2CK0L

Anti-anti-idiotypic antibody against human angiotensin ii, complex with a synthetic cyclic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSPKLLIYWASTRGSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in Complex with Fab131: Making Angiotensin II Analogs
rcsb
molecule tags Immunoglobulin
molecule keywords PROTEIN (IMMUNOGLOBULIN; LIGHT CHAIN)
total genus 49
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ck0L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ck0L01
1K4DB 1RY7B 4K07A 1BQLL 1I8LC 5T1KA 3IFOA 3TCLA 1VACB 2VITB 3MOBH 4UQ2B 2C3GA 4QRRB 5IBTL 1BX2A 5FIEA 4JFEE 2B0SH 4I3SL 2DQDL 3FT3B 5GGVL 3C5ZC 5IUSA 1F8TH 1AH1A 2D3VA 4LPVA 1LQSR 2BSED 2MSPA 3RA7H 1EZVX 4P5KB 4UT6H 4FQIH 2P24B 3RZCD 1G7MB 4YDVA 2EE2A 3MJ7A 4MJ2A 1Z5LB 2CUMA 5F7DB 2X9WA 3C60D 1CU4H 3MV9A 3L3HA 1EERB 3SDDB 4PJHA 3IJSA 3T0EA 4RAHA 4LLVA 5DSCA 4M7ZB 3K46A 1MI5E 1W8NA 4H1LH 4OF8A 3OJVC 4XNUL 4S10A 1ZLWH 3BKCL 4KXZI 3F7VB 1J05B 1U8QB 2F5AL 5I1GL 1HZHL 4OJFH 1S5IL 3DO7A 1J0HA 5HJ3B 2Y7QA 4NWUL 2VLKD 1UJTA 5FYLH 1GL4B 2AQ1A 4MB3A 1HI6B 2F74B 2UVEA 4PJFA 4QY8A 3GSNL 3K7UA 1QLFB 5T1LB 1IM3B 2AI0L 3JWOL 3FTGA 1S3KL 2ATKB 2A6KB 5EIIB 1ZLVH 4Q97A 3QEQA 5F7MC 1AD9B 2QQLL 3W9EA 4JQVA 1G7JB 4H88H 1YY8A 4U2ZA 3OR6B 1CICB 2IJ0C 5IB3B 4XNZC 2F19L 3DX6B 5HPOA 3OGCB 4ZDHA 4ZNCD 5IW1B 1FFQA 4JZJA 4P3CH 4I0KA 4LDOB 3X17A 3PP4L 4HWEH 3D0LA 4EOWH 5C0RL 2FO4B 1WIUA 4OFKA 1PYWA 5DUBB 5H37H 5C0EA 2YD6A 4G6JL 1FRGH 2ZP0T 1AHWC 3DURA 3NZHL 1Q9WB 4TUOB 5HGDA 1FC2D 3VXNA 4TSAL 2DQTH 2VC2H 4ZYKA 3WXWL 2E9IA 3NPSB 5IW6B 4HFUL 4GXVL 5D71L 1U3HA 3GIVB 4NPYA 3FB5B 2XOTA 3PDOA 4Y2DA 1XZ0A 4H5SA 3NFSH 5MEPA 2VQ1B 4KKBC 3L3GA 1AFVL 2WIIA 3E6FB 3SE9L 2R69L 3HG1B 3AVEA 4ZSOA 3TVMC 3NBNA 5BQ7A 3DMMC 1I3GH 3OKMA 4F7PB 5HVHB 3ULVC 4CDHA 4IM8A 3TBYB 1FV1A 4OLYH 1SJXA 3MGOA 4FQQB 4IRJB 4XHQA 1J9CT 4O02H 4S0TD 3F7YA 2DQFA 3VH8G 2Z31A 1S7UA 5IV2A 5F1IB 5KOVC 1HI6A 2XNAB 3Q6GL 2BVQA 3BDYH 3RY5A 3VD9A 1P2CA 1F4WH 1T0NA 4A6YA 2H9GB 5EU5B 1AO7B 4GOSA 3QUYD 4DOHE 3BN9C 5IEKB 3C2SA 3EBAA 3MRQA 1TMCB 4OM0H 1RURL 4ZOBA 5GS1C 5I18L 1OPGH 5IFJB 4XP9H 3UBXI 2BNQE 2Z8VC 2R2CA 4MQXD 4OKDA 4P2QA 3GK8L 4JQIH 4NN5C 1HH6B 1YNLH 1SJVA 3ES6A 3BIBX 3CJJA 4HS6A 5SWSE 1KSRA 4L5FH 3NABH 3KWWA 5I71C 4NQDE 4NOFA 1MAJA 1EEUA 4XB7A 4WTZA 1KJ2A 2VXTL 3GMOB 3MGTB 2W9DH 2CO7B 4GJTB 3VI4F 3E3QC 3VDCA 5JUEL 2V5SA 4F7CB 3LSOA 1A02N 1FZKB 5T1LA 3IFOB 2NX5D 4KRLB 3V4PH 3NCJL 2VDLL 1IILE 2JCCE 3EHBC 5FGCE 2DMKA 1A9EB 2ZNWA 1V7NH 4DN3H 5A2JH 3B8SA 3PWLB 4UINL 1ORSA 4KDWA 1JPST 3ZHDA 3KYMA 2VLKE 1RU9L 2HWZH 4IEFB 4PJAA 3O3EA 1QUNA 4HEME 3Q6FB 5CEZH 4Y8DC 5GGTA 4P5TA 3DUSA 4H1LG 5LWYL 1QD0A 5FXCH 1T80A 3MRJA 3QXVA 4JR9L 4TVPL 4HBQA 5DC4B 3MJ9H 3O6KH 4JVUA 5I19L 1DQDH 3W81A 1OTUC 1BGXL 4ODSH 5IF0B 4F57H 1IGJA 4PJDE 4URTB 1B2WL 3U9UB 3LEVH 3VRIA 5F9DC 4WFHE 4YHZL 3EGSB 1SBSL 5M94B 4EDWL 1NCDH 5FUZH 2A9NH 3QCTH 3U79A 4N0UE 2DS4A 4L9LB 1CT8B 5E4IA 3BP7A 3GKWL 3H3KA 2COQA 3DVGA 1GGCH 3BKCH 1EEYB 5DT1L 4XWGL 1SVZA 4GMSL 3FOMA 4YEFA 5D1XA 3HG1E 2DLEA 2E9JA 4WDIA 5I8CB 2X09A 2XY2A 5I1JL 2E8YA 1UFUA 1DN2A 3UTQB 5C08E 3BQUA 3GSNH 2MPAL 3RX5A 1ROWA 4KROB 4J3XA 3IB4A 1ZA6B 3JWOH 4B0MM 1HHHB 3QISA 2ENYA 5IOPA 2EDNA 5FV1L 1NFDF 1ZSDA 5F7KC 5TFSL 3BZ4A 2CLRA 3U0WL 4NKIL 5F44A 5F7FA 1C8PA 1CL7I 4BKLB 5JQ6H 1I9RH 3THMH 2NX5B 3MZTA 3ZKXC 3UTQA 3AY4A 4JPWH 2NXZB 4PRHA 1HHJB 1H9VA 1I1YA 3OG6B 2PTVA 2ZUQB 4XBEH 5I74C 4CVXB 5CIPH 5IB2B 1SEQH 4PJ8B 1PKQB 4M61A 5E24E 5DD0L 1XGPA 2CO6B 4Z7UB 5HVHC 4NKDB 2H1PH 1S78C 3DV6B 2A73A 4OLUH 4LVEA 3WCYA 3BUYA 1N2RB 1U36A 4G6JH 2AEQH 1G6RB 1KOAA 5C2UB 2N7AA 2RR3A 1P1ZA 1JWSB 3L3KB 1P6AB 4I0PA 1YNTB 3LCYA 1GGIL 2JLLA 2W38A 5D71H 5C09A 3A0OA 5HI4C 2J8UE 1QEWA 4M3KB 4ENED 4G80A 1XGPB 4PGDA 1A4JA 3L5IA 1G9NL 2R0LL 1RIVL 2AK1H 4PJBF 3DNKA 3I6KA 2WBJC 5L8KB 3EYOA 4Q0XH 1S8DB 3VFVA 1WWBX 4PJEF 1IC5L 1TENA 1X5ZA 3NCBB 1XGRB 4IHOB 4EVNA 5F9WC 1T1WB 4NQDD 1A14L 2JELH 4JKWA 5CFHA 4A6YB 5CKAA 2WINA 3KVQA 4PGCB 3VGAC 3SKNB 3ZKNC 1JK8A 5D1ZA 1DL7H 5EU4A 4E42A 2Y06H 3TYFA 2VLRD 2F54B 4KK8D 4EI5B 5L7XH 4FQXC 2H8PB 4G7VL 1QBMH 4KUCD 2C7UA 5JW3H 4U1IB 4M93C 4QXTA 3HG1A 1ORQA 4XP9L 3CFDA 4DN4H 1N5YH 2VQ1A 1HXYB 2DD8H 1M7DA 1TETH 3P0YL 1KENL 4H25B 4RAVB 4PRDA 1U3HB 1QTYT 2ZWLT 4Y4FC 4ZQKB 1D3CA 4K3EL 1UC6A 1YECH 4QO1A 4KI5F 2EDKA 5ID0B 1UA6L 1U41A 2D0HA 1MPAH 3DGGA 1YEKL 4IS6A 3U4EB 3FOLA 1QO3B 1SEBA 2NY0B 2ARJB 5GGQL 4BSVA 