26A 2GJGA 1CA8B 1BCUH 3K2UA 1AFQB 1HJ9A 1ZPBA 2I6SA 3L3TA 1W14U 2BDCA 2F9PA 1W11U 3PB1E 3SQHE 1FY1A 1OS8A 1P0SH 1FY5A 1HJAC 2AGEX 3KYFA 3BTME 4K8BA 3SO3A 1ZSLA 1C1QA 1RXPA 2A5IA 1NT1A 1LMWB 1BT7A 1THPB 2OD3B 1EX3A 1NM6A 1T8NA 2AS9A 3VGCB 3PTNA 1TPAE 1BJUA 1QTFA 1IQKA 3GYMA 1BA8B 1BZXE 3TJOA 1C9PA 1DUEA
chains in the Genus database with same CATH topology
3A8AA 1SQOA 2OBQA 2WPJS 1MAYA 9LPRA 2FEQH 2VIQA 2BD2A 1EAWA 4J2YB 4ISHH 3UREA 2BXTH 3SNBA 2ZGHA 1MBQA 1G37A 4GSOA 1C1NA 1O2HA 2CF9H 1Z8RA 3E91A 2Z9LA 1YF4A 3SNEA 2FTMA 2ZO3H 1C2HA 3I78A 1FV9A 4THNH 2FO9A 5C5OA 2ZEBA 3A82A 1EOJA 1ETSH 1TOMH 3QLPH 1EP6A 1RFNA 1OOKB 2C8XB 1A46H 2G00A 4NWLA 1MCVA 4ZHAA 4O3UA 1Z8IB 3RLWH 1C5LH 1GG6B 1O3LA 3BTTE 4I7YH 4UE7H 1LHEH 2F9BH 1G3BA 1GBEA 1UCYE 1H9IE 3U69H 1OWJA 1B0EA 4NFFA 5CHAC 1SL3A 5T6GA 1A0JA 1XUJA 1XKBC 4CRFA 2QIQA 3EE0B 2XC0A 3HK6B 3SBKA 1ZZZA 3GCOA 1DUAA 3IG6B 4H6SB 2GP9B 4YT7H 1TNLA 4JZEH 3V12A 2B8OH 3CS7A 1SOZA 2JETC 2WUBA 2R0KA 1PPHE 1DM4B 3LU9B 1EPTC 1TGCA 3UWJH 1BIOA 1FPCH 2PSYA 1AZZA 1MH0A 3SOSA 4D9RA 2P95A 1MTSA 1NFYA 4B74A 3SZNA 2ZTYA 3ITIA 3URDA 1YPGH 1BRAA 1AWFH 2FX6A 3A7ZA 4H4FA 3RXSA 4E06H 1RIWC 3LGVA 2FOHA 4GUXA 5PTPA 3UTUH 1AE8H 1D3QB 1GHWH 5DPAA 3ZZ5A 7GCHG 1MTUA 1MQ5A 2PGQB 1LVBA 1O5CB 5EXLA 3TH2H 5AFZH 5DK1A 3QN7A 1E36B 1HUTH 1SFIA 1XKAC 3QUMP 5J4SA 1DOJA 3TNTA 2AFQB 1P10A 1C1TA 4DJZB 3PTBA 4UEHH 1O3HA 3RXTA 1S85A 2QC2A 2VIPA 3VB5A 1FPHH 4I33A 1V2NT 2BMGB 4Y71A 1ANEA 1S0RA 4MNXA 3AASA 3RC4A 1GBKA 1P2IA 2O8MA 3MH4A 2P93A 1VITH 3S9CA 2PKSC 5LGOA 4MPVA 1RRKA 3P95A 4KKDA 3EA9A 5DJ7A 4IS5A 1C4Y2 1O3EA 3S7HB 2H9TH 2GDDA 1P06A 1G3CA 4U2WA 1MU6B 