2CGRH

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
214
structure length
214
Chain Sequence
RVQLLESGAELMKPGASVQISCKATGYTFSEYWIEWVKERPGHGLEWIGEILPGSGRTNYREKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRGYSSMDYWGQGTSVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
total genus 34
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cgrH02
4O02L 3IAQA 5C0AE 3FQXB 4NKIH 4N0YL 5F3HA 4RGMC 4JO1L 4HLJA 1YY8A 2A6DA 3X11A 2E7LA 4MZ2A 4Z76A 2YR3A 3H42H 4PGBA 2DL9A 1A6ZA 5FV1L 5JZ7D 3IFLL 3NACL 2IPKA 4V2CB 4OFYD 1CL7I 5FUOH 5B21A 2R0KH 2BVTA 3LN5A 3WIHH 1CD9B 2BNUA 2MPAL 2Z92B 4FHBD 4NBZB 3JVGC 4WCYH 2MQ0A 5T3ZD 2GTZB 2EECA 1V8HA 3MV9D 7CGTA 2BVEA 4FABL 1PBYA 2IMNA 1A9EA 2M1KA 3FO2A 3MREB 3IVKA 3Q48A 3QUKA 2E27H 2XZQL 4MA7L 4MJ5A 2FGZA 3LQAC 3CPLA 4HUVA 3KGRA 4M6MH 1WJ3A 4OZFG 3QA3A 1T6WA 2X9YA 3ZO0A 3ARDB 4NNYA 3P30H 1MCCA 2AK4B 1TNNA 2VDRL 2XXCB 4GRLA 4IRSB 2ZCKH 4JPKL 1BQLL 1J88A 4MD5A 5K9OB 4HEPG 3K8LA 4OGXL 2JIXD 4M93C 3L7FB 4KTDH 1JPTH 4TN9A 3LKOB 1JHLL 1MCJA 5JO5A 3FB6A 1QKZL 3V4UL 4P23C 1R0AL 5AEAA 4PRBB 3UJIH 5ALBH 1QEWB 3TZVC 4YE4H 4R4FL 4BK5A 4R4FH 3PUCA 3W0WD 1HXYB 4UU9B 3KYKL 4Y5YA 3IJYA 1DSFL 5GGSA 4TVPH 1Q9WA 1IARB 4X7CC 1N5YH 3GSNB 4JRXB 3EYUL 3T4YA 4J7RA 1BMGA 1XCTB 2A6JB 2F19L 1G9ML 5EO1A 3BP6B 3QG6B 4NDMA 3VDCA 4LGSB 4ZFGL 3OX8B 4Z7NE 2V5TA 4GMSL 1KENH 1RJZA 5GGUB 3U7WL 5IM7A 1CDBA 3T4AB 1W8NA 3W11D 3WSQL 2CXKA 5MEQB 3GJFK 1ZLWH 1MIMH 1HSBB 4GRMA 1TPXC 1J87A 4L8SA 2JJUA 2VLME 4ZOCA 5JHDE 4AIXA 4D8PB 3AM8C 3ARGC 1BIIB 1QFUL 4KPHH 4PJAB 5DFVD 4Y19B 1G7JB 3HR5A 2EDEA 4J1UA 2XN9A 1PY4A 4PRHB 4ODXA 1JCKA 5A16A 1LD9B 5B4MC 3OKOA 3VI3F 3GJFA 1IC4H 4G6JH 2Z4QB 5J13C 5DD6A 4H25B 1FVDB 3O3DB 1KCSH 1KEGL 1NDMA 3VXMA 1MY7A 4LNRB 3B2UD 2DQHL 3O2WH 1RZKH 4MCYA 4WEUD 5F9OL 1CE6B 3TVMD 3D39B 3MACL 1KT2B 2AJYL 4Z78B 5EZJA 4Z95H 1UZ8A 3VI4F 4U1IA 3QAZC 3FQTB 4XTRD 1OGTA 4UTBL 1XEDA 4U7KA 1AE6H 2D7TL 1QR1A 2HJFA 3GUTA 3TEUA 4FQJL 4HJJL 3U0WL 1EHLH 3U9UB 4QNPF 1MUJB 1EAPB 2A38A 2H41A 2IJ0C 5F7EH 3AM8A 3S88L 4J6RH 1CFNB 4P9ML 5GHWH 1A6ZB 4L4TE 2G9HA 2P46B 5DJYB 5CILL 2IH3A 1MI5D 1FL6A 4EXPX 3WKMH 4NNPH 2OI9C 4UV7L 5JIHA 1WISA 4OKVB 4Q9QH 3HE7D 4DW2H 3U36B 2P8MA 3TO2B 1P2CA 2YD5A 4HPYH 2PXYC 1JGVL 1OAXL 3SJVD 3GSWB 4MWFB 3CFDA 4EIZC 2HVKB 2V7NA 3HAEG 1YMME 4BELD 3QIBB 1KB9J 4Q9BA 2YHGA 1Z3GL 3WLBA 2CK2A 3F5WA 4PG9B 2ZCLH 4IEFB 1KN2H 3RWIB 1EFQA 1GHFH 1HHIB 2FD6L 4YDLB 2COQA 3ZSSA 4J4PA 4P0DA 4LSPH 4RA0C 4G3YL 2BSSB 4I3SL 4U1KB 2YA0A 1AGFB 5FK9A 4U6XB 4XNQA 3BXNA 5DJAA 1HINL 1I7UA 1CLZL 4HIIB 5I75C 3WJJA 3SGJC 3D5OF 1HWHB 3FOLA 4LVOB 4HLZG 4Z7UE 2CLVA 4U05A 4XCNA 1G7LA 4MXQC 3DETC 4ELKB 5D7IB 4L4VB 1EUUA 4FZ8H 1R5IA 5EU4A 5C0CE 5HGHB 2H9GA 1IM3B 4ZAKD 4A2MA 1EDQA 1H3TA 3NPSC 4JZJB 5CLTA 2ZSWA 3KPRE 3CX5K 3WFBL 4QTIH 1AO7D 1DBJH 5CZXD 2HRLA 1MNUH 1U2HA 4N68A 4PGDB 4MAYD 1YEIL 5IBLD 2EDLA 1BIHA 2JCCB 4HAFA 1PSKH 3G5XA 3C9NA 4ZO7A 4KXZI 3MLRH 4JANA 5IEHA 3OX8A 4PGEA 3RP1A 1HILB 4AEFA 1A4JA 2BSTB 1RZKC 3CVHB 4NO0B 1PW3A 2HFGL 4FTVD 1N0XL 4NQXA 4LEXH 3UYPA 5DQJA 1DUZA 3BH8B 1CDJA 1BD2E 4R0LB 2QQKL 3S36H 3OJDA 1ES0A 3RWJA 1A6VH 3JWOL 1M1SA 2PYED 3PWUA 1ACYH 4HH8A 4I8DA 4HHAB 3WMSA 3D2UD 1MVUB 5HVWA 3GSOA 2X4SA 5GRVK 1LEKB 5KSVB 5HHVH 5FOBB 3U4BL 4HIXH 4GAYA 3K0WA 4EI5D 2DKSA 5FGSA 4JY5H 1TETL 1IT9L 3QDJD 1JP5A 1VGKB 1UA6H 3VD3A 1A47A 3MJ9A 1N0LA 4TSAH 2R39A 3ZDZF 5JMOC 1S3KL 1UGNA 4M1GL 3HZMB 5GRWA 3SDCC 4X4YA 1XR8B 2VKWA 4HH9A 1EEYA 1MIEH 5KANI 3Q6FB 2EDBA 4JDZB 4KI5C 1OGAA 2GTWB 2C5DC 3CK0H 4FG6C 3GZKA 5L7XL 4U6HA 3AS2A 1RSFA 4Z7NF 5DVLA 5DZOA 4OZIA 5K9KA 3DXAD 1BJMA 2V7HB 3DVIA 5FO8B 1RK1B 1HKLH 5AZEL 1HKLL 1NC4D 3HI6H 5E70A 1ROWA 4R2GB 3O9WA 1Q72L 4FFVD 2X4OB 2R2BB 3MOAH 3TGXA 1T03H 4TQEL 5MP6H 1CTOA 2YKLL 3R4DA 3ARWA 3GSWA 1UC6A 5GRYA 4U33A 1V3MA 4CU6A 2A6IB 1HXMA 2JB5L 3CUPB 12E8H 4P46A 1LDPH 1FNLA 2PYEA 1UQSA 5T3XD 2DQUH 1NKOA 2YD3A 2HT2C 2AERT 4L1DA 5F70A 3B8SA 4E0RA 2XTJE 3FKUS 1H3WM 2EH8L 3OKOB 2LTQB 3AS3A 2YZ1A 3V52H 3FOLB 3SO5A 1BZ7A 3S34L 1IC7L 3HC4L 2JIXB 4PTUB 4XNQB 1T04B 3MXWH 3MYJB 5F7WC 1A7QL 5HGAA 4CNIA 5HHPA 4TVPE 2PR4L 3VD9A 1Y18A 4NRZB 2NX5E 4UDTB 2Q86A 5SWSB 4L3ED 4WU7B 3PL6B 4P2QD 2VJXA 2DQEH 4JHAL 4N8VG 4MS8C 2DJSA 4ZFFB 2R4SL 1NJ9B 5MENB 4KHXL 4XVTL 3LEXB 4GG8B 1K6QH 1VEMA 2AEIT 5GGSY 5CEZE 1LE5A 1MRCH 2G60H 3FO9B 1OAYL 3G6DH 4YHIA 3MROB 1H8SA 5KVMC 2FJFB 2YD4A 4LCCB 3DXAA 5DVMA 3ZLQC 2CPCA 4KZEH 3LS4L 5J1AA 2EH7H 5GRJH 1QSEA 3B4NA 3WKNA 3LAFA 4DK6A 4FTVB 4MQ7B 5IBTH 4X6DB 3QCVH 4HZAA 4Y16D 3DO3A 5C08E 5JTWA 2MCG1 4P2RA 1KTLA 5I19L 5CS7A 5KS9E 4R9HA 5CJXC 3J7HA 2PXYD 2ADGB 3ARYA 1TCRB 1KN4L 3WJLC 4F3FA 2JELH 4ORGA 1HH6A 3UP1A 2DDQL 4YFEA 3AB0B 4MJIE 2XZAH 4J3OC 3RVWC 3WNKA 3BEWB 3VWJD 1S9WA 2DWDA 2D9CA 2XA8L 5A2JH 3L3OA 3D39D 3VH8B 2H3NA 3LPGA 3QI9C 2VN7A 1BREA 3HUJA 2RJMA 4XP1H 1ZT4B 2EXYD 1FDLL 2C9AA 2GSGB 2HLAB 5IHUL 4XP6H 2ZSVA 3O4OC 2DLGA 4N0UA 1GOFA 2XNAA 1FZOB 3S96A 3T3ME 5FYLD 4M7JL 1URLA 2YPVL 5CGMA 5B4MD 1C12A 4C59B 2I60H 2IPUG 3BMWA 2D31B 5HYSA 2WZPD 5DK2A 2DQJL 4P57A 