1TXKA 1I8IA 5EUKB 1EHXA 5IHUH 4GH7B 2GT9A 3KYNA 5T5NF 2APVA 1KPRB 4PJ5E 5C09D 1XGYH 3BP5A 1KF9B 5IIEA 3ARYA 4ALAL 4NO3B 2GSIB 4PJDB 4PJAB 3NGBC 1FZJB 5JDJA 5IV2B 3FB6A 4P3DA 1KJ2H 1JUFB 4IOIB 4XBGA 1BQSA 4HV8B 3MR9B 1VADA 4K3DH 3PNWB 4KI5C 1D9KD 3MA7A 3VXPA 1YEGH 1GC1C 4X5LA 3O4OC 5KVEH 1X44A 3C60C 1XCQB 4NRZB 4OAWB 3ALXA 4D0DB 4JCMA 4OCMC 5FM5O 5EZOL 4KJWC 4LCWA 2IFGA 4Y2DB 2UWEA 4D9LH 1A4KB 1YA5A 4I18C 4MJIA 1FH5L 5T1MA 3RPIA 2FDBP 1M4KA 5IW6A 1FG2A 4PRIA 2R2HA 4OZHF 3WYRA 2BFVL 2O5YH 4TUOA 1M05B 3IKCA 4EDWH 3F5WB 4DFIA 5MP6L 1J05A 3WNKA 2A9NL 5FYJH 3SDDD 3C9NB 4JO3H 4X6DB 4TNVF 5D4QA 1EK3A 3I9GL 1KJVA 4PUBL 5KSUB 5F3BB 4ERSL 3DUUB 2KKQA 1OAZH 1A1NB 1KCSH 4FQ1L 4KPHL 4F7MB 3MOAL 3B5TA 1AIFA 1I1AA 4JCLA 2EEAA 4JO1L 4YAQA 3SQOL 1AR1D 3BW9A 1FFPB 1FORH 2AXGB 4W4NA 1ZGLM 5DFTA 1DCLA 2EDEA 1P5UA 2X70A 3QXWA 3RL1A 4OCXL 2CSPA 2UVFA 1CICA 4NQEA 1MCWM 1BEYL 1NGQL 1NEZG 2ZKHL 1PQZB 5BZDB 2ORBH 3FB8A 3OAYK 1S7UB 3UO1H 1DEEB 2N56A 4LCWB 5I1EL 2V5RA 1BOGA 2VB5A 1UZ8A 1YEJL 5GXBB 3IXAB 3BO8B 4NDMA 3D1MC 1IRAY 5D8JL 5CGMA 2VDQH 3LMJH 5DMKB 1D5BA 3V79C 1L7TL 4F2MB 4R2GB 5I1AB 3VWKC 1IKNC 3MRHB 2QBWA 3HI5L 3GSOB 4JPIA 4J3UA 2M8XA 5FHBL 1SEQL 1IGIL 4ODHL 4D0BB 4K71C 1CDCA 2CKBA 2F5BL 3PDOB 2CRYA 2WBWB 2ZOLA 3QO0B 4JB9H 4O51A 1GPOL 4OTXH 3O6LL 3IGAA 4QYOA 1CICD 5IM7B 1A6ZB 3LB6D 2BVTA 3MFFA 5C0DB 4R4ND 2ATPA 1E6OL 3WLBB 4NGHH 5I17A 4PJAE 1MLCA 1KTRL 4X9IA 3OXSB 4HIHB 5SX4H 3QUZB 3SDXF 1BVLA 2CIKB 1NFDE 1CF8H 4HF5H 4YUEH 4B41A 1P7KA 4YHML 3NTCL 3FQNB 5DO2D 2GY5A 2I9TB 5GRYA 3MLPA 1GHFH 5DRWA 3A67H 3MGOB 4JFEB 3S7GA 3PWJB 3LVEA 4TULL 2LAAA 4KZDL 1C16B 1E4WL 3MMEA 4IOSD 1OAYH 1DLFH 3O8XA 2K3TA 4LVNB 1TVDA 5C08D 3VFUA 4B7IA 2EDRA 4YH6A 3QIWD 1P7KB 1SYSA 3SE8L 3EYSL 3V52H 3BZFB 4YK4B 4OUUB 4U1LB 4JKPL 1JGUH 3RZCB 5KSBB 1YEDB 5JW3L 35C8L 1KT2A 2ZCHL 2I24N 1LDPH 3QXTA 5FGRA 3T65B 2FNBA 2QKIB 4EDXB 1CD8A 1KNOB 4YHKH 4BSVB 3WIFA 5E00A 4H8WC 5GISH 2M2DA 4P2OB 3UXFA 1YMME 3HLAA 3UTTD 2X89A 3WE6B 2BXYA 5LAXB 1FO0H 1H3VA 2BX5A 1MRDH 3QT2A 4AY0A 1PSKL 2JB6A 3VFUB 3PIQA 2W07A 4JN2A 5C0IB 1I3VA 5E6IC 3EYFB 2IAMD 3DXAA 1RVFL 3C5JB 5BXFA 3LHPL 5J4MA 1HXMA 5TE6H 3CSYA 4O00A 1LO3H 3SGEI 1OW0A 1FE8H 3FMGH 3ZKSD 1G1CA 4OLZL 3NFNB 1KJ2L 4OIIH 3H6JA 3SJVA 1EFXD 1RZJC 1JGVL 1P4IH 4JZJC 2GKIA 4LPYA 4KY1H 1S7WA 4H26B 4K3DL 1KTLA 5T3XE 4PIRF 1ZGLP 3P77B 2Z93A 4FQLL 1K8IA 3DO7B 3U4BL 2GCYB 4JM2D 4L9LC 4GLRI 4JFZL 2BVOA 2XQBH 5DDHB 5I1IL 2O5ZL 3CLFL 4EI6A 1NEZA 5AD0A 1FH5H 2AGJH 1IFHL 1S7VB 4WUKH 4ELKA 1HKFA 4O51B 4PTUB 4HDIB 4XAKE 5FUOH 3PJSA 4Q6IC 3CLEH 2NXYD 1N0LA 4NNXA 1A47A 1KG0A 5H2BA 3FN9A 1CL7L 2AVGA 4ZS6D 5I8EB 3AM8A 1GZPB 2R4SL 4WEBL 5IK3B 2ESVA 5KS9B 2EZ0D 8FABA 1K85A 1OAZL 1H15B 2OR9H 1PEWA 1NAKL 3LS5L 4HFWA 3SJVE 1X6NA 3A6BH 1CFNA 1FORL 2OJZL 1JGLH 1CGTA 3NFPB 5EU6A 3UBXA 4OCXH 4MD0A 4G5ZL 4PJCB 3O2VL 4Q2ZB 4EI5C 5DA4A 1DJSA 1IEAB 4JFED 4KJYB 2JKXA 4QRPE 3UROR 5MHSE 4LSVH 2D0GA 2B2XL 1TZGH 1Y6KR 3WUZA 2XXCB 1Q9OB 4NOBA 5EC1A 3DOSA 4K8RC 4AG4H 5ICYB 43C9B 2WMPA 1E4XI 3S5LG 4DK6A 3HAEB 4QHUB 1S9KC 4HAFA 1BQLH 1WWAX 4I13B 5GRWA 3N06B 2X9YA 1JFQH 3OAZK 5L2KE 4OZGB 5AZEH 3I85A 1RZFL 1RZJL 1EFQA 1CDGA 5EO9B 1R5IB 1KIQB 1GC1L 4KQ3H 2NW3A 3OHXB 5DQ9B 4GG6B 1R0AL 1I7ZA 3PV7A 3UDWA 3HZYB 4PRDB 5LBSL 1CN4A 3P9LB 1VENA 1HHIA 2LVEA 1MIMH 4UB0H 3HFML 4IMLB 3ME0A 3T2NL 2HT4D 4X5XA 3SDYL 1BOYA 4PREA 4MVBC 3KHQA 4E41D 3UZEA 1VFAA 1JJUA 1WK0A 3AB0B 3MV8E 4MAYB 2JTDA 5I8OH 1HH9A 1CF8L 1FIEA 4XBGB 1W72B 2XXMB 5CHNA 4LASL 1PG7X 3NTCH 3QULA 4HX1A 1DBJH 5BV7C 2F53A 1PW3A 1A6TB 1J12A 3BEWB 2AI0H 4PBXA 5EIVA 4NCDA 1S7SA 1IBGH 2E7HA 3IAPA 4N8VA 4EVNB 2OJEB 5K9JL 3WLWC 5EWIH 3HUJA 2VR4A 4HEPG 5CP7B 2WP3T 4CUCA 3NIDE 4G8EA 2FATL 3P4NB 3LKNA 1V7MH 4LQ1A 4I4WA 2DQIH 3CFKB 4OF5A 4JFFA 1U8PA 3LSOB 3PQYD 4HW6A 2X41A 5DJZA 4OCWL 3VE0B 4PREB 1TQBB 2AXFB 2D2OA 4Z7VF 5EOQL 4EOWL 4JQXC 5C0RH 4PGBB 4P2RB 3ALPA 2Y4SA 2DN7A 2YKLL 4JHBA 5BVPH 2AAVA 1FRGL 1I3RB 2Q20A 1U2HA 15C8L 5I1HH 3U7YL 3ULUC 4HK3N 2ZOKB 1C5DA 3CH1B 2Z92B 5LGHH 4K7PY 2A1WH 4PJIF 4XAKD 3FFDB 3NAAH 4GW1A 4R4FH 3HZVB 1IAIL 1CD1A 3RDTC 3KG5A 3O4OB 4XP6H 4S2SB 3TA3B 5FOBA 4ZS7L 1QFWM 5TE6L 1I3UA 3ZKND 4P2QD 4YIQB 3SCMB 2QKIA 2EXWD 5JNYA 4R3SB 3FMGL 1S5HA 5TQ2L 4JY4B 4NQXA 4CJ0A 4AIZA 1KEMH 3MUGA 3VXSE 1ZA6A 2H32A 3AREB 2NY0D 1QOKA 4ESKA 2ARJQ 1OCWH 3DROB 3KPRB 4M00A 3WFHA 1DANT 1FDLL 3DJ9A 1JPGB 4ELMB 4XNYH 2O5XL 3U46A 4POZC 3W9EB 4HGKC 4QRPD 4Y5VA 