3KGPA 1DY8A 4TY6A 1EZQA 4KELA 3MFJA 1C5VA 1CT2E 3B23B 3BG4C 4TY7A 1AFEH 1O2ZA 1T8OA 1JXPA 2ODPA 3TH4H 3SU2A 1Z7KA 1FXYA 4K1EA 1EAIA 1DICA 2EI7A 3A7VA 2BOHB 4X2YA 1GMHF 4CRCA 1SOTA 3P8NA 3ZV8A 3LH1A 2V0BA 3BG4B 4JYUH 1HXFH 4CHAC 2Z9GA 5GCHG 3KL6A 1PQ7A 1CBWB 1N1LA 1O2RA 2XYAA 2QY0B 4Z6AH 3GCHC 4JK6A 2F9OA 2QAAA 1O3OA 1UTMA 2V35A 1O2VA 1AB9C 2ZCHP 2ZDNA 2A2XH 1SHHB 2C8ZB 1TPSA 1V2WT 3VB7A 1THRH 4F4OC 1EQ9A 1TBZH 1K1PA 1MAXA 1GMDF 4Q2KA 1BITA 1BMAA 2XRCA 2ZPSA 2P8OC 4X0WU 1SC8U 3SU1A 3FP6E 1BRBE 1C5YB 1SG8B 1GI8B 3RXFA 3WY8A 1CE5A 1QJ7B 2VWOA 5G4BA 2CHAB 4LXBH 3A89A 1WBGB 1HAXB 1F0TA 2P8OB 2QGRA 3KIDU 5GPIB 3MO6A 1KTTB 2VNTA 1DVAH 2R2WU 2TGDA 5J4QA 2FDAA 1FDPA 1C1RA 3PWBA 4UD9H 1HRTH 4SGBE 3GDVA 5FCRA 1GBCA 1G3DA 1OWHA 2ZU2A 3OSYA 1IQEA 1A1RA 2QA9E 3K6ZA 2BD3A 4X1PU 5H4IB 4Q7ZA 3GY4A 3FFGA 4I8LA 1O2OA 3EA8A 5HYOA 1AD8H 3F68H 3G01A 1O5GH 3HPTB 1GHVH 3VEQB 5E0HA 4TPYA 1HAVB 1OKXA 2AEIH 4NCYA 1T31A 1VITG 5EQRA 2YNBA 3UFAA 1SGYE 2ZC9H 4I32A 1O3PB 1TA6A 1W0ZU 4FUIA 2ZTZA 1SQTA 1HNEE 2Y81A 4Y10E 4YTAA 1ESTA 4YT6H 1HIAB 1Z1IA 4FUCA 1ZPZA 2UUYA 2XW9A 1EASA 2BZ6H 1SVPA 1TNIA 1DITH 4FVDA 3SU0A 3ESTA 1BTZA 4Z0KA 2CN0H 3PO1C 1GI6A 3RXOA 1GMCG 2AMQA 3HK3B 4OS2A 1AKSB 2O9QA 3A7TA 5DGJA 1KTSB 1B5GH 1C1MA 2PTCE 1ZTLA 2FS8A 5C1YA 2VH0A 1MU8B 2C8YB 4AGKA 3BEIB 4AYYB 1HDTH 4DOQA 1NS3A 1THSH 1XUFA 3TIUA 2NU4E 4NGAH 1Q2WA 1A7SA 1IQIA 5L6NH 1CGHA 2H9EH 1A5IA 5I46H 3E1XB 3AVZA 2Z6BD 2BD9A 2OC8A 1FJSA 1P09A 4WJG2 3EDXB 1T8MA 1S6HA 5EOKA 3SUDA 2BLOA 1CT4E 5ABWA 2G5VA 4IN2A 1HAPH 1W8BH 2TGPZ 1J8AA 4INHA 3ZYEA 3T29A 2PUQH 1WQVH 1TRYA 4I8HA 2WINI 1ZOMA 4AFZA 4INLA 3ZZ7A 4BAOB 