5DJDA 3UC0L 3P0GB 1ZA3B 3C9NB 2VL5B 2WUBL 4FFWD 1K4CB 3CFKA 4M1CC 3D0VB 5IFJA 4NSKA 3FRUB 4R7NB 3R0MA 5FIEA 2Q1EA 5CWSA 3F7RA 1CFVL 4LIQE 4GAFB 4OIIL 2OM5A 2DQUL 4Q7DA 4UINH 4JFDA 5F9JB 4LL9A 1I1AB 1KBGH 2A73A 3X14A 3TCLB 3O81A 1D6VH 1BBJB 3OHXA 3JWDC 3TJHD 5EORL 4X5LA 1X4XA 4ODVL 2VLRE 3RNQA 4JY4B 4H25A 2VAAA 1NAMB 5SV4A 5DZNA 1X7QA 1IRAY 2MSPA 2QSCL 5JNYB 4LSVL 3P73B 5GS1C 3RBSA 2P5EA 2NX5B 4HK0B 5E5UB 3VXSD 5CSZB 4OD1L 4I2XA 2NY7H 4LBEA 1H3PH 3FN0H 3O3BB 3CLFL 5EUOA 5FM4A 2VXTH 3FB8B 4WW1A 5C1MB 1BIIA 2HJLA 3B6SA 5KSBF 1A7QH 3CSYB 5IB4A 3DMMB 3GI9L 3UO1L 3DGGB 4OLZL 2W9EL 4PLKC 1ND0B 1JPFA 1I3VA 4XBEH 4RX4A 3ILPB 3D1MC 1H5BB 2DWEB 4XPHL 4MWFA 5EO0B 1N3NA 5EFIB 4ZG1A 1NC2B 2E7BA 2E9WA 2BVOB 3QPQC 1CLZH 4OM0L 4P46D 5IB5B 5JW4Q 5BJTA 4OKDA 3CXHK 5E1AA 1B9ZA 1EA9C 3Q1SH 3O2DA 4LHUB 1SJHB 4PUBL 4HD9A 4TYUA 3P4NB 5IGXL 2CUIA 3GI8L 5I19H 1U36A 4JLRB 4NO0D 1A0QH 2HWZL 4CMMB 5I6XB 1TVHB 3D3VB 4IIQA 1WZKA 4JO3L 2AV1B 4ZUSA 4TSBL 4KRPB 3I50L 5DEFA 5H2BA 2PTUA 4QXUL 1RZGB 5E03A 3U4EA 1GC1C 2DD8H 4NM8H 1LILA 4FOMA 4JFYA 3F7PC 3QP3A 1NGXB 3QPXL 3NH7H 5BCAA 1B0RB 3WHE0 1AD0B 1FDLH 1YEJH 5DC9B 2AXHA 3DECA 3NFSH 2F8XC 1A7RL 2FIKB 4JRYB 1LVEA 3DTXA 3T0EB 1KULA 5T3XH 2WM0A 3LCYA 4O02H 4FG6D 4YHML 1K3ZA 3ZKQD 4HUWA 2R0LH 3D9AH 1E4KC 4P2QA 1NEZB 3EYOA 5JQ6L 4NN7B 1JGEA 4Z7UA 5HJ3B 4UQ3B 4EDWL 4G8GE 4KTYA 1QHPA 1DQMH 3MRGB 4AM0B 3H7BB 3MX0A 1UJ3C 3I75A 2XY1A 3WEXA 1FFOB 4YLQT 3SN6N 5F88A 3H9SD 3NZ8B 2ED7A 4HWNA 4ETQB 3FFCA 1BWMA 4NSKB 2J6EH 5DD3L 3MV9E 3X3FH 2DL2A 1UYWL 3BKMH 4I5BB 4LIQH 4YQXH 3WIFB 3DXAB 3CMOL 2PW2A 4HWBA 5T1DH 4WTZG 1WLHA 4LSPL 4U1LA 3L3JA 4PJXF 5LG1A 5TH2A 1X5GA 4FQQA 4BZ1H 1U3HB 4RGNE 2QEJA 3WFDL 3C60B 3QXAA 4XAKD 1RIVH 3EHBD 3MLWH 2UZIH 3H8NA 3BN9C 4XP1L 1CICC 3HUJE 3TA3B 1JK8B 3R06A 5IB1A 5KSVA 5I1AA 3SPVA 5C0AB 3HFMH 1AGDA 3PQYA 5FHBH 4KY1H 4PJIA 3CJJA 4YX2L 1IAOA 2QKIB 3W11C 3E2HC 4OCMC 1FNSL 1OLLA 1QO3A 3N1PC 3L5WA 4LLAA 4JQXA 4F9LC 4AG4H 2EIBA 1C7SA 1Q72H 4XBGA 4JFQA 4K94H 2R9HC 3T2QA 4DN3H 4TNVF 3K7UA 3CSYA 5IB4B 3BZFA 4EZMA 1UACH 5DQJB 4XI5C 3K2UH 3KWWB 3HMXH 3D39A 5EOCL 1NCWH 3NFPB 5I1GH 3QIUD 5D9SA 1HILA 1JI2A 4GXVL 3D69A 3R8QA 3CC5B 4HWBL 1LK3H 5IFHL 3OJVC 3QA3B 2JCCA 5IHZA 1W72B 5T1MB 2XOTA 5IROC 3SE8L 5CEZD 5IMMA 3TVMB 4Y2OA 4MYWB 2ICWI 3TZVB 3SDDD 5J7CC 3PWNB 5D1XD 4LHQB 1G1CA 1CXLA 4PS4L 2MFNA 1C5CH 1KEML 3VFRB 3R8BB 4QXGL 4FFZL 4JREB 1S9KC 3ARDC 3QEQA 2DQTL 4GBXB 3KDMB 3WXWH 1MI5B 1QVOB 4Y0GA 5B8CC 5FKPB 2ESVE 4EVNA 3R0NA 1RUMH 2VDMH 1HOCB 3P3YA 1B0RA 4QYOA 4MNQA 4JR9L 1CDIA 4KKAD 1RULL 4KMLB 4XCEB 2HVJA 1QRNE 4G80A 1MWAB 4PYGA 1WFTA 3ZKXB 5C70A 3NAAH 1RD6A 4KI5E 2PW1B 4MVBD 4JPVL 4HJJH 5IROA 5BRZA 4XB7A 4F58H 3NH7L 2VITB 5ESVA 1SBBA 4XT1C 3U30B 1HE7A 5CBEA 4QKXB 1D9KC 3RL1B 3SE3C 5F1OB 4U1NB 3U7YL 4D3CH 1QBML 4OSUH 1LK2A 1J1XH 1LNUB 3HI1A 1VERA 3KYAA 3MLYL 1YDPA 3MLYH 4UT7L 4Y4KA 1KPVA 3GRWH 3F7YB 2XTJC 1KCSL 4OFYA 3NPZB 4YPGB 3O2VL 7FABL 1KPUA 2Z9TA 3CFJA 3S4SB 3ZKNC 3BQUA 5DTFB 1QSFE 2VDLL 3QAZB 1M6OA 1L7TH 5DFVC 3TLRA 4QRTB 4GXUM 3MNVA 1DEEA 1VA9A 3CPLB 3QRGH 1RIHL 5DMIL 1GC1L 2DOCA 4O2CA 1RUQL 4KU1A 3BDBA 1PLGH 1KELH 2I5YH 4EN3D 2D9QB 4RFOH 4XNXH 2FD6H 4DWHA 3RWEA 1UZ8B 5GHWL 5J1TC 1FBIH 3ARFC 5JW5A 3RWDB 1P4BL 4NO5B 4UU9A 1X9QA 4ODHH 3CDCA 5E7BA 2IMMA 5T3ZL 2JE8A 4KK6D 2Y23A 2BERA 2VLKD 3B9DA 4G9FE 4D9LH 4OJFL 1HH9B 2IAMB 3VFGH 4HUXB 1J9CT 1NGPH 1BOGA 4HKZB 4F7PB 3JXAA 3ARGB 5JHLL 2WW8A 2DQJH 2VDQH 2J5LC 5F8QC 1U92A 2BOCB 3MUHL 3W0WA 3OKKA 5AUMB 3NCEB 3GIZL 3MV01 4OI7A 2FEEL 4NN5B 1BBDL 3HNVL 2VO5A 4K7PL 1OLZA 3NIGE 3BKCL 5C0DA 1FZMB 3TN0A 1U8IB 4MGXA 5CBAB 1ZLVK 5TQ2L 3NN8A 1AP2A 3VXSB 5J8OA 1X5ZA 1CIDA 1T5WA 3KPMB 1F13A 1WIOA 4YIQA 3QCTL 4V1DE 2FIRT 2DRUA 1F45A 1G0YR 1O7SA 4N0CD 4XVTH 1ZHKB 1MCFA 1EO7A 2LFGA 4OZFH 1WBYB 2F74B 4XP9L 1J5OH 3P4LA 4QHMB 4LLMB 5HGDA 5E08L 2Q3ZA 3IRZA 5FUCE 3WNPA 2GK0B 3BPOC 3GMQA 4QRRA 3O4OB 4H1LA 1S7RB 4NHCL 1N2RA 1X5YA 2H1PH 4GJTB 1MNUL 3OF6A 3O6FD 3LKPA 1HIML 3ARRA 1EGJA 4TTDC 2H32H 2OXHA 4XNUH 3VDAA 5E6ZA 3TPUB 3LKOA 1E4XI 4UT9L 3SDXA 2EE3A 4G9FA 2HMIC 4ZUVA 2HVJB 4JPVH 2PETA 3BQUC 3T65A 1WSST 4JFDE 4Z77B 1A6TA 4Y4HB 3PQYD 4Z18A 5HY9A 2HTLD 1UENA 4CRPA 4P46C 2NX5A 5C0CD 4RRPA 1JWSA 2Y5TB 1CK0L 4XXDA 5D5MB 4DFIA 5CSZA 3ULVL 3C5ZA 1OARL 4MMZC 3BYYA 2EYTB 1XGTA 2Q6WA 2XRAH 4FQJH 3BUYA 5EBMB 1FZJA 2P1YA 5ICZB 5L0QC 4NQVB 3QDGD 3T3PF 4HWEH 3X14B 4OI9A 4IOIA 4L3CB 4H0GA 3IT8D 5EBGA 5I1EH 4J3TA 1YPZA 4GLRH 1LO5B 2X70A 1QLFA 1R24B 4NGHH 1A1MA 1DVFD 2A9NH 4DCQB 1KB9K 3OKMA 4CN4A 4YHPB 3FCTB 3P11L 1MCWW 1RJLA 3P11H 2EDJA 2F5BH 4AIZB 1KJ2B 1S9XB 4ZAKB 3ZKMC 2VOTA 3TO2A 2VZSA 3MRFB 3WDIA 4ZFFA 5M94B 4JLRA 3VRLE 2Q8AL 5FA4B 3N9GL 3DBXB 3FO0H 4R0LA 5DS8A 4P2RE 2XV6B 4KRNA 2H2SD 4ZQKA 3OF6D 1QFWL 3QEQD 3BW9A 4QXTB 2OCFD 5C09B 4RDQG 3SDCA 4XCFH 5EO9B 1A7BA 2NZIA 3WNLA 2EIZA 3E3QE 4JKPL 4JKPH 5C0IB 2HKHH 3O2DH 4OD2B 5KG9A 5C08D 2FJHA 1NH6A 3AROA 2CLZB 4F8TA 1IKFL 3WUWA 4B7LA 4GW4B 1A3RL 1E27A 4YUEH 1HK6A 1DFBL 3OXSB 1A1NA 4QOKA 1AP2B 4JRYA 2F53A 3EJYD 4IJ3C 