2RIKA 4G3YL 5F7LB 3ARVA 1QFUH 4N0CC 1YJDL 3DXAB 3HB3D 4RQQB 3O3AB 5FUOL 1DDHB 1FNAA 3KPPB 5ALBH 4YO0B 3P9LA 1UKSA 1H15A 2XTJE 4M4PA 3VA2C 5FO9A 2BSRB 2DTMH 2H2SD 3IFPB 4JRXA 3TEUA 2YD9A 4G6FB 4FABH 1YNLL 4Z7UF 2F54D 3P4OB 1LO0L 2CLVA 2VLRB 2FZ3A 4QRSA 5C0AD 4U0RC 4NRXB 5EH1A 5D72H 1T5WB 3MUZ1 4GXUM 3STLA 1GZQA 4I0CC 6FABH 5J6HA 4CN6A 3WIIH 1MCQA 1AHWA 4LSSL 1B3JA 4DGVL 2OCFD 2YPLB 1NC4A 4GAGL 2IQ9H 5MENE 1I9JL 3PUCA 3QCVL 3RHWK 1HOCA 5SWQA 1MJJA 3W5NA 5D7JC 5D5MF 3LZFH 25C8H 2PF6A 2B4CC 2J2ZA 3RNQA 1KB5L 2MMXA 1YY9C 1Y0LB 2NY7H 3SKJL 5GGRA 3AMLA 3O3BA 3MRNA 2VJXA 5ANMA 3RFZC 1NMCB 1RU9H 2H2PC 5CKGA 4U33A 3PGCB 4Y1AD 2C26A 3DMMB 1U92A 4XHJD 1JV5A 2ID5A 2O61A 3RVWD 5DUMH 7CGTA 4IRJC 4UTBL 4NM4L 1N59B 3HI1B 4KQ3L 3VXRB 5MEOB 3K4DA 5L2KD 3QDME 4LDLB 3QJHA 3P9MA 1JRHL 5I19H 7FABH 3GMNB 3QCUL 3QQ9D 3ZO0A 1J5OL 5HGBB 3ZHKA 1XF4B 1P9MA 4NQCB 1MFBH 4I2XE 1A6ZA 5DRNA 4R8WH 2ED9A 3SE3A 3HNSL 1WFTA 5D7SH 4DKAA 4KTDH 2XKNA 1P84K 1D9KA 2NX5E 4YHYB 4YHNB 2JIXD 2F8OA 3GMNA 3O6FC 4YWGL 4PRAB 4ZOAA 4JPIB 2IG2L 1G7PA 1KYOK 3GSWA 3PF2A 4H26A 1QLEH 4ZODA 3SJVD 1J0JA 3KPRE 4JJHA 5HY9B 1AJ7H 4LP5A 5D1QB 4NUGH 1OAXL 4ZUWA 4Q9RL 3ARBA 4NYLB 5TFSH 3V0VB 3EO0B 2FHCA 1D5MB 2HP4A 3PWPA 1JTPA 3OV6A 5FYKD 2HLAA 3OKOB 1NFKA 3KJ6H 4M8VA 5IHLB 4ZMAT 1E0OB 5HD8D 3THML 1F58H 1KIPA 3FO1A 5TQ0H 5E9DA 3G5VB 5DI8B 5I2IB 1KN4L 3D39D 3IDNA 4X7TB 4CGTA 5J7CC 4XNXH 3QFJB 2B5IB 3HPLA 5E6YA 3KLDA 3TA3C 4HWBA 4MXVF 4OCWH 4ZUUA 3MRIA 4F7MA 4OUOA 4P2CG 5DHXB 5GGSY 3D6GA 2X4SB 3T8XA 3AU1B 5C92A 3C6LD 5T3ZH 5JW4Q 1X5GA 3RX8A 4HJ0C 4FS0A 3KYKL 3PXJA 3SGKC 5DFVC 2I27N 3KXFB 1F4YL 3T3ME 3HZVA 1DSFL 2V7NB 4ODBD 3OL2A 2FJFA 4JZJB 2DQHH 1MCLA 2VR5A 5E5UB 4JQVC 4L8SB 2NR6C 2X4TA 1DUZB 2R0WH 4YO0A 3ULUE 5DD6A 3VXUB 1IAIH 1NMBH 3IDNB 2EXYD 3BP6B 5ISZA 4D3CL 5BO1H 5FKPB 1A7NH 2YXFA 5E94B 5E2TL 3B2VL 3HE7D 3EYVB 3WUWA 4PJ9A 1F90L 1IC5H 2LAGB 4JFPA 3ROOA 2E3VA 5D7IA 4LVOC 3UMTA 3PL6B 1KCUH 4G8FB 4OB5L 3H7BB 1J1XH 1I1CA 1QFWL 5J13C 4HKZB 1C5BL 1OCWL 4APQA 5GJSH 3QIUB 4XTRD 1U3ZA 5LQBL 1V3KA 2EIZA 3EIFA 1DL7L 3WD5H 3OR7A 6CGTA 3BZEA 4Z7QE 5JDSB 1H5BA 3S97C 4EXPX 3VFMB 3P4MB 3L7FB 1DBAH 1FNLA 2X70B 2D7TL 1LP9B 3G6JF 1K8DA 3DVNB 1BBJA 4S2SA 2ZJSL 1B6DA 3MLTB 4LPWA 5DHVB 2PXYD 5I76B 3VXQB 4JN1L 1ETZB 1Q0XH 4RFOL 1PX3A 2VIRB 5DRZB 2VLJA 4M62L 4DW2H 4AM0A 3QDMD 4FQ2H 5J9PB 5F9OL 4XMPH 2CJUL 4RMQA 3BPCA 1EEZA 4PRIB 2XTJD 4EI5D 2K7QA 4ODWB 1PJ9A 1MPAL 3ULVE 4HS3B 5DJCA 4MD5A 1Q9LB 1S9YB 2CLZA 3EAKA 5C0AE 4WW1A 1QP1A 4QHKI 2IQ9L 3L5JA 3CFKA 3K8LA 3UCRA 2NZ9C 1XGYL 4Y4HD 4YXLL 4X0KA 1I9JH 3X3FH 5IEHA 5FAAA 3UC0L 3CVHB 4OT1H 1JWMB 5JPMB 1KIQA 2VZ3A 4MJ4A 3RKPA 3HI6L 3M8OL 3IDJA 4RDQG 1KB5H 5IROA 2FCBA 3V6OE 4IOIA 1GOFA 1TFHA 1VKXA 4HUXB 4KUCF 2AK4A 2DKSA 1L6ZA 1BQHB 5FOJA 4D2NA 3WN5A 4F33A 1K5NB 3WN5B 4YHOL 1LK3L 5F6HI 5J1SC 3FONA 5CSZB 3BPNB 4PJ5A 1QPPA 1RJLA 4FHBD 5DEFB 5HHPB 5C0GA 4DTGH 4X8JB 4Z7NE 2W0PA 1WF5A 3VWJC 3EOAA 5DD1H 5I66B 1ONQA 2UUDH 2UZIL 2D7MA 4OZGE 2D03H 4W6WB 1FG2B 4QHNA 2CIIA 2VXSL 3N9GL 2AJVL 1Q0YH 2B1AL 4NSKA 4ONOA 4QXGL 5HYJE 2UZYB 2BNUA 2AJSL 4BFEA 4N0UB 1CFNB 3DV6A 4MA3B 5BCAA 5F1KC 5C8JB 2NY1D 3SKOA 1UCBL 1AY1H 1YEHH 4YDKL 1HHIB 5EO1B 4RBPH 2A9ML 5IQ9B 3PABB 4ETQA 5B21A 3MLYL 4JO1H 5EA0L 5CZKA 4N68A 1HDMB 4JM2F 1A6WL 3W2DH 1X6LA 2C1OA 5ESAB 1BFSA 3RTQC 1NBYB 1CFQB 4ONGH 4D0CB 2DKMA 5J06A 2R1WB 1ZLSL 2EIDA 3DBXA 5EOCL 3VXQA 3O4LE 2F9BT 3QUXD 2BVOB 2LTQC 1T6WA 1ZSDB 5I1EH 1TJGH 3MYJB 4FQCH 4WW2B 2P47B 2HT3C 3LAFA 3VGEA 5EZIL 2J5LB 5TQ0L 3VFMA 5KVGH 2GTWB 4QRUB 2C1OB 5JXAL 1KTLB 4NHUA 1I1FB 2A6IA 5ITFB 1NFDB 3E8UL 4JY6B 4KQ4L 3P11L 4ACPA 3WNLA 2OZ4H 1YPZF 4M1CC 4ODHH 3NCYS 1R24A 3PWNB 3QG7H 4NN5B 4P99A 5ITBL 3J8F7 3I50L 4U6VL 4YNYB 5E8OA 5C09E 2W1NA 4ZAKB 5DF0A 1LE5A 2YD5A 3H3PH 2EO9A 4HK0B 2YBRA 1G6RA 3H42L 4UOW1 3U9UA 3VRIB 5BW7A 3CFBB 2ARWA 5JOEA 3MV7B 3K2MC 4RIRB 4K2UL 5HPMB 4UOW0 5KSBE 3R1GH 4U7SA 4NQSA 2Y07H 2VDKH 4J8RA 4M61B 4U0QB 3D48R 5EUOB 5JHLH 1NEZB 3JV5A 1NDGB 3FONB 1OSZA 4BQCA 3P30L 4R96A 5EPMB 1EAPA 3MRCA 5HHMD 1DQMH 1I1AC 2H26A 3TYGH 4PD4K 4ETYA 3NH7L 3OAZH 4Z76B 1EHLH 5C6PB 1EGJL 4LAQL 3ZTJH 4PLJC 3ULVD 1QFWH 2BDNH 1CLZL 4YLQT 4ZUUB 1CI5A 2X4PA 3UDWC 5HHOD 4WI8A 3BDYL 1RJZB 4PB0H 3MXVH 1BD2E 4LHQB 2C3HA 3IJHB 3WLWD 3Q0HA 4LLYB 1S9WB 2Q7NA 3GBML 4TSBL 1OAUH 2V5TA 5TDPA 3DTXB 5SX4I 4MHHI 4OCSH 2BOCA 1IEAA 3O45B 3DIFA 5I18H 4ZOCA 3KPNB 3GBNL 2AEIT 3VXRE 3SKUD 3WUWB 1MWAH 