3LOXA 1A0HB 1HBTH 1LTOA 5EQQA 1XUKA 8ESTE 4AFUA 1S82A 2FLBH 4MDSA 1ACBE 1OWIA 2Z94A 4AFSA 2PW8H 3BTEE 3SJKA 5EW1H 2PR3A 3VFEA 1SGFG 3GICB 3MNCA 3STJA 2ZG0H 4Y7AA 3KCGH 3P6ZB 5EG4A 3A8CA 1F0SA 3A85A 3O8DA 2SGEE 4NIVA 4YM9A 1Y3UA 2WPLS 2ZFRH 4KP0A 3RXQA 3NPSA 2EA3A 1N8OC 1T4UH 3V13A 1EJAA 2AIPA 3LGUA 1ELAA 3GY7A 2BYAX 4GCHG 2JH6D 5HM9A 1K2I1 2D8WA 3ZZ6A 1HGTH 1YYY1 2R3YA 3VB4A 4OGXA 1ZJDA 4RKJB 1IQJA 1YCPM 4A1TA 1O3DA 2Y5FA 3ZVDA 5DP9A 3V3MA 1TOCB 3SJIA 1PQAA 1O2PA 3GCTG 1MTVA 1LHCH 2UUJB 1MCTA 4B1TA 1QRWA 3B9FH 3O8BA 4U30A 1PYTC 2UUKB 3E0PB 1KYNA 4R0IA 1QRZA 2BD7A 3BG8A 2SGFE 2BLQA 4GAWA 1IHTH 1OSSA 4XE4A 1P03A 3C1KA 1CSOE 1GVKB 1SPJA 1LQEA 2Z9JA 3UNRA 2A32A 2HNTE 4BTUB 1GHYH 1ZHRA 2FOMB 2VU8E 2ZNKH 1GBHA 2VVVA 4AORA 2ZDMA 1GI5A 1GCTC 3SN8A 2C3SA 2IOTA 3LJJA 1UTLM 2SGDE 5JB8S 1D6WA 2GDEH 1TGTA 1UMAH 4NIXA 3R3GB 2ALVA 3Q76A 3UR9A 4D7GA 1C2KA 4Y0ZE 3RM0H 4E7NA 3M37A 1O2QA 3F9HA 1K9OE 2FOAA 1C5QA 3S9BA 2P94A 1AU8A 1NRQH 3ZZCA 2A45B 1GI9B 1DLEA 1XMNB 2NU1E 1VJ9U 5DP5A 3URCA 4MQAA 3LPRA 3HGNA 2A4QA 5JYIA 3JZ2B 1D3DB 4D7FA 2W3IA 2Q6DA 3MU4A 1M9UA 2W5EA 4HTCH 1X7AC 4X6OA 2R0LA 4J1YA 2BD4A 1BHXB 1V2QT 1Z6EA 1ETRH 1V2MT 1ELEE 1O5EH 4JCNA 4NA8A 3RXLA 2ZU3A 4B2BA 1UTKA 3DUXH 3PMAB 1C9TA 1OYTH 1AKSA 4O9VA 3BV9B 1E35B 2RG3A 1QHRB 4M7GA 1KSNA 3RXAA 2V3OH 2OQUA 1PFXC 2BDGA 1QL9A 2Y7XA 4JK5A 3TGKE 2PKAB 1XUIA 4F49A 1C5ZB 2BXUH 1ANBA 1LPZB 1LVMA 5EODA 4GPGA 3SNDA 1GBLA 5FHTA 4ZAEA 2F91A 6CHAB 1K1IA 3LJOA 2Y80A 1W12U 2OBOA 3MNBA 1TABE 3NWUA 1NFXA 4WMDA 2PV9B 2VWMA 4U32A 3D23A 5JBTA 1QBVH 1QCPA 3IWMA 5EQSA 5C3NA 4UFGH 2ANWA 2D1JA 2ZIQH 1EKBB 2ZGCA 2WV4A 2P59A 4ABAA 