43CAA 1CFSA 1BLNA 2EDHA 2F19H 1FN4A 4RFEA 3CH8A 1TZHA 2LAGB 4XRCB 2R15A 5DD1H 5DD1L 5D1QC 3LB6C 2ADGA 5JR1H 3RVXD 5D1XC 2F9BT 2GJZB 4I5BA 2XFXB 3GI9H 2GITB 1MCRA 4HIJA 4KVCL 4MB4A 2R1WA 3EO9L 1QBAA 3WL9B 3MLUH 4FQLH 4G6MH 3L95B 1S7RA 1Z9OA 1ES0B 1E4KA 3DYOA 1TTUA 1N2RB 4UBDD 1BHGA 1IILE 1UKSA 3LKSB 3BDYL 2W60B 4ALAH 2DB8A 2WIIB 3KJ6H 1I4FB 1CLOL 2IQ9L 2FDBP 4JDTL 1BD2B 2AAVA 3CFKB 5FGCE 1LWRA 2CKBA 3UEZA 3RGHA 5JW3L 4BSJA 4YFLI 2XKUA 3OGCA 5IB2B 3MOBH 5A1AA 4XPBL 1B0WA 1BVKB 1ZHNB 3I2CH 2X44D 1FPTH 5DRWB 1I85A 5HYJB 4Z8FH 1EZVY 1IC5H 1R5VA 5DVNA 5FYJE 1QQDA 1RQ5A 2FB4L 5I8EB 2FX7L 3Q5OA 5E6IA 1ZT7B 3MSPA 3AVEA 3LN9A 4R2GC 1JTTA 2OTUB 4Y8AA 1DTUA 1R5WB 3RNKB 2QBWA 6FABL 5DQDH 3H2WA 5D71L 4BA8A 4JY4A 4E42A 4KZDH 4WHTA 2AW2A 3MCLH 5JHDD 1DUYA 3QFJE 1W0VA 3BP7A 3HPLB 3SGKC 5HYJE 4HUVB 4ODSL 5D7LB 4CVXB 4M43L 1SYVB 3MLVL 4M43H 3BN3B 3K81A 1AXIB 1DQTA 2VLMD 4OIIH 3DX6A 1XIWC 2EYRB 3RPIB 5K59E 1PLGL 2HFTA 2RGSA 3DMMA 4OV5B 3IKCB 3NZ8A 3W9EA 3MA7B 5ESQA 2XWTA 4Z5RA 2H26B 4LRNH 4UT7H 3PDGA 4JM2C 3VWKA 4L8BB 4B7IA 4OLEA 3RVUD 2J8UB 4P4KB 2NYYD 4APQD 1HCFX 4F2MA 3RVWD 4FQXB 5CP3A 1EX0A 1A9BA 4TVPD 4DTGH 1U8OB 1QRKA 1AI1L 4GRWB 3BRGC 1XH3B 4WGVB 1CCZA 2BJMH 3MRLA 3IAPA 5C0RH 2PW1A 5C0AA 4OV6F 4D0BA 4QHUB 3VFSA 1Q9WB 4K7PY 4MSWA 1OF2A 1TJHH 3UXFA 1X5HA 2DLIA 2DQIL 4HPOL 5GJTL 5B3JF 2HMID 5CMAB 5GGTH 4ZNEA 5D1ZB 3O3AA 1S7WB 4JHZA 4XCYA 3FRUA 3QCTH 1XF2A 3K2UL 2Q8BH 4LP5A 3HZKA 2R4SH 5HI4C 4K3EH 5F3BA 3PV6B 3IFOA 3CSBA 4UB0H 1XF4B 4EVNB 3CFJB 3S4SA 1CLYL 1NGQH 1WUNT 3IS0X 4QRPD 4YNYB 1AO7E 1XT5A 2A1WH 5J6HB 3GIZH 5C6WH 2WIIA 3ESUF 4R3SB 1RUPH 3I6KA 2NXZB 2XWJA 5LCVH 15C8L 1IFHH 3BPLC 4Y1AB 4K2UL 3O11A 1KEMH 5DD0H 3JWNC 4DQOH 4X8JA 1JZ4A 3RWEB 1VSCA 4Q9CA 2FJFA 4LCCA 4WI4A 3D18A 2P8LB 2LU4A 2VTFA 1NCWL 1F4AA 4UIKH 3N1FC 1XGYH 1ZGLP 5D2NC 3BEVA 2H32B 1K6QL 4PV9B 4FN0A 1A7NL 3IDXL 4QHLA 4HGWA 3U7WH 2ZUXA 4M61A 3DV6A 3UPRB 3UTPD 3FTGB 1H9VA 1WZ1H 3JTSB 3T0AA 2IBZX 4JN2B 4LP4A 4NQDB 1CDGA 3KPNA 4JFZH 1RHFA 3UJJL 1NBVL 5BVJB 4Q74A 3OXSA 1Q0YL 3FO0L 3O2VH 5EH1A 1UWEH 3O41B 1EJOH 3CK0L 3OAYK 1T21A 3R06B 3T3MF 2NW2B 1Y0LB 1J0KA 2ICCA 3MODH 2HYMA 1CZ8L 2ENSA 1S9WB 3GMQB 4L5FL 4LVNB 4QHNA 3ARBC 4IDJL 3O8XD 3MRQA 3IF1B 3QNYA 1RZIB 4O51A 1HNGA 2P5WD 4YQXL 5I15H 5CWSB 3D69B 3GMOB 3VXRD 5IW1B 4K3DL 2YKLH 2HVKA 1X5IA 3P30L 2YPLD 5LXGH 1BX2B 4NO2A 1IAIM 2DTMH 1I7TB 2XYCA 2XRAL 4Y5XA 4XMLH 1FZKA 1T7ZA 3VRIA 2R4RH 1R6VA 4CGTA 3QHZH 3HS0B 4AT6B 2PO6B 3KHOA 5IR1A 2PN5A 5GS3A 1IGJB 2YD8A 4YX2H 3BGFB 3O6LL 1IGFH 1UADC 1YJDC 4P2QB 1XH3A 4DN4L 1K8IA 4KKLD 5D6CA 4ENEC 5IIEB 2FBJL 4MDJB 1P7HL 2F5BL 1JN6B 1DBKH 2Q6WB 3LS5L 5FB8B 2P42B 5GGRB 5ERWB 5D5MA 1OAZL 3K8KA 1A5FL 1A5FH 4IRSC 4WGWB 4H20L 5F96L 3GMLA 1IMHC 5EPMB 1BGXL 1GL4B 3E6HA 1A2YA 4O2EA 1WQVT 3MR9B 5JUEL 3FCTA 1DBJL 4NP4L 3T0DA 4KK8D 5D1QD 3FT4A 4NZUL 3UTSE 4P23A 3GI8H 1RZJH 4MB5A 1MHHA 1G7PB 5L2KE 5C86A 1JMXA 3H7BA 3BX7C 3MGTB 3G6JE 4G7YL 3MJ8B 3U46B 5GS1A 5H37G 2Y36L 5JLZB 1JK8A 4Y1AA 2GK0A 4W6YB 5DGRA 1XR9A 1EVUA 5CZVL 3QCVL 2W65B 5I1JL 3HI1B 4Y4KB 4UBDC 4RBPH 5C0RL 3U1SH 3VXUA 2OSLA 4U0QB 5ISZA 2AK4D 2W0KA 4HS3A 3U30C 4ZFOA 3ZTNH 2FCBA 1UFUA 4HKJB 4BQ8A 1MQ8A 2VXSH 5F9WB 5F9DC 1R3LB 2HFFA 5JW4N 4XNUL 2E7CA 3C08H 1CFSB 1FYTE 5ITBH 2E6QA 4NM8L 3EO1A 1UM6H 2X4PB 4LSRH 1JPGA 3L5XL 4N1HB 1LE9A 5EIQA 3KPMA 3FQWB 2GJ6A 3BDXA 4NQCE 2DKMA 4NOBA 4LVEA 2D4DA 1MJ7L 1LEGB 3PWLB 2GHWB 4EN3A 2FR4B 3GSXA 5DSCB 3C60D 1WWCA 2YZ8A 5C0BD 2DLEA 1XR8A 3TWCL 2X4TB 4G8EB 3HG1D 4V1DA 4L4VE 4YHMH 1TFHA 4XH2B 3U0TB 4PRPA 3PGFL 4ZQKB 3LKQA 5TFSH 4NO3B 5INDB 5BS0D 2Y6SC 5I8CB 1FYTB 4MJ5B 1L7TL 4ACPA 4OI8A 1L9MA 2Q76B 4FTVE 3MRJA 5DJ8B 3S36X 1KUMA 2V2WA 4DKAA 1CICD 1LEIA 4TNVK 5CUSH 3EOTH 1J0ZA 4AIZA 3GIVB 2R2BA 3IFPB 2Z92A 3ZYIA 3MRBA 2J8HA 2WBWB 1EZVX 1LO4H 2AS5M 3RGVA 2EDTA 5DHVB 4PBVC 2GY7B 4OUOA 4R96A 1B4JH 2E7HA 3VFRA 4R3SA 4L9LC 1XIWD 3CXHJ 1IEHA 1VADB 1J10A 5DEZA 9CGTA 2XPGB 3VI3E 5TF0A 4TPRH 3FOMB 4I18A 2DBJA 4ODVH 3VFTA 5IVZB 2GIYA 3SE3A 2R56H 4LVOC 1CFBA 5FM8A 1U8KB 1MWAH 5SWSA 4NFCA 5EUOF 1RURH 4JFQB 4X9GA 1T0MB 2C3GA 2XKSA 2DI7A 1LNUA 2EE2A 1T04A 1JF6A 1RU9L 3HG1E 1RU9H 3NIGF 2VSDA 3LKNA 2I27N 1MFBL 3BHBB 4WI9A 4CADB 2ITDA 4I0KA 3RJQB 1MRCL 3LEVH 3UBXG 3UAJC 1MWAA 2VE6B 3KPSE 4M48H 2W9EH 4Z7WE 2BXZA 4Y5YB 5T1KA 4IS6A 3RJDA 4L8DB 4IHOA 1F3RB 2DM7A 3RI5F 2CR3A 4I4WB 1SY6A 2YA2A 4B50A 4WFGE 3GFUA 3SO3B 2R29L 2AGJH 5CEZL 5DQ9A 1T20A 1CL7L 3KPPA 5D1ZD 3HC3H 3WFCH 1QUNA 3UYOD 4GH7B 3NIFE 2OJZL 4NKQB 1QLRB 2B1HL 4JKWA 1U6AH 2J7LA 5IW3A 1F3JA 3QZWG 2NY7L 4QHNB 4PJIE 1AGEB 4Z5RB 2W65A 2BVYA 4KZEL 4JQXC 3UJIL 5DLMH 4GO6B 5LGKA 1J1OL 4JFFD 3LQMA 4MD4A 1INEH 3MGTA 4EUPH 4QRPB 2KKQA 3GGWB 3C5ZD 4PJ7E 5IQ9A 3VXQA 2O5YH 5CIPB 3RX5A 1FZJB 3ZHKA 3RWCA 3W9EB 3T8XA 4MQXC 4MD0A 4OF3A 1YY9D 3HZVA 5KSAA 2A6KA 5HHQA 1FORH 3U82B 1X5JA 4HK3N 2Q7NA 3X17A 1JBJA 1LGVA 3UTTB 2BSRA 5BOPA 1CG9A 1FAIH 2PXYA 2WBJA 3DETD 5JOPE 5KBNC 4OD3L 1DUYB 4GUPA 3FB8A 3D2UA 3O3DA 3ECBB 2XTJD 1AR1C 1EO8H 4B5EA 2DTSA 1RFDH 4LLWB 2ADIB 4YPGA 3KWWA 