4KAQH 4U3XA 3D39E 1FYTE 5CBAA 4NZTL 3FRPA 5IFAL 5EUOE 3QUYA 3DX8A 4PP2A 1N7ML 5B4MC 4CW1B 2VL4A 4TRPL 3QEUA 3ELAT 3VXSA 4OV6F 1YZZA 2MQ3A 3D2UB 1MVUA 3PV6A 2VDMH 4GG6F 1RIHH 4JGMA 2OP4H 2BK8A 1AQKL 5HYQA 4OQTA 3VDBA 3MCKB 3H0TA 5EN2B 1EMTL 3M45A 4WIQA 3FAXA 1T03L 3LQZB 5JXEA 5T3ZD 2NTFA 3VWKA 3L5XH 2RB8A 1J1OL 4MMXC 3LEXA 3RDTD 3ULVF 3JTSA 3Q6FA 1U8KA 1XGUB 3BPOC 2F58H 4FTVB 3FO9B 3ZE2E 1T20A 4XXCC 3V5KA 1IVLA 4QRTA 4KKCD 4Y4FA 1OTSD 3SDAA 5JZ7D 4CKVX 3WHXA 5HI5D 1SJEA 3LKRB 4X5WA 4PJEB 1T3FB 1YMMD 3O41A 2XYCA 4TVPH 1QBLH 1KB5A 3BGMB 4U1MA 1AGCA 3HR6A 2XQBL 2LU4A 3FB8B 5FHAL 1JE6A 1AKJB 1BFOB 4A6YH 4FQXA 4HIXL 4MDIA 4P9HL 1G7PB 1UM5L 3ARQA 4NZUH 1KUMA 1KCLA 1DFBL 1OP5H 5CJQH 4QTIH 4Z0BH 4PFEA 2R4SH 4PPTA 1DLHA 3GSUB 4Z5RB 4DVRL 1CVRA 2LE9A 3C5ZB 2DQEH 5JO5B 4JM4H 4ISVB 1FNEB 4L4VA 4LRNL 1U8IA 3QEHB 2P5EA 4S1QL 4HWNA 2Q8AH 4GLRH 4Y5YB 4LNRB 5E9DB 4O02L 5I2IA 3SPVB 1LO4L 5EO0B 3C6LA 5HDOA 3S9DB 4PJIB 3G5YA 3GSVA 3EOTL 1EAJA 5CEYA 1AD9A 5C08A 5E2WH 2PW2B 3PDDA 5CWSA 5J12C 5TJWK 1K3IA 2WLYA 3CMOL 1B9ZA 4U1MB 3GI9H 1MLBB 3U0WH 5BJTB 4QRRA 4RQQA 2AXJA 3FQUB 1H8SA 1YQVH 2YSSA 2NYYD 5EZIH 1DBKL 5FA4B 1CXIA 2FD6L 2DL2A 2W65A 4ZD3L 4HGWB 1D5ZB 3PNWA 1ZHBA 3BSZH 3CIQA 4L8BA 4HUKB 3E8UH 5HDQH 3QAZB 3QG7L 4NKOB 2P1YA 2ZG3A 2GSIA 4PJDA 4GS7C 4QOKD 1ND0A 4UDTB 4LHUG 2AJUH 4JY4A 5GGTH 1BD2D 3WJJC 3HLAB 2WUCL 4R0LA 1ZK9A 3VDAA 5I30H 4UT9H 4QXWA 4R2GC 3BVNB 5MHSD 3T0DA 2OZ4A 1E4XH 4OZFH 3L9RB 3EKCA 1IJ9A 4QLRA 5JUEH 2IC2A 3PG2A 3SDYH 1OD7A 4IRSD 3U7WH 3EDEA 2H9GA 5EU5A 3TFKD 5EBMB 1FYTD 1TCMA 3MRFB 1T4KA 3KJ4B 4M48H 4Y1AA 4XC1H 5KW9H 1RULH 2EDXA 1T1XA 4WFHD 2VKWA 2HFFB 3QFJA 1T0PB 4ENEC 1CXEA 3H7BA 4YGVB 3F7YB 4GBXA 2FR4A 3OR6A 4D94A 4ZO8A 2ADJB 4JG1H 1GGBL 5DJ0A 4R7NA 4OGXH 5TF1L 5C3LD 1HXMB 3B4NA 5ESVA 5ESVB 4MLSA 4NBYB 5JMOC 4ZSOB 1C7TA 2I9TA 3P9WB 4BK4A 5ETUB 2X4UA 2J7LA 5D5MB 3MUGB 3RWJA 4K94H 1DUZA 4NQCD 4PB9H 2CDEA 3K80A 2GIYA 4H20H 3ESVF 1JPFA 4RGNB 3C2AL 1BIIA 3QCTL 1B90A 4PGZA 4QRSB 2DD8L 1MQKL 5L2KA 3GB7A 4ZOEA 3H0TB 4N0RA 2EO1A 4Z95H 1G7QA 4HLZH 1NDGA 3WDHA 1GAFH 4AEEA 1YEDA 1ZE3C 3DMMD 1OVZA 1A7PL 1WWCA 3OTTA 4K3EH 4OUUA 3K0WA 1HINL 3I6LE 3RZCC 3T4YA 4JAMA 4XBPA 3DX6A 2HT4C 1FLRH 5GGQH 1N59A 3HI1A 1DE4A 3VXRA 5MEOA 1SY6A 5F7HA 2HLAB 4ZS7H 4LRIC 4WWKA 1UJ3A 1T04A 3TN0C 4OQTH 4BH7A 1SYVB 1A2YA 3S35X 4ZUWB 1UACH 3UTSB 4D0DA 3T3MF 4KZEL 3D2UD 3S34L 4PJ8A 5IB4B 2X9XA 2FBJH 4NQTA 1DEDA 3BD5A 4NC1C 3T2PA 2C9AA 1UWGH 3S98A 1RFDH 4KDTA 3ARRA 4F7TB 1MLCB 1U6AL 2VWEE 1JHLH 1A64A 2XWTA 3T0EE 5JR1L 2BOBB 1NBZB 5D7LA 1QBLL 1EHAA 4W68A 5T5FL 2VH5L 3RIFK 5HHOE 3A6CH 2WWMC 1FZMA 3RKDC 4HSQA 1JPSL 1P4BL 3GHBH 3RNKA 5IBUB 4XHJC 3SE4C 4OCRL 3X11B 3K3QA 2JK5A 1FFNB 4DCQA 3AS0A 4D9QE 1RIVH 2AK1L 1NANH 1KCSL 4FQ1H 3IVKB 3PGFL 4KMTL 1S7RA 2I25N 1U8LB 5D9SB 3MLSH 5F72S 4ODVH 1NGXB 1HXYA 5EBGA 4RMWA 1BOGB 3QEQE 4JVWA 5AG9A 1T3FA 1KCRH 3HZYA 4KI1A 3W0WA 4NM8L 4D8PB 5DWUL 4GAGH 5KG9B 3JWOC 4DUVA 1ZA3A 3QCVH 4KC3B 1HOCB 5SWQB 1F3JA 3BIAX 1VGKB 2DWEA 1JVKA 5T3ZE 5IJVA 5JOPE 4NFCA 2NY7L 3UP1A 4PJCF 1ZGLA 4G9FB 4MS8D 1L7TH 1HHHA 5IOPB 4JG0H 1DBMH 3DUUA 4YXHH 4WY7H 3TT3H 2OS7A 3KPSA 5DVNA 4L3EA 3TZVD 5IR1A 4X6EB 4QCIA 1LO2L 5FHBH 1Z3GH 1W8OA 3ARDA 4X6CF 4U6YA 2R2HB 1N3NA 2FHFA 4PS4L 2R1YB 3DRTA 3CNKA 3O6LH 2DYPA 1GGUA 1LP9F 2Q87A 3SKOB 1IC4L 1YEKH 2YA1A 5J89A 4IJ3B 5E6IB 1XEDA 1SMOA 2OQJA 3UX9B 4OZIF 4NGHL 3U36B 3VXSD 3OAUH 2IANA 2NY0C 5IROC 5JXED 5JA9A 1HQRA 3BPCB 3TO4C 5KW9L 2E7LA 3CK0H 1F11B 2P43B 5L8LB 32C2B 3H9SD 1G9ML 4FG6D 4JG1L 4MXWH 1D6EB 4OGXL 4PRHB 5TF1H 5DURB 1BPVA 2BRRL 3DPBA 4S1RH 5AAWA 3TO4A 1LHZA 4UDUB 3AB0C 4MAYC 1OGTB 1Q9OA 3V6OA 4KK9D 4NC2B 4WEMB 3IDJB 1AI1L 4JRYB 1FPTH 2GJ6A 2ICWJ 3T04D 4H88L 3CGTA 1BVKB 3DBXB 5INCA 1T21B 3ARGC 3L1OL 1OLLA 2H2PD 5FYKU 4PP1C 4JKPH 4PGDB 4HJJH 5IGXL 4FQHA 5FGBC 4GKSB 3O8XD 4DGYL 4FFWD 1ZTXL 1YNKH 4LFHG 1HQRB 5IW3A 2DI8A 3GMOA 3MGTA 4PV9A 5GISL 4AZ8A 3WUWG 3LDBC 3KWWB 1E4KA 4WHTB 3KYKH 3UTPE 5K9OA 4K7PH 1T66D 1LK2A 5GSVB 4UOJA 3WSQL 3GM8A 3V2AR 4FMFA 1OP9A 3CZJA 1DTUA 4Z7VB 3KNBB 1R5IA 1LD9B 3UTTA 4M93B 4LDEB 3I6LD 3WFBL 1M1SA 4HUVB 1G9EA 4X8JA 5TDOA 4GMTL 3CVHL 1UXSA 2APXA 1NCUA 3WDIA 4YE4L 1T0NB 3V5DB 4UIMB 3O3DB 1Q94B 4U1KA 4RGOH 3KYAA 5IJVB 1WCBB 4GAFB 3ZT5A 1SY6H 3QR2A 4FXGA 4QRQA 3V0AC 3VCLA 4ORGB 2QSCH 4N0CD 4NJAL 2VYRE 2Z91A 2IGFH 2FX8L 3U4BH 4L8BB 5LQBH 5BVJB 3PHQB 2QR0A 4BJLA 3QA3B 1JF5A 1UB6A 2G9HA 2AQ2A 1F4WL 