3CS0A 3NUMA 1W10U 1ELFA 1BBRE 5E0GA 1KXEA 1LPKB 3ATMA 3S9AA 3MMGA 2D26C 2FLRH 2XBVA 3H5CB 1GJ8B 1WTHD 2R3UA 4CH2B 1SGNE 4O3TA 3M7UA 1H8IH 1ARBA 2BVSH 3M61U 2FM2A 1NPMA 3W95A 4IMQA 1C5PA 3U98H 2ZF0H 1G2MA 3RP2A 1MD7A 2HWLB 1F5RA 1F5KU 2PWXA 1O3GA 1YPHE 1A4WH 3GY2A 3TK6A 1DLKB 2BOKA 3I77A 1B7XB 1GBBA 3SU3A 2GT7A 4DIHH 4I31A 4Y8ZA 2FZZA 3NK8A 1HJAB 1PPCE 1F7ZA 1YCPK 2Y5HA 4ISNA 1ID5H 4AGJA 1O35A 3SUGA 2R9PA 2TIOA 4DW2U 6ESTA 2HLCA 3SNCA 2Z3EA 1Z8JB 3P8FA 1KY9A 3T5FH 1ELTA 4XBBA 5SGAE 4GHTA 2AMPA 1TMBH 3M5NA 4BTIB 3SNAA 1S84A 1Z6JH 2H2ZA 2IPHA 4NIWA 2ZHFH 1O2JA 4X8SH 4NWKA 2BLWA 2P3TB 4AOQA 3A7WA 3MO9A 2F9UA 3TJVA 1A0LA 3LT3A 3VXFH 3T62A 3T28A 2Q6FA 3GY5A 4B76A 1OWDA 1SQAA 1HLTH 3UQVA 1FN8A 1Y3YA 2GV7A 4UFFH 1TRMA 1RTKA 1XXFA 4MVNA 1P57B 3PMHB 5AF9H 3RLYH 2BY7X 2XBWA 1C2EA 2B0FA 5JB9S 4K8YA 2BY5X 1SLUB 6GCHG 1O2UA 4Q7XA 4CRGA 2NU2E 5CHAB 1MTNC 1WYKA 1YPLH 5A2MH 1QL7A 1SGPE 3AAUA 1OX1A 2XC5A 2BHGA 3QTVH 4JMYA 5TCAA 1AVXA 1GBIA 1TQ0B 1H9LB 1MKWK 1BJVA 1H9HE 1PPFE 1SGFA 3FANA 7ESTE 1Y5BT 2F3CE 1HJ8A 2JETB 1K1MA 1QQUA 5CE1A 1MZAA 3AAVA 4X1RU 1EPTB 3A87A 3Q3XA 1FIWA 1JBUH 2OCVB 4WMFA 1CGIE 2ZU4A 1LHFH 1TQ7B 1EAXA 1LHDH 1QB9A 3FVFB 1TMUH 2J9NA 5F8TA 2SFAA 5EPYA 3ZYDA 1AI8H 4AYVB 1OP0A 1V2UT 1RIWB 2QYIA 1A5HA 3E3TA 2BB4A 1L2EA 2PKAA 1GI3A 1BTYA 3PLPA 1AE5A 2UWOA 4NSYA 3T25A 1EATA 1A5GH 1AN1E 3BTKE 1BB0B 9ESTA 3BTQE 8LPRA 3QTOH 1Q3XA 3TK5A 3BSQA 3UOUA 1Y5UT 1ZLRA 2BLVA 3ZZ9A 2GKVE 3A84A 3MHWU 5FX6A 3A8DA 3VB6A 1AWHB 1S81A 3PV4A 3R0FA 1NN6A 2VIVA 1BTPA 4ZUHA 1BQYA 1GCDA 3EAJA 1A61H 5T3HA 4WXIA 2ZHWH 2PKSB 5A8YA 3RU4D 3MH7A 2G4TA 3M5OA 2FPZA 2O8UA 1Y8TA 1EZUC 1W7GH 