4NRZA 4EN3B 1MFDL 5ITBL 2YPVH 3RIAF 3RRQA 3PL6A 1SEBA 1EGJH 1C5CL 2R0ZL 3LN4B 1FAKT 3VMPA 4MJ6B 4S1DD 1D5MB 5GPRA 4Y1AE 3RTQC 2FH8A 4YWGH 3TM6A 5BXFB 5CZVH 4EI5C 1JYXA 1YNKL 4H1LH 1A22B 4ZXBB 4J6RL 2EIZB 3VMOA 4JFFE 3N1MC 1MFAL 2M2DA 4PJCA 4NHUA 4PJGF 4DFHA 4JFEA 5L2JB 3X3FL 1W0WB 3WIIL 2J6EL 5DD3H 5MENE 3AS1A 4F8QA 3IDGB 5BZWA 3MCLL 4OF5A 5GSVB 3SCMA 4BFIA 1AXSB 1ZHLB 4J8RB 2XXMB 4Q6IC 4JKLA 3OG4B 3ZHLA 3ULSB 1GZPB 4X6EB 2O61A 4F15B 1S5HB 4R4BA 4Y5VB 1W2KT 4Z7OF 5EU6E 4PP2B 4UZGA 5FDWA 2J8OA 1F4YL 1FV1B 4JZJC 1FNHA 5FO9B 1T66C 4W6XB 3RUGA 4ZTPH 2GT9A 3WL9A 4WCYL 4MLSA 4X6DE 3O3BA 1KPRB 3JV4B 4HMCA 5HXMA 1GVIA 5ADOH 5AUMA 1S7QA 3DUSB 4G8IB 4NWUL 5INCB 5BRZB 4PRHE 3P4OB 5D72H 3T1FA 3LS5H 3NCMA 2Y1VA 1NCTA 5C6TL 2J8UA 4P4KA 3CSPA 4RNRB 1FL5B 2ADFH 5HSFA 4KTEH 3HB3D 3LSOB 3WFHA 3QG7L 5E9DE 1JWSB 2Y5TA 3HPLA 1CGWA 4K8RL 4XXDB 4DGYH 3DI3B 2YPKA 1AR2A 4RWHA 1NCCL 1T66D 4NC1E 5DK0A 2FX9L 1KJMA 1JF1B 3VA2C 4Q97A 3GM0A 3ARVA 3PHQA 4M03A 3Q3GB 2G75A 1CXIA 1OY3B 2VZUA 1I9RL 1IBGL 4HIHB 1C5BH 4P2RD 2RBLA 1QSVA 5I71B 5DJDB 3RWJB 4RGNB 1R3HA 4U3CA 2NMSA 4A6YH 1PEZA 3F6LA 4NO2B 1JHTB 2BJML 1JV5B 4PJ5D 1DUZB 4YXKH 3PNWA 2B0SH 1OB1B 4BSVA 3ZDXE 3QDGB 3MXVH 3OKDA 4QT5A 3AGVA 1Q1JL 1Q9KB 4S2SB 1DE4A 2FL5B 2IQAB 4Y5YC 1DBMH 1G6RL 3I50H 4M9OA 3OB8A 4WDIA 1HCVA 3DUHA 1JZ3A 4WEBH 4L4JA 3P4MA 1W72H 5FYKH 1XF3B 4LPVA 3O41A 3TYGL 3TCXA 4JM2A 1NMBH 4OCXL 5CBAA 4I2XB 5HJ3A 3W81A 3MRPB 1TVBA 3T0VA 2QSQA 1OGAB 2GTWA 3I9GL 3RWGA 4PUBH 2CSPA 1L6ZA 2X1QA 4PFEA 4WFFD 3VRLF 2UY6A 1YY8B 4JDTH 2NPLX 4HMDA 3TFKC 4GW5B 5T3XL 3DGCR 5T5FH 3MLPA 2XICA 2B1AL 3C6SA 4ZS7L 2YUXA 1F4WH 3ARTA 3G5ZB 5SWZD 2NZ9D 5I15L 4N90E 5E2JA 3H6JA 1FSKB 2OK0L 5E2UL 3LRGA 2SEBA 4NN6B 2C26A 3MRRB 3GMPB 4TUOA 2C4FT 4OQ1A 5EN2A 3P9LA 1PY9A 4JY5L 3IDNB 3QIUA 1WF5A 3MJ9H 3MJ9L 5BS0B 4HFUH 3LKRB 2A9MH 3RY4A 4Y88A 5IIEA 1Z3GH 4M7ZB 1NBZA 3V6FA 4KJQD 3PGCB 4OAWB 5FAAA 2BCKB 2GTZA 3U7YH 2IC2A 2DBLH 3V79C 4M6ML 4HFWA 3HMXA 4PJ7F 1WBXA 5I76A 3SE4C 2K7PA 5C0EA 4MS8D 2APFA 1DFBH 2QJDA 4RGMB 4P2OD 2E7MA 2WWMD 4E41B 1U8MB 1FP5A 1OTSD 4P23B 2JIXA 4UOW1 2IADA 3LD8B 4KI1A 1B0GB 3CFCH 3R1GH 4JFEE 4YDVB 5ILTH 3MR9A 4NM4L 4XAWL 2JKXA 4H26A 5C09A 5F7HA 1Y18B 4G9DB 4AQOA 1HXYA 1UM5H 1HEZA 2BC4B 4P5TB 1EXUB 3GBNL 1ZWIB 2DQDL 5J6GB 5KVEH 3QIWC 5I1KL 4A6YA 3VFGL 1ONQA 4PRPB 3PG2A 4NC2B 3VW3L 4OLUL 1VFAB 1WAAE 1MLBB 4E5XB 4JM2F 3ULUD 4PGCB 4P59L 1HZHH 3PWVA 3HAEB 1NAMH 5ENWB 4ZTPL 1VESA 3GMMA 3FFCB 3VWKB 3K8MA 3LKSA 3HLAB 4GLRI 1QLFB 1R24A 4W4NA 3G6JB 4Y19A 4HQQL 1JWUA 5E5RB 1AY1L 1V7NL 3O0RL 5CJOH 2VXQL 1IBGH 4LCIH 5AG9A 5TQ2H 3I3DA 1A3RH 4YUEL 2OZ4A 3BIKA 1ZA6B 3D25B 4JR9H 5DHVA 4ONHB 3WS3A 1B6DA 1HHGB 1K5NA 3FQTA 3VFPB 3FO1B 1JTOA 4WW2C 3FFDA 3RDTC 2FBOJ 4GMSH 4FXKA 5AAMA 3RZCC 5BW7C 5E5MA 4LPWA 4UOJA 3X13B 3AAZB 4APQA 1WCQA 3LS4H 3TA3C 1R5WA 5INCA 1Z9MA 2VLKA 1JGUL 2CLZA 3L3DB 1FZOA 1EGJL 1A14H 3WN5A 4CVUA 1U0QA 3S9DB 4JM2B 4L3EB 2Z0BA 1MCLA 4X98A 2NQCA 1ZKAA 1ZT4A 4H0IA 1U58A 2V2TA 1EFXA 2YWZA 4ALAL 4CDHA 5ADPL 3DMMD 1X4YA 4N8CH 1CD0A 5A43C 3TWCH 2J8UF 3NZHH 4N5EC 4DZ8B 3F5WB 1G9NL 3QNZB 5DJ0B 2IGFH 3QUXC 5GRZA 1RJZB 5GGUA 4N8PA 1CDUA 3BQUD 4OZGA 5F9OH 5JA9A 5BO1H 5C3TA 2V7NB 2KH2B 4BSWB 4U3HA 3VXMD 2ZOLA 4M02A 5C7XH 1C7TA 4RZCA 1RZ8A 4Q2ZB 5CP3H 1MIEL 3LKRA 1FHGA 4HCRH 5I76B 4YXHL 4CVZB 5FKAA 3OTTA 4WUUE 4I0PB 4LDOB 3VGEA 1B2WH 2CRIA 4P3DA 1R3KB 1T1ZB 3RTQB 2RFXA 1NAKL 1BBDH 5FGCB 2MTPA 3O6MH 3SKOA 2EEBA 1TPXB 3I3BA 3JWOC 3MMEB 2UV3A 1WK0A 3NTCH 2IAND 2C4FU 4DUVA 5IW6A 1UACL 3HI5L 1YQ2A 4PRHD 2NY3D 2VDRH 4PJDE 4MXWH 1YPZF 4U6YB 4Y1AD 4ZTOL 2C4XA 1KJ2H 3PGDB 4E41E 1S7WA 5ACZA 4ZFGH 5ANME 3T0ED 1UVQA 4O51B 5D7IA 4WHTB 1B90A 1S7SB 5L9DL 3S3JA 3MRHB 5I6XC 4HS8H 1R3IH 2AJUL 3V6OE 3WE6B 3VGAC 3UCRA 2GJJA 3SQOH 3O4LA 5FO8A 4HQQH 5EIIA 1RJYA 3WD5H 3ELAT 2QR0A 2IPKB 5JPMB 1SMOA 5IP4A 3I6KB 4MAYA 2XZCH 1TVHA 2ZUUA 1Y6NR 3FRPA 4YK4C 2A83A 3FOMA 2C3VB 2D0HA 3EYFA 4IM8A 3WN5C 3RVTC 1N7ML 5EU5A 4X4XA 1T3FA 4XAKE 2VYRE 5CINL 4LVHC 1MCWM 5F97E 5C2UB 4OFKA 3C60C 5KSUA 3BIBX 1I9JL 5F7FA 1IZKA 4NNYB 2BCKA 4OD3H 1HHHA 4PP1C 3HCVB 4YDJA 4LMQE 1Q9OB 4NQTA 3VFNB 2BP3A 4YAQA 4HF5L 2ITCA 4ONGH 2XG4A 1K5NB 3L9RA 3RKPA 5F89B 3W0WE 5C9JA 2AJSL 1H0DB 2YK1L 4JCLA 2VXVH 4FZEL 1IGIH 1XCQA 2BVUA 1AJ7L 2VZOA 4WFFE 2NX5D 3GM8A 1U8OA 3SDCD 4RNRA 4Z76B 3KXFA 3WXWL 1I1FA 3DTXB 4ODWA 3T0EA 4MA1C 5J3HD 4NKIL 4YXLH 3VFTB 1MH5B 1ZLWK 4K2UH 2I60L 2YC1A 7FABH 3RFZC 5EPMA 3NCBB 5I30H 1CGSH 3RUGB 2Z8SA 3DROB 4PY7B 5ID1A 1UEYA 4HIXL 4C56B 1ZGLM 1J05B 5E00B 2VH5L 5I1EL 5CLWA 4QRQB 1MREH 2YUZA 4NFDA 3JV0A 1KIQB 3DUSA 4RZCB 3ROLB 5HHQB 4WHYG 4X6BA 1RZFL 4D0CA 2IH1B 3PP3H 1F4HA 3ORJA 4XVJL 4I2XE 2CGRL 2MNUA 3LN5B 1MJ8H 4WNQA 1JV5A 2EIDA 1F3JB 1F2XK 2NCMA 5J57B 4G8FB 4P2OC 1I3UA 3TBWA 3ZL4H 3MRQB 3ARED 3GSNA 3T4YB 3TIEA 1G6VK 4NPYB 3CVHH 1S5HA 4R4BB 2BVPA 3MGOB 5IJVB 2VLLB 4WTXA 3I3EA 3IGAA 3MRDB 4PLJD 4KKCC 2CDEA 5HHOD 4PJFF 1DL7L 3KR3L 4K8RH 3VFWB 1N8ZB 5C0NC 3HE6A 5DUPL 5F1IA 1UYWH 3MV8E 1E4WL 1JF1A 3MO1B 5C9KA 3QUZB 2CMRH 4PJBB 2QSVA 