3KHOA 5E1HB 1T2JA 5C0ND 2V17L 4NYLA 3FHQA 1BF8A 2D7TH 2H2SC 2BNRA 4FZEL 5HYJD 1AD0A 4HXAH 2BXZA 5KSVB 4MA3A 3QDGD 1MFDL 4MNQD 1KJ2B 3H9HA 4HUUA 1Z2KA 2BC4A 5I1LB 1J10A 4KU1A 5EBMA 5FKAB 1IGTB 4MDJB 4KJQD 1F4AA 1T22A 1AR1C 3GJFA 2X2YA 5C70A 2WUBH 4XNQB 2VISB 4OKVB 5DTFB 4X98A 1SHMA 4F37F 1FNHA 1HK6A 1FNEA 4L4VB 2X4SA 4JHWL 5C86A 1JGLL 3F65A 4C54A 4MCYB 2OSLB 1OL0A 3GNMH 4MNGB 4ZTPL 2CRIA 4PLKC 3BZFA 1G7LB 5JPNB 2I07A 4KHXH 1CE1L 3TNNA 4B53A 1TZGL 3X3FL 3V4PL 1DVFA 5SWSB 4F7TA 1YY8B 4NC1E 3SE8H 1D5ZA 1D5BB 4R90L 4LMQI 2DQGL 5H94A 4IDLA 4Q9QH 1ZWIA 4FXKA 1TVHA 4ZFOB 2HWZL 3NFPA 4OAWA 1LDPL 5SWZE 4S11A 3BRDA 1DEEA 4YHKL 5CILL 3MLWL 5CJXA 3HR5A 3Q3GB 1A5FH 2VAAB 4ODUA 5ADOL 2C4FU 3GHEH 3K2UL 3HZMB 4DTGL 3ARBD 3BOVA 1JZ5A 3RUGF 5T3XD 1U8QA 4ZFGL 4XCCH 2R39A 2H41A 4R26H 1CFTA 3FQXA 5DO2C 4WTWA 5AZ2L 3CSGA 3N9GH 4GUPB 1EO8L 2Z9TA 3O4LA 3OAUL 3QO0A 3UTTE 3MLUL 3D5OF 1QRND 5DJYB 3EYUL 3MBEA 4M1DH 3HMXA 3WFZA 5ILTH 2DJ4A 5JZ7C 4HJGA 5I1JH 1JGVH 1VEMA 4G6MH 1LEKB 4LCIL 1CICC 1MWAB 2XIDA 4MXWL 2IH1A 4U1HB 3TVMA 2Z31B 2XICA 3O0RH 4G8FA 3RJQB 4X4YB 4KK6C 3BD4A 3IF1A 3ZLQC 3MV7E 2NY3D 2NZ9D 4JFPB 4Y4HC 1U3HC 4NZRH 2BOCB 4APQD 4BM7A 1Y18B 1JPGA 2YUWA 3WXVH 4ZPVA 1DBBL 5E95B 3VXRD 2IFFL 3T0AA 5C0IA 2IF7A 2J8OA 5ECJE 1JZ8A 1NEUA 1I8KB 1G7HB 2ICEB 3QHTC 3CLEL 3TH2T 1RJZA 5GS2D 2L0DA 1F45A 1WVZA 5DVOA 3KLHC 1NPUA 2BVPB 2W91A 3KS0J 4PJXE 3WE6A 3HAEG 4WEBH 2WBJD 1WBZA 4FFWC 4FQXD 3OKLA 2YKLH 5BVPL 4KDVA 2LU3A 4IS6B 5CJ8A 2B4CH 2VISA 4HLJA 4OKVA 4OLEA 4EDXA 4Y8AA 2OJZH 1TNNA 2Q76A 3D85B 4U1SA 2X6MA 1M6OB 3RAJL 1WWWX 2YPLD 1GGIH 4G5ZH 5F7EL 1HSBA 1CR9L 3P0VL 4ZPTA 5IESL 4FTVE 3NAAL 3BP4B 3JV0A 4M7ZC 3KPPA 1AGCB 1KB5B 5KSBF 5D2LF 3O4LD 5GRVL 3OJDA 3LD8B 1BIHA 3CPLB 5I74B 4R7DB 4DKFL 3H7LA 1EUTA 2AV1A 4QNPF 5C0NC 4PJHF 3VE0A 5BQ7B 3NACL 5GRUH 3ZKMD 3VWJA 3OZ9H 5KJRH 1BFTA 4GKSA 2DB8A 3ZKQD 2UV3A 1A9BA 1E28B 1QVOA 4CNIA 3O3BB 4P46D 1UQSB 1MWAA 4JO2H 4PB0L 3P3YA 1PX4A 1YUHB 3SDCC 5EZLA 2CDGA 3ZTNH 1QSEA 3F58L 2OBGA 5KAQF 1FL5A 2WSKA 4YHNA 3UPCA 4BUHA 1MSPA 4P5TC 5HD8C 2BCKB 5C0DA 4HUVA 1D5XB 4HC1A 1A21A 3X3GH 2RGSA 4K9EC 4EKXA 3BN9D 1R3JB 3MRMA 3QRGL 4MNGA 4OGYL 2WLZA 3BJ91 4OI9A 3BAEL 2J5LC 5IW1A 2APFA 2VDNL 3QRFM 3UPRA 4CU7A 4CW1A 4FABL 1P5VA 1ZHLA 2AEWA 2HVKA 5D72L 2OK0H 5E2UL 4PJIE 4FNLH 4X8XA 5LCVL 3CDCA 2H32H 3WFDH 3CX5K 4JPKL 2IAND 4LSSH 3ESUF 4AEHH 3P73A 3UTPD 3ZE1E 3L5XL 4Y0GA 2YRLA 4L1HA 4P46C 4GRLD 4U3HA 2IADB 5C0AA 4I4WB 1WIPA 3BQUD 2QL1A 3N1PC 3QDGB 1OW0C 1A7OL 4MJ6B 3EZJB 4J1UB 1MCCA 2ADIA 2BSTA 3TPUB 5JHDE 4QCIB 3Q5YA 5CS7A 3EJZD 3QHZL 3V4VH 4N8VG 4P2QE 3OF6A 5F88A 2ERJB 2NPLX 5CILH 5CEZD 2VMFA 1I1AB 1MFCL 2FLRT 4HWBH 2XWJA 3ARGA 3VJ6A 1GZQB 3QWRD 4GO6B 3U2SA 1U95B 4YDIH 4MLIA 1VFBA 2XN9E 5E9DE 3N85L 2CR6A 3K1DA 2HJFA 4NWTH 1IGFH 4KJYA 4P5KA 3TO4D 4XVTH 4JRXB 1J5OH 2ZSVA 1ZHNA 3TNMA 4WDIB 4X7FC 1LILA 3GO1H 5GSRB 4JDVA 1X5LA 1FL3B 3QWQB 2R1XB 2A1WL 1NBQA 3IDMB 5FYJL 3MUHL 4JO3L 3DX8B 4PP2B 3L95A 3MLUH 4XP6L 4I48B 3G6JB 4P49A 1E6JH 4UIKH 5ANMB 4M1DL 1DQLL 1RUQL 3MGAA 1MHPH 4DCQB 1IKNA 2FJHA 3T09A 1ONQB 3U4AA 3C8HA 4AM0B 4WU5B 4JDTL 3IDIB 4LU5L 4HPOH 4MAUH 4XCYA 4R4BB 3EOTH 5D7JB 5FYLE 2YD1A 1IZJA 5D1ZB 3LRSA 4MCZA 5HHNB 5E2WL 5DHVA 2YA0A 5KSAD 1WZMA 3WO4B 4QOKE 3QUYC 2X1XR 2Z8RA 1QFUL 2MCPH 1YQVL 2R1WA 5DQJB 2NY4D 3BUTA 4U7KA 5TGBA 2DL9A 3AXLA 1H5BB 1KN4H 3OGOE 3UJTH 4J3VA 2OR8A 1S8DA 2CLVB 2VLRA 4HCRL 4CU8A 1FC1A 5JPMA 1KLFA 2DBLL 2JF1A 4U1JB 2ZSWA 4PG2A 3ISWA 4X0KB 4RAVA 5FDYA 5D2NA 3UAJD 3BRGC 1OHQA 1OARL 3SBWA 4HHAB 5I30L 3JV6A 1LE5B 3EDJA 4QHNB 3BDXA 4HS6B 1E4XL 4YNYA 4TSCH 1ZVYA 4X80L 2LU7A 1R5WA 5IESH 1JYWA 2IMMA 4PG9B 4OZGF 3JSSA 3VMPA 4GW5A 1EHNA 5C0GB 3QI9D 4G9DA 5E6ID 3WJLC 3LN4B 1RULL 3RWEB 4MMZC 4XP1L 1PZUB 1A1OA 1AXTL 4NQXB 3WEXA 2JJWA 2W59A 1QRNE 1CVSC 4HPYH 4I8DA 3KPSB 5KJRL 3P77A 3BWAA 5FOBB 2CDGB 5ISZD 1J1XL 2BVPA 1IEBA 2DQDH 5DRXA 4G6KH 3QNXA 1R3LB 4X9GA 2P5WA 2OX5A 1A1MB 1RZGA 2C5DC 1I8KA 2HLFD 3GGWA 5IB3A 3KR3H 1MREL 5SWZB 3RA7L 1GYAA 4Z0XA 3GZKA 5IMMB 2YA2A 3QJFA 4H20L 3LS4L 2EDFA 5T5NG 4MQ7B 4R7NB 2HFGH 3QRGH 4OGYH 3BPLB 3FT4A 4X5XB 1BZ9B 3MBXH 3NIFF 1WAAE 5DFVD 1OSPL 4JFDB 3BUYB 1S7TB 1OY3B 3KPQB 1EVUA 3MNZA 4HJ0D 4WW2F 1MCWW 4U1HA 1ZT4A 3LPGA 3ULSA 4C56A 1T1XB 2F5AH 5I1GH 4L8SA 4LLQA 4PLOB 3X13A 4N9OB 5I1DB 1YC7A 2JK5B 4M9PA 2IBZY 2J6EH 3F7VA 4DAGH 2ATPB 1HYRC 5D7KD 4NO0A 3AXLB 1BIIB 1ZT7B 4G6AC 4NUGL 1RVFH 2YPLE 1KN2H 4F15B 4FQJL 