3SV7A 4DGJA 2B5TB 2O8LA 1OPHB 2A0QB 2ZDVH 1AUTC 1OP8A 1P01A 1UO6A 4INKA 2BX3A 2BD8A 3B8JA 1KDQB 5K7RA 1FY8E 4DCDA 4CBOA 3F1SB 5AFYH 1UCYH 1AO5A 1IOEA 1UK3A 1TWXB 2HNTC 1O2NA 2CXVA 3RXRA 3F9GA 2CGAA 1FY3A 2AIQA 2VB0A 1Y5AT 1UVPA 4X6NA 4CHAB 1HFDA 5A09A 2W3KA 2ZGXH 1MBMA 1XVOA 3CP7A 1NC6A 4B71A 2XWBI 2QV1A 3GCHB 3SORA 2C8WB 2GCHG 1V2TT 2ZTXA 1GI4A 1PPGE 1AB9B 3E6PH 7GCHF 1QB1A 1ANDA 3D62A 3PLBA 1O3NA 4NZQA 3U1IB 1C2IA 3LC5A 8GCHG 2XXLA 3SV6A 4AB8A 4OS4A 1NZQH 3Q77A 1C5TA 1O2WA 3LDXH 5GIBA 1C1PA 2THFB 3HGPA 3DFLA 1N6XA 2PGBB 3HATH 4AG1A 2OINA 1HAYB 2ASUB 3MYWA 1D3TB 2FOGA 1JRTA 3KEEA 2ODQA 1TNHA 1FAXA 1IAUA 3RXJA 5C67A 3ZVBA 2HPQH 5TCCA 2FYRA 2BDYA 5FXLA 2F83A 4FUGA 4Y0YE 3RU4T 2ZP0H 4QT8C 1VCPA 1C2JA 1O5FH 1L1GA 2ZQ1A 5C5NA 2FXRA 4RSPA 3D49H 1O32A 1V2RT 1QJ1B 4Y7BA 3PLKA 1TX8A 2YNAA 1EB1H 3P8GA 1SGQE 2BM2A 5BPEA 1O0DH 4B75A 2G4UA 1C2MA 3MU1A 1ESBA 1NESE 1QR3E 1PJPA 1XX9A 2FOFA 1GBJA 1GJCB 4YO9A 3UIRA 3OU0A 2FOBA 1GI7B 3MO3A 1ZGVA 2OC1A 1YGCH 3AW0A 1T8LA 2AH4X 1P3CA 1ELBA 1KXCA 2HOBA 3GISB 1HAOH 2DE8A 1O2IA 1TMTH 3ATIA 1K21H 3BTDE 3E16B 2O8WA 2Y5GA 1UTQA 1O3JA 1GVZA 1FY4A 3P92A 1EUFA 3A86A 4AN7A 1P3EA 2Q1JA 2OTVA 3RXKA 2ZHDA 3FAOA 2VWNA 4NIYA 1AUJA 1T32A 1DWDH 5EW2H 1ZJKA 2QCYA 4H6TA 1WOFA 1EPTA 3SV9A 1GHBG 1D4PB 2STBE 4LZ4B 3PO1B 2J95A 3E8LA 1GI0A 2V3HH 1UTNA 4BXSA 4ZXXH 1MD8A 2G81E 3KHVA 1WSSH 3PYHA 1ZR0A 3SGQE 3T27A 2J92A 3OY5U 2W26A 3BTHE 2Z9IA 2A5AA 4AFQA 5E8EH 5FBIA 2VIDA 4CREA 1P12E 1JMOH 2A7CA 2H6MA 5F03A 3DA9B 1QA7A 2ZECA 4YOGA 4B73A 2ILNA 4XFQA 5IYTA 1D6RA 3RXHA 4A5TS 1IHSH 4CR9A 4I8GA 1GJ4H 1YPHC 1P05A 1C1WH 4FU9A 2WYJA 1P2NA 2IJOB 4FUBA<