4YBLC 1QR1B 5EOCJ 3QPQD 1FBIL 4OZGE 1Q38A 1UXSA 4I1NB 3ZL4L 2QQNL 4FA8A 4NKMB 4TULL 3VXUD 4BSVB 1JNLL 5D7SL 3TIDB 1MWAL 1A02N 3GJFB 3QQNA 3BWAB 2OZ4H 5TDOB 1IQDB 3OKNB 4WENB 1MIML 1FIGL 2BDNL 4PRPD 1KV3A 2MMXA 2CK0L 3QO1B 1YYML 3P0VH 1ZE3C 5EBWB 4NJAH 2PR4H 3P77B 4EDXA 4ZSOE 1WVZA 2A73B 3EO1B 4MLIA 3NGBB 3G5VB 4FP8L 2OYPA 3WLBB 3NIDE 3BVNA 1ULVA 1YZZA 4YO0A 5C92A 5DUBA 4Q6IA 3RZWA 5FCUH 3OGCB 5A2LH 5F7MC 4X7SL 2H6PB 3TT3L 4K8RC 3AXLB 3OKEB 5IMLB 2H2PC 4HKBA 1KLFA 4OQTA 4W68A 1CU4H 2DYPA 5I8OL 3HC0A 5IGXH 3CZFA 4G9DA 2ERJB 3HE7C 3F7VA 1E27B 2B1AH 3PWLA 1E4XL 1HYSD 4PV8B 3A0OA 4KPHL 4NIKB 1QFUH 5DJYA 3PGFH 2XA8H 4L9LA 5DD5H 3Q2CA 2OTUA 4Q6YA 5AD0B 1RUKL 2F54A 2QSTA 1EAPA 3IU4L 1FG2B 1AGBB 5I66A 3L5HA 5F7UA 1NGZB 1LE9B 3EJJX 4XVUC 5I1CH 4K8RD 3E6HB 1SBSL 3RQ3A 2NTFB 1PQZB 5IUSA 4EUPG 2DQHH 2YPKB 5E2WH 5GRVL 2GEEA 3PXHA 1AFVL 4KROB 2Z31D 1QBBA 2X4UA 5SWSD 3RZCB 1IEAA 1FGNH 3RGVB 3LPWA 1E0OB 4C56D 2P8LA 3IDUA 5FEBA 1T7VA 3L3GA 4ZS6D 2W60A 5C08A 1F8TL 1X7QB 4ZUUA 3VXPB 4W70A 4OKVA 1A6UL 1UWEL 3FZUC 4YXHH 2A83B 3DHMA 4KVNL 4HZLA 1MCSA 1E28B 1BBJA 4QRPA 3TBVB 4V2BA 2ATPA 3OL2A 1D5XA 4U0RB 4LU5L 3CXDH 5CEXA 2BRRL 4DN4H 4L4VA 1SBSH 3D48R 3ULVD 2Y9RT 2AJ3B 3FQXA 5F3HB 1NKRA 3AREB 4KAQH 2ID5A 2N1KA 3QDME 4MA7H 1ZGLA 3PWJB 4R7DB 4DN3L 5MP6L 3JWDH 3PWVB 1QRNB 3UPAA 4JFFB 3V5DB 4MNGE 5FO7A 5ID0A 5I16B 3KPSD 4H5SA 4XWOC 5GZNC 1G9MH 4HS6A 5F96H 3BPNC 4N0UE 1EEUA 1I1CA 3CLEH 2A2QT 3B9EA 3TV3L 5IFAH 1XFPA 3VXSA 1TQCB 5GXBB 4RGOH 5FHAH 4RGOL 3TN0B 3MZTA 3MA9L 4ZO6A 2YD1A 5DGQA 5CIPA 5B39G 4I48A 3WD5L 3BHBA 1AQKH 5E8NA 32C2A 3L3OB 5TF1H 4HJGA 43C9A 2Y36H 2B20A 4S10A 1H15A 4KQ3H 4L4TB 4PJDF 3RIAK 5J6HA 1MQKH 5EB9A 1X5LA 1TIUA 1WFOA 2OL3B 4FZ8L 5JIKA 5TH2B 3GMRB 4OZIF 2QHRL 4U1GC 1AR1D 5HHNB 1LMKA 3NA9H 2BSTA 1YEEH 5D96B 3T65B 2Z93A 5FV2A 1ZVSB 4LCWD 5E2VH 3U0PB 3B9KA 3L7EA 2IALA 5C07A 2J12B 5HDBF 3QEGH 2D7MA 1MCHA 1KCKA 2ORBH 5KSAB 1YNLH 3GMPA 3QQ3A 4XNZC 3DGGA 1DQJB 2UUDK 5EUOE 5IEKB 3RX7A 2ZSWB 3MRLB 4JO2H 4PJBF 4HWZA 4LEXL 5DYOA 2GY5A 3DRTB 1ERNA 4JAMA 4RFNB 5HGHA 3P0YL 5I8KL 3SCMD 1KTKE 4HMEA 2IFFH 4M1DL 5HGBA 3I85A 2EYTA 3KYNA 4LF3A 3SDYL 4JDVA 4JFPA 4LSSL 3AAZA 3BD5A 5BV7L 5IVXF 5SX4H 2BVQA 4G7VH 4NN7C 3VFVA 4Z7OE 1I8KA 2UZXB 5ICYB 1MRDH 4Z8FL 1U8PA 4U1SB 4DKFL 1TZIA 2AXGA 2VR5A 3ARDA 2DTML 3G08B 5FA3B 1SQ2N 5HPMA 3W5MA 4I0CC 5FDWB 3T0BA 3HE6D 2AQ2A 3VFUB 1I1YB 4Y5XB 1N6VA 3U0WH 1EHLL 2I5YL 1KELL 4OZ4B 3FQRA 4ERSL 3F12B 5D2LE 4UAOC 3TFKD 3EYSL 1G1YA 3T8XB 3V6BR 1NLBH 1VACA 3FJTA 4PJIB 4XVSL 5HHOE 5SX4I 3QULA 1W8OA 4H1LB 4K7FA 5DFTA 3KDMA 5KAQF 4FXGA 2V5RA 3H3PL 3OMZA 4R4NC 4JVPA 3MRNA 4NCDA 4MMXC 3BT2L 3G6JA 5DS8B 3MBEC 4Z0BH 1BD2D 4X6FA 4UNUA 3GJEB 1UWGL 1IL1B 1NEZG 4RGNC 5IESL 1L4IA 5C8JA 3VWKD 1FJ1B 4LCUA 1IGTA 1CFNA 1UKQA 3EOTL 2CK0H 3VXUE 2JK5A 4RWYL 1KFAL 4G6FD 4Y4HD 5CFHA 3PABB 1KLUA 1Q94A 1SEBB 4XAWH 1OAUH 2R1XA 4NM4H 1TQBC 3BEWA 1A2YB 1TJHL 4LK4A 4TNWF 5HHOB 2DWDB 5GGRY 3QDMB 4XVSH 2CIIB 3T0WA 2J3SA 1VHPA 2ADIA 3MRRA 3MUZ1 2EICA 1P4BH 3ARXA 3MV7B 3CVIL 4WI7A 5LXGL 4RFEB 4OCYL 2WLYA 3V7AG 3F7QA 1WBZB 5DJ2B 3EOAA 1VFUA 4I77L 2BK8A 3Q6FA 5EU6A 2ICEB 2AJVL 4GW5A 4U6YA 4PJ5A 3T1FB 3IYLW 1RURL 3QHZL 3BI9X 4X7SH 1HZHL 4P59H 1YECL 3TBSA 5EWIL 1CFQB 4P3CH 4HKXA 4X6DA 3RIFK 3OPZL 5D8JH 3VJ6B 3TYFA 4OZHB 4BQBA 4JM2D 5A2FA 3P4MB 4KQ3L 4WFEE 3QB7C 1FV1A 2AEQL 2Z35B 3SJVE 3AMLA 4P5TC 4NWTH 1NBZB 3L3GB 1FZKB 4RA3A 3BAEH 1F11B 4ZUUB 2EDXA 1GGIH 1MCQA 3NPSB 1HOCA 1BEYH 2VC2L 2BXYA 1RHHB 4ELME 4PTTA 4KROC 4EJ1C 4YDKH 3TN0C 4X4XB 3WIFA 2OZ4L 5EC2A 2VLLA 3UROR 1GOGA 1GGUA 2QADD 2QQKH 3HMWL 4MVBC 3QEUB 1RULH 4DUWA 3L6FA 1JN6A 4KHTL 3RNKA 3ARBB 5FB8A 1QA9B 3WUWB 4V1DB 4CNIB 1W72L 5GGSB 4MQSB 1FZMA 1DCLA 4WWKC 3A67L 5BV7H 1RAMA 4RIRB 3G04B 3SY0A 1WT5C 2IAMC 2ZUWA 3MRKA 1KCLA 4ZFOL 1NCUA 1PG7W 4DKFH 3QXWA 4HG4J 2F5AH 5IBTL 4M7KH 1A7OL 3MBEB 3STLB 4AH2B 1F6FB 3DNKA 2BRRH 3LDBB 4NZRH 3PGDA 3BH9B 2BNQA 1KCRL 2K7QA 4UV7H 3QJFB 1RUAL 5ICYA 4WU5A 1TXKA 3UBXB 3F58L 4P99A 4FQ2L 5D2NA 3B9KD 3RWDA 2CDFB 5FYKE 1YMMB 5JW4M 3RY5A 2YN3A 3MRBB 3V95A 3LVEA 3HE6B 4HUXA 3HAEH 3RVVD 2XZZA 3ZE0F 2FO1A 2O26U 4QRUB 3HR5B 4F33B 2XWTB 4JGJA 4IMLA 4K3JL 1XCQB 3M1BA 4EUPB 5GS0H 1CD1B 5L88L 3ILQD 1S7UA 3PJSB 1BECA 1T2QH 1D9KB 1U95A 4LLYA 5DJXB 1HDMB 4C57C 1GJIA 2J88H 2ZPKH 2CMRL 3U0PA 1ZVHA 2YRPA 3C5JA 4J3VA 5K93A 5JORB 1R3JA 1IKNA 1JMZA 1ZSDB 5B39B 1IQDA 2ZG3A 4L29B 5DRNB 1P4IH 3LB6D 3EYUH 3RWGB 2I25N 1L6XA 1OAXH 3NACH 4C4KO 1ORQA 4XCYB 5E6IB 1QFHA 4WU7A 4OLUH 3HZKB 4LQFH 4PJBE 3GKWH 2BC4A 4P5TA 4PBWD 5IFAL 5SX5H 1FNGB 4MSWB 4JFEB 2ZCLL 1N64L 1YQVL 5ID1B 5IFHH 4L8DA 1KLGB 5CMAA 4HUUB 3F62A 5K9JL 3ULUL 4ZMAT 1RIUL 2EDNA 2J5LB 4BUGA 4D9LL 4XPTH 3NVQA 2AJXL 3VXNB 3PWUB 4KUCD 4PJ8C 2ATKA 5TE4L 3BD4A 4EKXA 4HKBB 4Z6AT 3TBWB 3ZYZA 4POZC 2Y06L 5F72S 5JIIA 4KUZL 5FA4A 3GSNL 5CSGA 2EYSA 5CJOL 5E8EB 5GZOD 2A6KB 2E6PA 3PWJA 4R7DA 1UCBL 4X6BB 1TENA 4S1SH 4R7NA 3W2DL 1YEFH 2VDPH 4XBEL 3P77A 4EDXB 1IC5L 1J05A 4HJ0D 3NN8B 3HG1A 3QFJA 1KB5H 1TETH 3U79A 3IJSA 3BKYL 3HC3L 4JDZA 