2PYEA 5HTSA 1RK0B 4MCZB 4OT1L 5D5MA 4X4ME 4IIQC 4YDVB 1SYSB 1OP3H 4K7FB 3HNVL 5TE4L 5FF6B 4RA0C 4N8CL 5AYQA 1KELL 4KY1L 4YC2B 4IRZL 4ODUB 4XNXL 2KL6A 2PO6B 4BUGA 5FA4A 2I5YH 3OKMB 1QLRA 4L4TE 4WNQB 1W0WB 2GTZA 1GOGA 1WT5C 2ZUTA 1K2DB 4HIEB 2EEDA 1PQZA 3QIWB 1UEYA 4G42A 3SEPA 5CEZE 2VH5H 3GMQA 3KPMA 3A6CL 2ZUQC 5K93A 1DSFH 12E8L 2DQCL 4CVZB 3PP3H 2X4NB 1Y6MR 5D1ZC 3GO1L 1FAIH 4YFEA 5L6YL 1X5IA 5DJYA 1KG0B 1PY9A 5H2BB 2XKNB 3D25A 2YPLA 5B38G 1CXFA 3IJYB 2R8SH 1A6UH 4QHLB 1M7XA 3V5HA 4LQFH 4WCYH 5D2NC 2R4RL 5E1AB 2A9MH 5E1AA 3TPKA 1T83A 1NAKH 3RL2A 3MLSL 3ZSSA 1I3GL 3ZDXE 1BQUA 4IDJL 2R2EA 4APQC 4P5MA 4M9OA 4H0HB 2V2WB 4NM8H 2AS5M 1Q72L 3O2VH 2ADIB 2BSTB 3TPUA 4TUKH 1A6PA 1YYMH 5I1AA 1C5BH 2IANE 4XVJH 5HI3D 4KTEL 4KV5E 2GSGA 1OAQL 3NPZB 1DDHA 4OD3L 3BI9X 2K1MA 1T7YA 4AG4L 5FUCE 4MZ3A 1PAMA 1DQQA 1ZVSA 2DJSA 5GGVY 1RURH 5IG7A 1MIEH 4LVNC 3VD7A 4RISH 4HCRH 4GAJH 2H3NA 3HHRB 4V1DA 1INQA 3BE1H 4NQEB 1TVBA 3L3GB 2V5MA 3GK8H 4JQIL 3BP4A 2X7LA 3LH2L 4X6CE 1D9KC 5ITBH 4HQQH 3GFUA 2EDWA 2PTUA 1K6QL 4KV5F 4HAGA 3LQAL 5DURD 3NABL 1S7VA 4ELKB 1KPRA 2BP3A 1KJVB 1CBVL 3GJFH 3FB7A 3LEYH 4JEGB 1ZLVK 1Z6JT 3T2NH 2NY5C 3HE6C 1E4JA 1TQCC 5B8CB 4YXLH 3SKMB 4UT6L 5A3ID 4JM2C 2DTSA 4OZFG 4I77H 3JUYA 4C56B 1AGDA 4YEEA 2HT2C 3T0ED 2ZCLL 5JOPD 4Y19B 5BZDA 1U8HB 4U49A 1VACA 2UYLB 1EO7A 3NH7H 3OKOA 1UB6B 1HEZA 2G9HB 1UXWA 2J1KA 3QQ4A 1WISA 3BGFC 4HV8A 2FR4B 1AGBB 3PWPD 4NWUH 2CGRH 1AI1H 3ULVH 1VFMA 3MQIA 1MREH 1WCQA 3MJ9L 1X4XA 1DQDL 1RK0A 1PFCA 3RVVC 1HYSD 1QYGH 5L88L 3QH3B 1A8JH 4F57L 4ZFFB 5EO0A 3L6FA 5IKCA 3QEQD 2RQ8A 1MWAL 3BWUC 4KAQL 3MBXL 1NCDL 3W5MA 1X4ZA 2XRAL 4PY7B 2XY1A 3TWCL 3QO1B 5IJKC 1HILB 1ACYL 4FN0A 2EDQA 5H35B 2Y1VA 4LPUA 5EBWB 3QIUC 4JO4H 3G6DH 4KJPC 2VDML 3RVXC 1DLHB 3QHFL 1A3QA 4OZHE 4DJMA 4J3WA 3IDYC 1QEWB 3CU7A 3I02A 3WSQH 5I1HL 2Z4QB 3HZKB 3W2DL 3HE6B 2FYYB 3FHAA 1FL6A 2FEDD 3UZQA 3IKCB 3MREB 4C55A 2IH3B 1BP3B 3UJJH 4PJXF 3PHSA 4PV9B 1MY5A 4NKMA 4EEEA 5GZOC 1MCSA 4FQJH 2IPTH 4UILL 1GSMA 4M1GH 3O9WA 5EU6E 3UTZA 4JFEA 3QUZC 4NP4L 2YUXA 5B38A 4M7LT 4N8CH 3P4NA 4TTGA 2XV6B 1KELH 4UTAH 4RDQF 3GSQB 2QSVA 4CJ1A 3OJMB 3FQRB 4QTHA 3RRQA 1YMMA 1QFWI 4TYUA 4GG8B 5E5RB 4ZFOL 4M7LH 4NJAH 1OGTA 2R69H 4OF6A 3RL1B 3MBEB 3O81A 4NNYA 5KTEL 4PRNA 3NA9L 4OLUL 5DJ2B 1KLGB 2GEEA 3QIBB 4ZG1A 3MRGA 5F9AC 3VWKB 5D7LE 5ICYA 3L3HB 4PG2C 3SDDA 2EYTB 4YPGB 3GI8H 4QKXB 2Q1EA 3D18A 1OTTC 5ALBL 1MAMH 3C9NA 2J8HA 1JI2A 2HMIC 4POUB 3RI5K 5L6YH 3LQAC 1JZ2A 4GRWB 1U93B 2DLIA 5I15L 4K2UH 3UEZA 1EV2E 2GYSA 2OLDA 4Q2ZA 3TH3T 3ZE0F 1HQ4B 5DJ8B 4YQXL 2DOCA 2R4RH 2GITB 3IFNL 3EUUA 4JM4L 1XMWA 1CXKA 2B39A 4LRNH 2NY2D 3UPAA 5D9SA 5FM5M 2DQUL 4F58H 5D2NE 1NMAH 4ZTOH 3QQNA 1ZLUK 2YC1A 4NRYB 3MV01 2P49B 4Y1AE 4CVXA 5CD3B 1EGJH 2EIBA 5A1AA 3IFLL 4F9LC 1TCRA 5K9KA 2OXHA 1X5JA 2MKWA 4JZOA 3WFHB 3WHE1 3K1KC 2VWEC 4XPBH 1VERA 2V2TB 1S7QB 3CFCL 2BY3A 2PO6D 4BH8B 1F6FB 1HKLH 4L8CA 4MWFA 1A1MA 1RZGB 2W0FB 1FBIH 3MBED 1WBXA 4N9GB 5JORA 2W9DL 4PJ8C 3UJIH 1K5NA 5HI5C 1QBML 5EG6C 4BZYA 3O11B 4ZD3H 4RMVA 2P8MA 3JTTB 1LMKA 4WO4D 3RWDB 3BE1L 4Z77A 1HHGA 1UM4H 4IHOA 4HUWB 1ZA3B 1MNUL 2EYRA 5I8CA 1JNNL 1SVCP 3OQ3B 5JOFB 1D5IH 5IB4A 4XPGH 3QCUH 4O58H 4PTTB 1NCTA 3VXUE 3CH8A 3FRPG 4I48A 4UT9L 4RIRA 5KVMC 1MFBL 5C8JA 3CC5A 4C59B 5ERWB 4NZJA 2WV3A 5KANG 1AC0A 3OB0K 1W72L 5A2FA 3MFGB 5C0BD 3U9PL 3QDJA 3MODL 3S96A 3MV7D 4JN2B 5J1AA 3V6FA 2OTWB 3G08A 4FOMA 4HZLB 5E2JA 5JHDB 1FG9C 4LSTL 5D70L 5E03A 1L6XA 3QFDB 5DHYA 2NW2A 2NLJB 1OM3H 3W82A 1MCPL 5CCKL 3G5XB 1NSNH 3DETD 3NCMA 3BWAB 5FUCC 3HAEA 1XIWC 3ILQD 3EFFA 1H3UA 3FQTA 5E8PB 3TO4B 1IC7H 2VKXA 1WFUA 1NCCL 3RWHB 4FXLA 3ULVL 1M7IA 4FZ8H 5FHAH 5C9JB 4HT1L 5MI0C 1F58L 2FBOJ 4JANB 1JZ3A 1C1EL 4MJIE 4P9HH 1UT9A 1S7QA 2EDDA 4J8RB 1YYLH 4RFEB 3C2AH 5JTWA 4N0FB 5IFHL 2FB4H 3MV7A 2AJYH 1TZHB 4UAOB 1HDMA 1Q9LA 3TWCH 5HHQA 3FCTA 3JV6B 5CP3A 3R8BB 4Z8FL 4ETQB 5I73B 4H8WH 4MQTB 3BN3B 2DQEL 3G6DL 3VFTB 3SQOH 1IAKB 5DYOA 1A7RH 1FL3A 1PKQA 1T4KB 3HRZA 4HXBL 3LKNB 3EGSA 3HMWH 4LNVA 1BVLB 4S1SL 1VSCA 4U1SB 2HVJA 4KWUA 5AD0B 4JANA 3ZDZE 3T1WA 4W4OC 4WGVB 1T5XA 1OF2A 2HKHL 1WBZB 3CXDH 3ARZA 1L9MA 3FO2B 5JDSA 2HKFL 3QH3A 2NY3C 5F88B 3CAFA 1ND0B 4RMSA 5JORB 5T33H 1RPQA 4PBWD 2EH7L 5D7JA 3BSZL 4BQ9A 3QFDA 1G9NH 2ITCA 5KSAB 1OWWA 1OQXA 4P4KD 2VZSA 5K9KB 4F2MA 5KG9A 3L3KA 3QDJB 3S96B 3ZTNL 4JB9L 1DBAL 1GPOH 2J12B 4M4RA 4OTXL 3R8QA 2XZZA 3F8UB 1VESA 5EO1A 3VFPA 2K9UA 3NIGF 4BZ2H 1CG9B 