1FLTX 1C16A 3LOWA 4M7LT 3WFCL 5JOEA 4RCAA 1MHPL 5T5NF 4YC2C 4XHQA 1EMTL 2EDDA 4FRWA 4G6KH 5A40E 5E7FA 4P3CL 1VFBB 1OARH 1G7LB 5I1CL 4NHCH 2WV3A 4KK5D 2J4WH 5SWQB 1KG0A 4LRIC 4U49A 1F4WL 1Y6KR 4LSTL 1BQUA 1GZQA 3ZMRA 4M62H 3MV7A 3EUUA 3BFOA 2R69L 4I3GA 4Y4HC 1S78D 4RMRA 1JE6A 5FUOL 4KJQC 4FZEH 4K7PX 1SJEB 3ES6A 5E8DL 1OCWL 4O00A 3FQUB 4XMPH 1FG2A 5CEYA 4BYHA 1PJ9A 2P5EE 3EOBB 1QO3B 3KJ4C 1RZFH 4KKLC 3ULSA 3AY4A 2VB5A 4QGYA 2HJKB 4ISVB 4APQC 3TA3A 1YMMD 3KLHC 1A4KB 3DJ9A 2CKBB 1CIUA 4PREB 4U6VL 3EYFB 3PE9A 4QRRB 1Q0YH 4XI5D 3U48A 2CXGA 3OGOE 4KDTC 3DO7A 2VZ3A 2APWA 2XKNA 3BSZH 4AMKL 5EU3A 4DKEH 2KPNA 2EDYA 5D93C 1NSNL 2WNGA 2YRLA 3FT2B 4PJHB 4Q0XL 3FFDB 3ROOA 3V4UH 4QF1B 3VGGA 2DIJA 2PUQT 5T1MA 4NKDB 5FF6A 3UTTE 3KPRA 1OTUD 3OV6A 4MA3B 3A6OA 3IXTB 1SJVA 2YBRA 1ZTXL 4OCWL 4AEHH 5D2NE 1V7MH 1EERB 3GBNH 1KJ2L 2Y6SD 43CAB 3MLRL 4JFFA 5ID0B 1UWXK 2ZWLT 3GMLB 2F53D 5GGVY 3MV7D 2R1YB 4TRPL 1JJUA 1WTLA 4KKCD 4YHLL 1NUDA 3F7YA 2B1HH 5TDPB 5H94A 5I0DA 5AD0A 2PKDA 2NY1B 1OP3K 3OKLB 3EO0A 4KDTA 3KYOA 1GGTA 2WBKA 4NJ9L 3Q6GH 5C2BH 3VDBA 3OHXB 2F58L 3ARFD 1TNMA 4PB9L 3QIBD 4OF8A 3MA7A 5ESQB 3ZKSD 1IGCH 1M7DA 2KQMA 3QEGL 1NUNB 2VDPL 4A6YL 4FQQB 3HMXL 5EOCH 4LGRB 2ZUQB 2Y07L 1YEGH 1YEGL 2OSLB 1ZVSA 1F58L 3DVFA 3PL6D 5TGBB 4G5ZH 4R90L 2HLFD 1N5AA 1OQXA 4G8GA 3TBYA 4HC1A 5DJZB 5J3HC 1S9XA 4ZAKA 1OW0C 1J8HB 5EOQL 2FYYA 3FMGH 3LEYH 2Y7QA 4UDTA 5FA3A 2R0LL 4MQXD 3RHWK 3QISA 3HUJB 2FX7H 2QADB 3L3IB 1DQQB 4I9WE 4XTRC 1P9MA 2HLAA 4YBQC 1AD9B 1CGSL 4N0CC 4I48B 1XGPB 3IU3A 4S1QL 2BMKA 1AO7B 1S7XA 2IAMD 4XP5L 3E3QC 2AXJA 5E8DH 1Z2KA 1RV6X 4ZSOB 4O2EB 1L7IH 3QHFL 1OT1A 3MRMB 4DW2L 4HAGA 4U1MA 1G9NC 5D1QB 2FLRT 4NYLA 1P4IL 5L2KB 1WICA 5KVDL 1F90L 2R0WH 3BOVA 3QUZD 2VXVL 2PYEE 3W9DB 3IFPA 5MEOA 2IALB 4WV1C 4PJ5E 5C07B 5GJSH 2VRAA 4PJ9D 4DVBB 4AMKH 5L6YL 1MHPH 3DX7A 4K71B 5I9QC 3RWHA 1P5UA 2L7JA 1VGEH 1FJ1A 4LCUB 3ZDYF 4ZUWA 1GGYA 2H8PB 2NYYC 2D31A 3CXDL 4PJXA 3FT2A 3HA0A 4LPYA 5C9JB 3ARUA 5FDYA 3WIIH 1KCUH 2W0PA 3G6AB 1DDHA 3QQ9C 1H15B 2DKUA 5J0BA 4L3EE 4XMKH 1DP0A 5KN5A 2NLJB 2XWBA 1I9IH 2C1PA 2C3XA 4JY6B 4H20H 3PP4L 3O9WD 2UVFA 1HEZB 2AKRB 3WLWD 4YHZH 3MRCA 3MYZA 4QNPE 4OGXH 3QDAA 3FRPG 2EZ0C 2FATL 3PWPB 2O5ZH 2CIIA 2DQFB 4P5MB 3BH9A 1JPTL 4DZ8A 2NXYB 4H0HB 1VGEL 1T5WB 4QY8B 5HYJA 4LLUB 1CLCA 2Z91B 4Y89A 3VFWA 3TT1L 1JGDA 3QR2A 5BQ7B 1CVRA 3EO0B 3EIFA 4HBQA 4K94L 4PJEF 3SGJA 4GMTL 5DXWA 2O5XH 4KK9D 5H94B 3B2VL 3P4NA 2IPUK 4D2NA 1L9NA 3RHWF 1VEOA 2E8YA 2HTLC 3HFML 2BSED 3GHBL 3LH2H 4N9OB 3HC4H 1GYAA 3OKEA 3TJEH 1NDGB 5KS9A 2BSRB 2EKSA 3MRFA 5LBSL 4FXKB 1LK3L 5EO0A 3QUYA 3V6ZA 3ZE2F 3KYMB 1CBVL 4J3WA 4JJHA 3OKYA 3VFPA 3SQOL 1VFOA 4O2CB 1FO0L 3RWCB 4GG6F 3T04D 4KGJA 1KLUB 1Q94B 4DGIH 4FQIL 4DOHE 3GSOB 5HPMB 4NNXB 3QZWA 4Z0XB 5F7YC 5D1XA 1T5XB 3DX8B 4P9HL 5CKAA 3OXRB 5D9SB 2NY6B 4LKXA 5KVGL 1J12A 5C0BA 3MJ7A 2Q87A 3IU4H 4EOWH 1U93B 4HWUA 3L3KB 1EO8L 1YN7A 2DJUA 4PD4K 3NZHL 3B43A 1A0QL 2HWZH 3AS0A 1X5KA 1RJYB 3VG0L 4KJYA 1IZJA 3OBAA 1DBML 1G6RH 3V0WL 3WJLA 5HDOA 4ZOBA 1C5DB 1UH3A 2X4NB 4HX1B 4HUUA 5T5NG 4BK4A 2N56A 2UYLA 4R97C 1ND0A 3D39E 1SYSB 3CX5J 4GBXD 3FB7A 3IDMA 4X9FA 1JZ8A 4X6DF 4KGLA 5ALCH 3H7LA 1FO0B 3C60A 3QXAB 5TQ0H 3VFSB 5E6IC 5DI8B 5DJCB 1K8DA 1ZLUK 5HHXH 4O5LL 3VRJB 1MHEB 1HHHB 4ZPTA 2AK4E 5EIVA 1YEKL 5IHBA 1PKOA 1INDL 2JJWA 5I8KH 2NNAB 3D3VA 4IIQB 4TUKL 5K9QI 5TPWH 4U2YA 1NANH 4YO0B 5C6PB 4ZXBC 4NRYA 4U6VH 3SKOB 3S3PA 1CTNA 4Q9QL 1RZ7L 1FSKC 5F88B 3CVHL 2MJWA 3SOBH 3IDYC 3M1BB 3TH2T 1T1ZA 3ARPA 4OZHA 3AFLA 4KJWD 5GISL 4ZUWB 2OXGA 4P9MH 4KY1L 5JPNA 4Q6IB 2PW2B 4HKXB 2YSSB 1GSMA 3SKUD 1T1WB 4UV4H 4L4TD 5C0BE 4EBQL 1ZT1B 2GW5A 3MRHA 1EIBA 1PGRB 4MNQD 1V05A 5T33L 1LDSA 3G6JF 4XXCC 5DTFA 5BS0E 1BM3L 1FN4B 4X9IA 4BFGA 4H5SB 1OGAD 3S3SA 5CD3B 3SGEH 4XPTL 4PJ7A 3QG7H 5KVEL 3VGDA 4LARL 1GZQB 3HUJF 4TRPH 3UTZA 4LLVA 3SKNB 5ACMA 4QOKD 1H3VA 1CF8H 5J9PB 5ICXA 3UBXI 3TJEL 1G7JA 2G2RB 3VXTA 4JG0L 1WZLA 3FAXA 4QRUA 5IR1B 4D8PA 2OJEB 4LOUD 2VZ1A 2O5XL 2OMNA 2PTTA 4Q2ZA 1JGLL 3CDYA 4Y5VA 5DC4B 3DSNA 5MERA 4CMHB 1E6OL 4GRLD 3L7EB 2QHRH 5EBLA 1SY6L 5LGHH 4XC3H 1I7TA 4JVWA 4ZUTA 2NXYC 3LMJH 3SKJL 3IVKB 2OJZH 2A0LD 5F1NB 5ELIA 1MHCA 2FZ3B 2NTSP 5IW1A 4Y5XC 2CO7B 3WUWG 1QACA 2VN4A 4M1DH 5FUZL 3C08L 5I17B 1BZ9B 1M71A 1NPUA 3PJSA 1S7UB 2DLHA 1I8LA 4PLKD 3KYKH 4P2CG 4P23D 3L5WB 5ABDE 2BOBB 3QEHA 5FM5O 3TZVD 3NBNA 3IDJA 3BISA 5KOVC 2VDNH 1H3GA 5SWQA 5HYQB 5MI0C 5DQ9B 3G08A 1JWMB 3RDTA 1FNEB 1EEQA 3V4PH 2R1YA 2VLJA 1QBLH 1F42A 1KN4H 3N0PB 1EFXD 5C0GA 1FFRA 4HUMB 1TZHB 4HF5H 4XRCA 1Z5LA 4KRMB 2GCYB 4PJFB 2VDLH 5E9DB 4WEBL 3GK8L 4XWGH 4TNWK 1FVEA 4RISH 4AEIH 5FYKL 3QCUL 3RAJL 4RGND 1NGWB 3C5SA 2A9ML 2DF3A 2BRQA 2AEPH 1OPGH 2J8UE 2Z93B 3HZVB 4U1KA 1QBMH 3F65A 1J86A 1IC7H 4N5ED 1AH1A 1IC4L 4G6JL 2FYYB 3S5LB 4QXTA 4X4MA 5E56A 3F7VB 3G9AB 4PYHA 5EU6D 4CJ1A 3B83A 1U8QB 1HQ4A 4RMQA 4FQ2H 4OT1H 1YEHL 3EDKA 1G7MB 1ETZB 3E8UL 3EFFB 1OAZH 4UIMB 4FXGB 2MKWA 5F9WC 5I1GL 1H3PL 2P8MB 5GIRB 3EFDH 5TDNA 5DT1H 3QUXB 2EXYC 4Z7VF 1A1OB 1F97A 3GEWB 4KXZH 4RQQB 2R1XB 2HJLB 5DK3A 1FLRL 1KT2A 4PRBA 3SQBA 1N6UA 2VE6A 3ULUH 3TT1H 5EORH 3G5ZA 1AQKL 2HT4C 5IQ7H 3SHSA 3KYNB 4LF3B 3VD4A 2Q8AH 4XGZB 4MXQD 3LY6A 5TDPA 4XHJC 2BVQB 4NRXA 3VFVB 1JNHB 3NTCL 1DSFH 1YEHH 1IGCL 2XN9E 4NQDD 2PCPB 4LRIA 1N26A 2ZG1A 4NYLB 4I18B 3QEQE 4K9EH 3JV6A 1NMAL 1QLEH 5I1JH 5BVPH 1KFAH 5TE6H 1A6TB 1E4WH 5I18L 1OAYH 3F12A 4NO5A 3U2SB 2H1PL 3PWPE 3UO1H 1S9VB 1FLRH 2Z31A 1BJ1H 4GRMB 4JG1L 4GAYB 4KKBD 5IVOA 3S37H 1G84A 5DA4A 2FECI 3CCHB 5HHVL 1NFDE 4JHAH 1GRWA 4MD0B 3A6CH 3QWRA 3IRPX 1S78C 1MLCB 1IAIH 3L3IA 3MJ6A 4ORZC 4OUUA 4H88H 5JMRA 4PRAB 3MRMA 1AKJA 4PG2C 2Y7QB 2ARJQ 1DBAH 3FAWA 4FQCH 5DHYA 3V2AR 2KZ1B 4ZPVB 2M26A 4KI5D 1VPOH 3K2MC 2GSIB 2WIMA 4NQXB 5F3BB 2NY3B 3OSKA 3BE1L 1KCVH 4TOYH 1XGPA 4YZFF 5J11C 5LGJB 4NBXB 2F54B 2KUTA 2DS4A 3WYRA 5CD5C 5J1SC 4LLUA 2WAHA 3H3BC 4BKLB 5HY9B 2F8VA 3ET9F 4IHOB 3HRZA 5IV2A 4F7EA 4G6AC 4M00A 1ADQA 1UA6L 5HD8C 2UWEA 5HDQL 5HHXL 3STZB 4RBPK 1IGMH 3H0TA 1ORSB 3TBTB 2D0GA 5EOQH 5CILH 3DIFA 1NLDL 2C1PB 4ODHL 4IOFC 1F11A 2VL4A 1E4XH 4G8IA 4MX7A 1CXHA 1UEMA 3D9AL 5C09E 2E7LC 3WS3B 5BV7B 2X70B 3ME0A 1QP1A 5IHLB 4KRPC 1OT2A 1QRND 2X1OA 2UVEA 1NFDA 2BNRA 4EUPA 1CXKA 5D6DA 1TCMA 1L7IL 3KPOA 2VUOA 3QFDA 2ZCHL 1ZVYA 1WWWX 3QUXA 1AKJD 3WFBH 1PAMA 2YWYA 1AFVH 1Q9LB 1BFOA 1GGBL 4DEPB 4CDGC 2CDGA 1DVFB 2W1NA 3BGMA 4UIMA 2FLBT 3VFMB 1DQDH 5A2IH 3NABL 2AK1H 2E8ZA 4O58H 3QWOA 5J89A 2OTWB 1MFCH 5FYLE 3VE0A 1SY6H 5LGHL 5E8OB 5MHSE 3WJJC 5I66B 2R4RL 1MVFA 4YHLH 5IKCA 3PL6C 2OTPA 1JHLH 1JUFA 5BQ7A 4XZUB 4YHYB 1FC1A 5F21B 1MFBH 5C0JB 3BKJH 3GB7B 4WTZA 4YGVA 5FO9A 1DQQA 2XKNB 4TQEH 4LCWB 4DQOL 4WDIB 1JZ7A 3IDIA 3S5LG 5C08B 3GHEL 2GAZA 5BZDB 1K2DB 4QT5B 1R3LA 5DMGD 4BJLA 1GZPA 1MI5A 2D2OA 1BWWA 5D7JD 3AC0A 4YBLB 4ZD3H 5DWUH 2B4CL 2X4OA 2YPLE 3TA3D 1VKXB 1OB1A 5JORA 3V8CA 2VXSL 5FYJU 4JG1H 3VG9B 3SDAB 4J3XA 3SBWC 1QPXA 1BFVL 2D3VA 1A7PH 3MV9A 3MJ7B 4YE4L 4BM7A 3ZTJG 3QXVA 1MCKA 4NUJB 1UJ3B 1PG7X 4DVBA 4BH8B 4PJ9B 5CBEB 4JJ5B 1K4DB 4FQXC 4GKSB 3CH1A 4BZ2H 4YEFA 3UJTH 2V9RA 4NQEA 5IT2L 1HSBA 1MCBA 2DN7A 3JZ7A 4K3GA 5CJ5A 2VKXA 3IDNA 3QIUB 4QXWA 2FHFA 3PV7A 4KUZH 4KHXH 6FABH 1IEBB 4XPGL 4C56A 3CC5A 3MRJB 4RMWA 5DJ8A 4LPCA 3GSVA 2P24A 1PKQA 1RUML 2VDML 3U9PL 5FYKD 1RZKL 3O2WL 1AGFA 2F54D 5I2IA 1NUGA 3MFFA 5EO1B 3VD7A 1L0XA 3ULVH 1HHIA 4PRID 3MREA 4X9BA 3QIBC 4ZODA 1JZ5A 3L5XH 5F6HI 4LSRL 5ISZD 4TTDD 5FXCH 1JNNH 4JB9H 4RMSA 5I75B 2BFVL 2VNCA 4G42B 4XPFH 5LVEA 3KPLA 1ZA6A 3D25A 3MLWL 3D0VA 1FNAA 5IFJB 3ABZA 5K9KB 1ODAA 3IFLH 2P5WE 5CHNB 5IHUH 3QXTA 2CJUH 4XP5H 4K23H 5D7IF 5DRXB 5C8JB 1OVZA 4L5FH 5C0EB 4M1GH 4ETYA 5MEQA 4PREA 4G8FA 1D7FA 2JB6B 1R3HB 1OTSC 4JANB 5IEHB 4X83A 3DV4A 3LIZH 4OV5A 4GQPH 1MREL 3RAJH 4DGYL 1KTRL 5KSAC 3H9HA 5D7LD 3FN9A 3V6ZB 2APVA 4U1IB 4OGYH 4Y2DD 4JPWH 3P9LB 2G9HB 3S34H 4J23A 4AENB 4R0LC 5ICXB 3GGWA 1D5MA 3RU8H 3RA7L 2H9GB 1R0AH 1G0DA 1ZXQA 3OWEA 5LGJA 4OF0A 4JREC 3ZKMD 3UTZB 2YUVA 5E4EB 3PF2A 1P7QB 5DSCA 1AHWA 2CLRB 3L3KA 3GSRA 5AAWA 4GT7A 4NUGL 2DM4A 4RSVA 5AG8A 2YXFA 3D3VE 3SGEI 4PGEB 4HLZH 2LV4A 4I3RL 3UTTA 2IH1A 4UTAL 5ILTL 3BD3A 1YEEL 4JO3H 1FC2D 2OP4H 3QUMB 4JFDB 2EYRA 4G6AD 4LCWE 4PP2A 3HMWH 1S7VA 3KNBA 1LO3L 3FMGL 3LEYL 3MRCB 5DEFB 5CCKH 5C09D 4HS3B 1AD9A 3V6OC 4PJDB 4Z7QE 4KKBC 2R2CA 2XY2A 3FT3B 1FIEA 3GKZA 4JQIH 4XWOD 5GZND 1A8JH 3S35L 4CU8A 4ELKA 4N9GB 1IAKA 5L2JA 3SDAA 4ZFZA 5FGRA 2GUOB 5IVZA 1REIA 5DMYA 3VD5A 1NCDH 1AHWC 1A7PL 3HZMA 4CBPA 3RVTD 1LEGA 5F6HJ 4AL8H 2NY0B 3VCLA 2P44B 4MAYC 5IG7A 4ZDHB 3EBAA 3UZVB 1I85C 3RY6A 1RPQA 2ICWA 4YJZL 4I4WA 2F5AL 3EGSA 3BP5A 1QNZH 3MV8D 1A6AA 3QYCA 3K46A 4DGVH 1NCAL 5GGVL 3QUYB 2WBJC 4M4PA 2WLZA 1DVFC 5JOFB 1X5XA 3EYSH 4QRRD 3L3JB 5EC1B 3UPCA 1WZ1L 1I8LC 1JWMA 3RDTB 3BGFC 1ETZA 5E94B 3JV6B 2IBZY 4PRDA 4Z7WF 1A6VL 3DPBA 4PRIB 2VERN 5D6CB 8CGTA 2BX5A 5DJXA 1P9MC 4OFIA 1A6UH 4OUUB 4P3WA 5DR5L 2PNDA 3BSZL 4IMLB 5FK9B 4OCRH 5EO9A 5CHNA 2VDNL 3RWHB 1I8IA 4PV9A 1A4JB 3RVXC 1G7IA 2ZP0T 5E6ID 3ULUF 3TBVA 1IM9A 4KMTL 4P3DB 3CLFH 4X7DC 5MEOB 4NZRL 5DUPH 2HP4A 3BESR 3U7AA 3SCMC 1LO4L 5IM7B 3T3PE 1XGQB 4YR6A 1II4E 4LVNC 4ZUTB 2FECL 4LSQH 3QIUC 4ODTH 3LKQB 5D7JC 2DAVA 4JRWA 1FYTA 1EVTC 1BLNB 4FXLA 5DI8A 4OJFH 3KPQA 5DJCA 5IW6B 3QFJD 4PJCB 4ZSOA 3G6AA 2J2ZA 1KC5L 2XNAB 1ACZA 4WFGD 2EDQA 2JJVA 2ILLA 5GGTA 3VWKC 5JXED 1P7QA 4BKLA 1U58B 2V2TB 1T20B 1S5IH 3EW3B 3V5KB 3HNVH 1HN1A 4LLQA 3BKJL 4MHHG 4PLOB 4N0FA 5CAYB 4U31A 2FEDD 5EUKA 4M93B 1JPST 4JKMA 4Z7QF 3NFNA 1C1EL 2YD6A 5DZLA 1YEIH 4MD5B 1OTUC 1JGVH 5DHYB 4Z78A 2ADFL 1QSZA 1EEZA 4WHDA 5FKPA 3SGKA 2HT2D 4R8WH 1IE5A 2B4CC 1RIVL 2O5ZL 4MCYB 2X1XR 5D1XB 4HWBH 1ADQL 3H9SA 3D0LB 3OR6B 3KPRB 3CCHA 4MQ7A 3EKCA 4P4KD 1BFOB 3I2CL 3SE8H 3TO4D 1S7VB 1SVCP 1JHTA 4PJXB 4NN5C 5JLZA 3D85A 1S9VA 2P45B 1CD8A 5D7KD 5E4EC 2EKSB 3VG0H 1X5FA 5IEKA 1P84K 3EJYC 5ANMA 3OR7B 2UY7A 3QXDA 4JQIL 4XNMA 5DMJB 5H35A 3WXVH 5J9PA 3MROA 1MJ7H 1J18A 3N85L 1U2CA 1I1RA 1EEYB 4JRXE 1J1XL 1WFNA 4GG8A 4CKVX 3RWFA 4L8CA 4LPTA 5DJ6A 5E8OA 4ZPTB 2FGWL 1EXUA 3MNWA 4CN6A 1WEJH 1IGML 4G7VL 1RK0B 4PJHF 4HIEB 4OQTL 1A6AB 3WHXA 3UDWC 