1NGXA 2OMNA 4WUUD 1LE9B 3RTQD 2UY7A 2HT2D 3FZUC 5DJCB 3QIBC 3M07A 4FTVD 4P23B 5DQ9A 1P9MC 4PJGA 3EZ8A 4Y4HA 3OXRA 2NY1C 1KNOA 5FYKE 5HBBA 3MRJB 2VABB 1NMAL 3O4LB 4ZTOL 3WFDL 2QQNH 3GSRA 4DN4L 1A7QL 3K74B 4OBSA 1FLTX 1PLGL 1TZIB 2W0FA 2AK4B 5C0BE 1ERNA 4I1NB 4MS8C 4NNYB 2Q86B 2CK0L 2L4OA 4LCYA 2J8UA 1AC6A 1NUGA 2OL3H 4W6YB 4BFBD 2Q6WB 3OKYA 1Z0NA 3O8XC 3ZDYF 1AKJA 1BFOA 3BYTA 3LIZH 5D1XB 4J2XA 3MZGB 5IHUL 4JG0L 2ZCHH 1N64H 1CT8A 2IH1B 3AREC 1UM4L 3TVMB 3D39A 4M6ML 5F89A 1A6VH 4RGNC 4ALAH 1MFCH 1Z3GL 1IT9H 1A6AA 2GJZB 1EIBA 4GRLB 4ZUVA 4BELD 2HJLA 2N4IA 3ZE0E 2QEJA 2VERN 1R3IL 2DDQL 1MJJB 2BY1A 1ZHLB 4XPGL 5C7XH 4NWTL 4MJID 3NOIA 1AGDB 1CK0L 2P5EB 4TUJB 1LNUB 3KPOB 3CVIL 2RBLA 2LFGA 3BKYH 3T1FB 3SKMA 5LAXA 4Z78B 5FYJD 5E8EA 5E8EB 4OSUH 5DD3L 1P69B 3VXUD 1LEGA 4KKLD 3TIEA 3VA6A 4K8RD 1NANI 5DTFA 3P4OA 2V2XA 3E2HB 4RX4A 1YJDC 4NNPL 4YC2C 1MHPL 3P9MB 4KZEH 4OLZH 4PJBE 1MFEH 2YD4A 3BKML 3RVWC 5JIHA 3GSNB 4JHAH 3I9GH 3V95A 1CG9A 1BX2B 2B5IC 4KPHH 1FQ9C 2X1PA 3QNZB 1UADC 5GGRB 3F12A 3FCTB 4W4OA 3ZKXB 1JGEA 1NLDH 1TJGL 1JGEB 4P46A 1B0RA 1ODAA 3EO9H 3IDUA 4P46B 5BVJA 2P4AB 5I16A 2ADJA 1U8MB 4R7DA 5DRWB 1EBAA 1QSFA 4OZ4A 4PGEB 5E94A 1RJCA 2WIIB 1MCOL 4OCYL 3PIQB 5MENA 4XPHL 1VHPA 4GXUN 1H0DA 1CIDA 5JPNA 3TF7C 5JLZB 2RCSL 4KUZH 1V05A 3JTSB 4OLXL 3KPLA 5D1QD 4QXUH 4Z6AT 1F6AA 3MJ9A 4Z8FH 1YEJH 1C08B 1HILA 3LQZA 1XGTB 1ZOXA 2R9HD 3PGFH 5TDOB 3AM8C 3TM6A 2F53E 5HHME 4BYHA 4K7PL 3AGVA 3D85D 4PJGE 3DGGB 4XNQA 1JIBA 3T65A 1U58A 3H42H 1KCRL 1W0VB 3CX2A 1ZANH 2JCCF 1RUAH 3IJYA 1MCRA 2VZVA 3R1GL 4CDGC 5HPMA 2Y07L 4OFPA 3RGVD 4F80A 1WJ3A 5I16B 2HTLC 4GRLA 2C7UB 2MWCA 3FT3A 1VADB 4GBXD 2GK0A 3V0VA 5T33L 2WWMD 1U9KA 1CXLA 3DROA 2DIJA 2HJKA 2O26U 1TVHB 1YEFH 1A22B 2NY4B 3ZSTA 5FEBA 1RZFH 1R3LA 3GIVA 4N0YH 1F2XK 5DK2A 1U8JA 3GRWH 3EDFA 4Y7MA 3WN5C 4PJ7B 4P4KC 3MRLB 4XMKL 2PO6C 3SQBA 5JXEC 4I3RH 1E4WH 3O3UN 4N1EA 1OAYL 4NZTH 2NLJA 3OMZA 1QRNB 4QGYA 5KSUA 3T1FA 1YEEL 5IFAH 3RY6C 3TBWA 1CGWA 2OMBA 1T7WA 3EYSH 1WSST 4NRXA 2DRUA 3DX9B 2P7TA 1JPTL 2NXZC 2G75A 35C8H 1U2CA 3HZMA 4HK0A 4V1DB 4XP5L 5EOTA 4FQPA 1A7QH 4YBQD 3MRKA 1YC8A 2H6PA 5KSVA 2FGZA 4WU7B 5ISZE 3DGCR 1S7TA 2Q8BL 3NGBB 2R1XA 5BJTA 2VITA 4GQPH 1MF2H 1F4XL 1GVIA 1Q1JH 4QY8B 2ZUVA 3RTQB 3H9SA 1KLUA 4NQDA 3DX7A 3SDAB 1AGEB 1IZKA 4G7YH 3RWHA 2GTWA 4QRUA 3DXAD 2FATH 1HHGB 1BBDH 3V5KB 3LIZL 4L3EB 2HTKC 1QA9A 3MNWB 5D2LB 3MO1B 5IGXH 5EC2A 3O11A 4XCNA 5DLML 5DMIH 2IPUG 3QNXB 4LPTA 1SM3H 4Z7WE 1DVFD 4MB4A 3B2UD 5JO5A 1LO3L 2F53B 1XH3A 3IS1X 4XGZA 1A5FL 2ADFH 3GHEL 5IWLA 4PJHB 5BMFH 5GRVK 2Q3AA 4OZHB 2XPGB 5CHNB 4ZO9A 5IB5A 4A6YL 4X6DF 1UWXH 4ZFGH 4ZNEA 5I75C 1EVTC 3I2CH 12E8H 2DQCH 3VGDA 3C6LC 4L4VD 2BSRA 1F02I 3OWEA 4FQLH 5D7KE 5CEXB 5GZOD 1WBYA 3OX8A 3DHJA 2IPKB 4WUUE 5GS3A 4JFZH 4Z0BL 2X10A 2R8SL 2A74A 3L95B 4WNQA 3QUKA 2JB5L 4Z7WF 4JFDA 4P2RA 1XCQA 5GHWL 4Z18A 1IFHH 4BA8A 2AKRA 4MNQB 1IARB 5TF0A 5ILTL 3TVMD 4QHMA 4X6CB 3ZDXF 1H3WM 3R0MA 4L8SC 4JVPA 5MEQA 3IDXL 2EYRB 1URLA 3ULUF 2D31A 3SGDI 3T08A 1Q72H 2HA1A 1G6RL 2NX5A 1SY6L 5F6IB 4TUKL 4NO5B 1I9EA 4MX7A 5B3JE 3TV3L 5M7QA 3V8OA 1FDLH 4OD3H 1ZVHA 4K94C 3INUH 2GAZB 1FCCA 4R0LC 3LN5A 1QKZH 3PL6C 2GI7A 1NLBL 2XQYK 2YUZA 4XTRC 4U3CA 2FEEI 4H1LB 3OKEA 2R2BA 5FGBA 3U4EA 5J13B 4UV7H 5EPMA 1AGEA 4UBDD 2B2XH 4FG6C 4GW1B 5KN5B 4Q6IA 1QBBA 3QIUA 4F7EB 4JLRA 3ARFB 4LL9A 4R4BA 5GRXG 3FOMB 1KFAL 2AV7B 3G6AA 4AMKH 5HDQL 1E28A 5GRJL 4YBLC 3P73B 3BP7B 1MRCL 1YEIL 2J4WL 3WIHL 4JPVH 2YPVL 4XPFH 5C3TA 3LQAH 3B6SB 3RP1A 3LKSA 5E08L 2JE8A 3FT4B 4M6OL 4MNQE 5FFLA 1CGSH 4G8GD 4KKAD 5HHQB 4Y16A 4KRMB 1X5HA 1N6UA 3O9WC 3CMGA 3RAJH 4XXDA 5IB1B 3BZDA 3B9KA 3I75A 4C4KT 4OFVA 3WL9B 4U6TA 4P4KB 2HTKD 3N0PB 4I77L 2YS4A 3IRPX 2ZCLH 1MIML 3R4DA 4UB0L 3HFMH 3OKEB 4KKNA 1NBZA 2DAVA 1T66C 4PJ7A 5E8PA 4UDUA 4DFHA 5IEKA 2XWBA 1CLYL 2L7UA 3OR7B 1NGYB 1EDQA 3MLVL 5I8OL 4JO2L 5IVXF 4HKZA 4APQB 4G9DB 3EJJX 1I9IL 3GRWL 1B0WA 5IMOA 3JVGA 4FQQA 3X14A 3EDDA 4GRWE 2EDTA 3RGVB 2SEBB 4JE4B 5DEGA 1CU4L 3E2HC 4CN4A 3DXAE 3B9KD 2LV4A 1UJ3C 5FA3B 1EO8H 2LQRA 3E1F1 4ZAKA 3RHWF 4KHTH 3VFSB 1SQ2N 1H3PH 4WHDA 3SDAC 4KTDL 3HC4L 3IDMA 1G1YA 2OYPA 3EYUH 1KJ3L 4LSRL 4L9DA 1I7RA 2G60H 3OPZH 4NN6C 4WO4C 4OZFB 4AIXA 4CN1A 4FP8L 3D69A 4YR6B 1O7VA 5C6TL 4L4VE 2MCG1 4LCIH 1BWMA 5TGBB 3PXHA 1MJ7H 4HDIA 3DRQA 5I1KL 4P59H 3MC0A 1JCKA 2NY5L 1GGTA 4P23D 2IPTL 1L7IL 2NXYB 4AEIL 4QHLA 5ACMA 1D5XA 1A7OH 5DHVH 3LRSB 5EC2B 4KKLC 2IBZX 5HHXL 