2P8PB 1UH2A 2XQYG 2FB4H 5HYSG 5I1DB 1E6JH 4YDIL 3GSXB 3WFDH 2ITCB 4PRIE 1AJ7H 1EO5A 4QCIA 5EOTB 1U8MA 1OSPH 3VXTB 2FL5A 2IQAA 4PPTA 3REVB 4GG6A 3L5JA 3VA6A 1B0GA 4WUUD 3ALWA 1ZA3A 4LGPB 4OGYL 1NLBL 3REWB 5ISZB 1D5ZB 5I17A 3PNWB 2EIEA 5E2TL 3RA7H 2A9NL 5LJYH 2AXFB 4GRWE 5EU5B 5CSBA 2C1OB 3TJHC 3MOAL 2J88L 1U8JA 2KBGA 1ZLSL 5CD3A 5AWNH 1A64A 4MJIB 3HG1B 4A6YB 4F80A 4QHKJ 1MJUH 4UUJA 3AB0C 4JHWL 4M7LL 1MUJA 1N4XH 4MDIA 2ZNXA 1QSEE 4PJEA 1QSED 4LCCC 35C8H 3EYVA 2YPLA 3U2SA 1OF2B 4Y7MA 4R97B 3UDWA 3UTQA 3DYPA 5C0DB 2DQCH 3T08A 4LAJH 4X5XB 3V0VB 3GJFH 4LLQB 3EDJA 3HLAA 4Y2DB 2X4TA 4G8EA 5D6DC 1JL8A 2ICEA 4U1NA 4MAUH 2APXA 4RMUA 4JHWH 4FQHB 3V4VH 2EC9T 3IXAA 1YEDA 5CZXC 4PJGA 4PJ7B 2DMCA 5JOFA 4U7SA 5EDXA 3T1WA 3LEVL 3PGCA 3OAUL 1B3JA 1OAKL 1CXFA 1LEKA 1SM3L 2IG2L 2NY5L 2VAJA 3O3UN 1J8HA 1UXWB 1Z9SA 3T2PA 1JFQH 1F2QA 1MAMH 3MJGX 4XXCA 3UTPE 4XPHH 3JSSA 4HEME 2QQNH 2IADB 5EU3B 2DIAA 3S6CA 1KC5H 4OCSL 3I6GB 4YDKL 3TIEB 4GKZB 4MD4B 1ZS8B 4NPYA 2GK2A 4FQ1L 1D5BB 5ETUB 4B53A 4AQ1B 1OP5K 5KSBE 1C08B 4NRXB 1O7VA 1NC2A 1MEXL 1NBVH 4LASH 1TTGA 2YD7A 4QTIL 5B3NA 4L3EA 3G5XB 1MOEA 1QSFA 1TJGL 3U4BH 2R2HA 3HPJA 2NY0D 4N8CL 3B6SB 2DQTH 1NEUA 2UZYB 1YMMA 2VDOL 2GCYA 4JE4B 3WEXB 1MFAH 3WS6A 2IANB 4XMPL 3CU7A 1U41A 4L3CA 2SEBB 5I1HH 1F3DH 3JV5A 4MCZB 5KS9B 1UZ6E 4UQ3A 1T1YB 1YEJL 3MV8B 4XNXL 4OGZA 4CU7A 4EI5B 4ZS6C 1TZGL 4EQ2A 4PY8I 5DEGA 4GW1A 3QUXD 3OKNA 1MFEH 3NA4A 3WFEL 2AJ3A 1S7QB 2N4IA 5T3XE 5I74C 3EDDA 4F37F 1U95B 4LLYB 1IAMA 1DLFL 4ONHA 3NCJL 5IJKC 1GIGH 1AD0A 4F7MA 2NY0C 5IQ9B 4MA1B 4WJ5B 3QQ3B 1UJ3A 5JXAL 1DLHB 3UYRH 1WAAA 4MDIB 3ZYOA 2FGWH 2DQFA 1U8HA 4P5MA 5F1NA 2O61B 1G9NH 4JFOB 1PEWA 3QUYC 1L0QA 3B9AA 1MJ8L 2RHEA 4KV5E 3GDBA 2R0WL 4L29A 2Q8BL 4WY7L 2OQJB 3KHQA 1XMWA 1JZ2A 2NY3C 1RMFH 3QG6A 1LK2B 4FQPA 4NZTL 4XPAH 2UZIL 1CQKA 3QUML 5E0QA 4AM0A 1GHFL 1XF1A 3UX9B 3EGSB 2NY4C 4Q0XH 2DBLL 4ZOAA 1JGDB 1YYLL 3E2HB 4RFNC 4QRRE 1N6QH 4HIHA 1JIBA 1I3RA 5A2KH 2F58H 3MPCA 1PYWB 3PHOA 4UTAH 1CICB 5CIPH 1UB5B 5TF1L 3CNKA 3VXRB 4X7FC 3WE6A 1C1EH 4LSVH 5C6TH 1NFDF 2X4QA 1HHKA 4FP8H 4D0DB 3SDXE 2VLKE 3MUGA 4E9LA 2VZVA 4W4OA 2Z8WC 4LQFL 3R1GL 1DE4B 5KTEH 4NZTH 2IEPA 3DV4B 3V9FA 3G6DL 1RJLB 1DVFA 2ESVB 1EPFA 1I1FB 4K07A 2E6JA 1ZEAL 3IJHB 4R6UA 4FQCL 2MHAA 2YRZA 1V3LA 1YN7B 4OLYL 3DHJA 1IGTB 4JPIA 2Q20A 1HDMA 2ATPB 4X7EC 4BQCA 1CXEA 1NFDB 4FS0A 4OLWH 4D9QE 4LKXB 4G6ML 4EXKA 1C08A 4G7YH 3OG6B 2AP2A 4PB9H 2R8SL 4Z7VE 2YS4A 1NBYB 2ADJA 2AEQH 2MQ3A 2NY1C 4WEMB 5I74B 5HVHB 5IHZB 4OZIE 4HUWB 4AK1A 1KXVC 1XF5B 5IBUG 3B3IB 4LMQI 1LP9A 4KQ4L 4X8XA 1HWGB 5E9DD 3MNVB 1ORSA 3TBTA 2EO9A 1J11A 4YXLL 3K1KC 4FNLL 1I75A 3DIFB 2X6MA 1I7ZA 4TSBH 4Y16B 2X40A 4NKMA 4PIRF 2F53B 1T1YA 3FB7B 5IF0B 1FGNL 3KS0H 4PRNB 4MB3A 2R0ZH 5GRJL 1TZIB 1W0YT 1F6AB 4XC1H 4CW1B 4N0UB 2NY1D 1IGIL 1UB6A 2XACC 5EZLB 1KIUA 1IT9H 2WP3O 32C2B 4OCXH 5D5ME 3ARDD 3LQZB 4FQHA 1DANU 1T2XA 4KUCF 4C83B 5JHDB 4XCFL 2G5BB 3U6RA 1F4XL 3VXUB 5IJVA 4E41A 4HXAH 2HN7B 2HKHL 1UKTA 5E95B 3IGAB 3O6KH 4Y19E 3B2UC 5JOPD 4BFBD 3KLSA 4FQXA 4LSTH 1MJJB 3BZEB 4FFYL 4OIAA 4MNQB 4M1CD 4UQ2A 4AEEA 1UWGH 4JVUA 4Q9RH 3S37X 4WHCA 1QVOA 1MCOL 3OXRA 5IOPB 4OD1H 1BD2A 2V5MA 4YBQD 3B9KC 4AYFA 5J13B 4IDLA 3GUTB 3MLSH 4PJIF 3AUVA 3HR6A 1H3XA 4PB0H 3X12B 3W39B 3H9SE 5H35B 4WI5A 2B8OT 3O6FA 5IB3B 3UMTA 3DXAE 4D0BB 3BQUB 4UT6L 2XI9A 2V5SA 1FL3A 1CFQA 4PY7A 1IGFL 1PZUB 5CGYD 4J3UA 4XH2A 3U0TA 2ZCKL 2BNQB 1DN0B 3A6BH 1D5IH 4LBEB 1JHKH 4P2QE 5GS2D 5TE4H 3B2VH 1KJVA 1DQML 2F74A 5IKCB 1Z0MA 4ODWB 4GG6B 1XF4A 2VITA 5ESVB 1FIGH 2BDNH 5FECB 2CQVA 3RTQA 4PJAF 3EOBA 3C8DA 3HI6L 1NFIA 2NY5C 4I3RH 4P9HC 2D7OA 1I1YA 4LHUG 1ZEAH 4X80H 5DUMH 1V3KA 3MTRA 3EJZC 2DLFH 2DQCL 3TPUA 2CDEB 3MNZB 2VABA 1FVCA 5LWYL 4UUJB 1GAFH 2DQDH 3ZT7A 2AQ1A 3DO7B 3WN5B 4DEPC 2EDOA 5AZ2H 4Y4KC 4P2YA 4KDWA 1IC1A 1CLYH 1I4FA 1LO0H 1NGQL 4KK5C 3RIFF 3E6FB 1OQOA 5T1LD 1G7HA 3JTTA 4PJ8D 1EH9A 2DYPB 3UTOA 2J6EA 1HSAA 3ZE1E 3S98A 2LTQC 1Y6MR 4F9PA 1NFKA 1KCVL 2FX8H 1EFXB 2B5IC 2V6HA 3ILPA 2EXWD 2NY4B 3VGAB 4QCIB 5EOTA 4MJ6A 3IETB 1JUFB 4NQSB 5I1IH 3P2TA 5DURD 5IT2H 4ETQA 5D1ZA 2WUCL 1U8IA 4JCMA 1IM9B 3S8WA 1Y0LA 1BF2A 4GFTB 5C0GB 1M6OB 1Q0XH 1I7ZB 3D6GA 5HI4D 3KLHD 3J8F7 4QHKI 1KXQE 2JCCE 3OKLA 5I2IB 4OM1L 1M05A 3N50A 4K23L 3HE7A 2Y5EA 4QOKE 2F53E 5F71A 4E42B 1RUPL 1ZGLB 1ZHBA 1ZMYA 3UJJH 4G43A 4QGTA 4TPRL 1A1NB 2HN7A 3SDYH 1F00I 3O6FC 3I6LE 2BY2A 5IBLC 1IGYA 1RI8A 1YUHA 1CD1A 2LAAA 3JUZA 1A7OH 3ZE0E 4M7KL 1U3ZA 1NBQA 1QYGL 1T83A 3UTTD 1BF8A 5ANMB 2GT9B 2ED9A 2D7NA 1OCWH 3MLXH 4LKCB 3DBXA 1FNGA 5DC0A 1R5VB 2YPLB 2VR4A 2ZCHH 3IJHA 4ONFL 5M95B 3PWPA 4MZ3A 4LCYB 4X6CA 4ZDHA 1H8NA 3U83A 3ULVC 3S97C 1RZ8B 3TESA 3H9SB 1U8JB 3V5DA 1NUFA 1EEZB 4U2ZA 1RZIA 3QJFA 4X5WA 3BO8B 2AK1L 3L3HA 4O58L 2R56L 3AREA 1T7YA 5TE7L 3DI2B 4MAYB 2BNQE 1AO7A 4IOIB 1CGVA 1QHOA 3KPRD 3BP4B 1T21B 5EIIB 2O93L 3TO4B 2G75B 4PLNC 3EAKA 5JXAH 3MV11 4AIOA 1GCFA 4XGZA 3VXOA 2DMKA 4JRXD 3HNSL 4PY8J 2APBA 3KNBB 5GSRA 3OAZH 4M48L 3VXPA 2APTA 3FB6B 1NGPL 2GITA 5GGTL 1FVEB 4Y4FC 5SWZA 5KJRL 1P1ZA 1HXMB