3SO5A 3WXVL 2VDPH 2XZAL 5F70A 2DQFB 5TE7L 4PRBB 5D7LD 4WUUB 5ESAA 4XRCA 5CGTA 1U8MA 3DUHA 4TPRH 3VFOB 3QHZH 2D9QB 3GSQA 3QDHA 5MEQB 1BF2A 1QFPA 1IAOB 4OIBA 5DD5L 5L9DL 1U6AH 2UYLA 2OR7A 5JHDD 4ODXB 1DQJA 4HWBL 4P3CL 1JHLL 5DJAB 1S78D 4GRWH 5TQ2H 3PP4H 2FHBA 5D1QA 2H6PB 3O2DA 1Y0LA 2XZQL 5T5FH 2IPKA 3BGFB 4Z9KB 2HFEA 5EOTB 2X4OA 3VG0L 4HWZB 4Q7DA 4DZBA 4X4MA 2IH3A 5HGHB 1FYHB 4Y5YC 4AQOA 2E5EA 5I15H 5EU6D 2EH8H 4N90E 4X6DE 1G7LA 3AS2A 4XPTL 2NY6C 5DK0A 4XH2B 3SCMC 4YQXH 3GSRB 3RIFF 4HKBA 4MCYA 1JNJA 4HKBB 3SE9H 5CAYB 3DYOA 3E6HA 1WAAF 5DJ2A 1HIML 2VXUH 2DQUH 3D25B 2BVYA 3MNWA 3ZE1F 5DJXA 1RSFA 4IRSB 5T1KD 4E5XB 3HPJB 1RJYA 5FV2A 4HPOL 1KXTB 4X6BB 4LCUA 2X4OB 1ZHBB 3DSFL 1LO0H 5H8DA 1XF3A 3QEQB 2AEPH 4PLNC 3H3BC 1HKLL 2HRPH 2W60A 2W60B 3O9WB 1XF1A 3TGXA 4XC3H 5HYEA 1HEZB 4PJFB 1P53A 1YN6A 3DLQR 4RFNC 4KMLB 4PJ9B 3BPLC 4BQ8A 3IF1B 5KSAA 2HVKB 2Y9RT 1BECA 2ADGA 4Y4KD 1RK1B 3TNNB 3MJ6A 2W0KA 5GRJH 1SJHA 4AL8H 1XT5A 1P7QD 5DRXB 1YEIH 2J4WH 3MBEC 4FQ2L 3TBTB 2YPVH 1G0XA 3D9AL 3QUZA 3CSPA 2L7JA 3VXNB 3T0EB 2VZOA 3Q5TA 1R3KB 4J3SA 1CGSL 1JN6A 2PYEE 3SBWC 2VUOA 1ZEAH 3SDDC 4RWYL 5DUML 4TSCL 4NM4H 4ZXBD 1N0XH 5KSBA 3RZCA 1MFAL 4LOUD 7FABL 4KJQC 4XPAL 4ZFZA 4L3AA 3STZA 3TBVA 4G42B 2ICEA 2CKBB 4N5EC 2D7PA 1LE9A 1YY9D 3VD3A 1MCJA 4Y19E 4Y88A 4BK5A 5CMAA 4YHPB 2GK0B 1BHGA 3V4VL 2HG5B 2AXFA 4S1RL 1NMCC 3QA3A 2A77H 4EN3D 1MY7A 1S9WA 5DZOA 3TYFB 4UUJB 2CDFA 4PJBA 3CDFA 1AKJD 2ICES 3V6ZA 5FM8A 5HY9A 1JK8B 3HE7C 2HFFA 4CU6A 1C1EH 1WUNT 2PYEB 5FDWB 5FYLD 3GUTB 3S37X 4HJJL 3ZYZA 5KAQG 5DVMA 3TESA 5BRZB 2AJVH 2B1AH 4QXGH 5IWLC 4OD1H 5IFHH 2Q86A 4QOKA 4FA8A 4B5EA 1OSPH 3AS1A 4NO0B 3OKLB 4YXKL 3BW9B 4NN7C 3EYOB 1UCBH 1YEHL 3D69B 4YR6A 4YDKH 2J3SA 3FFDA 4P4KA 5HYQB 4GMSH 1DQLH 4XCYB 4XH2A 1OGAB 3QEUB 3VXSB 1RUKL 4J6RL 3RUGE 1TLKA 3RIAK 1I3RA 1TPXB 3LQMA 3K81A 4YK4C 1FYTA 4JFDE 2MPAH 4ZPVB 3MCLL 4N90D 5I1KH 4HHAA 5E99L 2O61B 2SEBA 1IL1A 4GMTH 4Y4KB 4WGWB 4ONHB 1D5MA 3PWPB 2HKHH 3AFLA 5C0JB 1INEL 1PGRB 1A7BA 2EDOA 3B83A 4YE4H 5HHXH 3WXWH 3MRNB 2VDPL 2XZAH 4Y2DD 3CCHA 3K8MA 4X7EC 4ELMF 3RWIB 3VWKD 3SKNA 2XG5A 2EH7H 2HH0H 1CD9B 3EYQD 2BHZA 3GSVB 4QT5A 5AYUL 3HS0A 4HC1L 1BJ1H 1AFVH 5L9DH 1RJYB 5GJTH 2V2WA 2V2XB 2YD7A 1J87A 3FO9A 1D9KB 1XGRA 5JA8B 1XIWA 4P0DA 1QPXA 3NVQA 1NDMA 2D7OA 3QG6B 3MJ8B 5J8OA 3E6HB 2XZCH 2J6EA 2DJUA 3QUMA 2HT3D 5I9QB 3PWUA 5DRNB 5EBLA 5C0BB 2QADD 3H9SE 3KDMA 1FAIL 2LVCA 3WD5L 4GRLC 4XPTH 4L4TB 1FNGB 2FWOB 4PJCA 4MDJA 1BZQK 4JZNA 2R0LH 5C0CD 4WCYL 2E27H 3IXTB 2VQUA 5E7FA 2XFXA 3VXTA 3FJTA 5I0ZA 3QNYB 1KACB 1LK2B 1B6UA 1G6VK 4HIEA 4PJ9C 5A3IC 3MOQA 2VDOL 1FCGA 2BNUB 2CMRH 3B9KC 4GAYA 3O6ML 4M7JL 4OGZA 4UQ3A 1I7ZB 1A14H 2JELL 1CFVH 2G75B 4LAQH 3L5WA 2DWDB 2AJ3B 5DXWA 2F8VA 3RGVA 1YYML 4AH2B 4FFZL 4G6KL 4I18B 4P2OD 5FCUL 3MXVL 3N50A 5IMOB 4H1LA 5DQJA 1NAMH 4PJAF 4ZNEE 2VSDA 3JWDL 3QUML 3VXOA 2HRPL 1NGWA 3GBMH 4LLDB 3CD4A 3ROLB 1CGUA 1OAUL 3F62A 5CGYC 3VFWA 2XN9A 2KZWA 1RIUH 3LEXB 1NC2A 3BIKA 2BOBA 4LGPB 5J6HB 1G7IB 3GJEA 1HCFX 3D3VB 4NBZB 3CSBA 2V2TA 3C8KB 2H26B 1N5YL 3UC0H 3JVGC 1Z9MA 5DK2B 3P0YH 4RZCB 1MOEA 1FSKC 3LH2H 3JV4B 3ZZ1A 4LIQE 2KDGA 2XTJC 2R29H 4AENB 3D9AH 3WO4C 2BZDA 1YECL 1UA6H 1LK3H 4YDJA 4UV4H 4RWYH 2XI9A 3HKFA 3FZUD 3RZWA 3BKJH 1KN2L 1MFAH 3O6KL 4NCC1 4XWOC 4B7LA 1VA9A 4O5LH 3V4UH 3MLRL 5J9PA 2BVEA 1PZ5A 1HH6A 3U6RB 4NNPH 3HNVH 4CL7A 2EYTA 4YPGA 4NO0D 4DKEL 1MFEL 2ZSWB 4X7CC 2YK1L 4O2FA 4YZFE 1NFDA 4JY6A 2NTSP 1BVKA 2ICCA 1KLGA 2P8PB 5IFJA 3TH4T 3FN0H 3ALWA 4LKXA 43CAA 5ENWB 9CGTA 3QPQD 4PBVC 4GG8A 4RGMB 1RZ7L 1QHPA 4LKCB 4EN3B 4CRPA 3RWFA 2NW2B 4R6UA 2I9LA 4ONGL 5MENB 4XPHH 4GW5B 3V6OC 1F97A 3ZYJA 3QPQC 1UM5H 3V6BR 2BFVH 1OD9A 3MMEB 4OD1L 2V5YA 4L4TD 5D7IB 3VD4A 1FO0A 2XRAH 4NKIH 4C83B 4OLXH 4KROD 2KQMA 4QXUL 1LO5B 2AJXH 4PUBH 2KQNA 1K4CA 3I3EA 4LLUA 3S6CA 1QFHA 3DVGB 1B4JH 5INDB 5KVGL 4IMLA 3C6SB 2C3XA 2DI7A 1NJ9B 2JB6B 2VE6A 3ARUA 4OV5B 1TIUA 3L3JA 4GS7B 5GS2H 3TBVB 2UWEF 4KQ4H 3TBWB 5L2JB 4NCC2 4NSKB 4AENA 4NJ9L 3OXSA 4HIHA 2R1YA 1LWRA 1WC7B 1JNLH 5E99H 5SWZD 1S9XA 2YPKA 5HVWA 2OTUA 3DWTA 4RFNB 5IB5B 3QI9A 4M7KL 1JWUB 2AEQL 1FL5B 2G5RA 4DKFH 5IKCB 3W9DA 1WEJL 3BEWA 3WS6A 3ECBB 2W9LA 3VFWB 1WBXB 2Z35A 3PP3K 1H0DB 4RISL 43C9A 5CZXD 3D3VE 1RK1A 5GQBA 1QVOB 3HI5H 3QUXB 1UH3A 2C3WA 5D7IE 1WT5A 4Y19D 1S9VA 3L3IA 4WV1A 5DMKA 4HQQL 3DVFA 1K6QH 3PWJA 4MSWB 5JW4N 4LVHC 3EYVA 2PNDA 1FZKA 5J6GB 2NY6D 5F1NA 1PG7L 2WUCH 1IM3A 4CVUA 1ULVA 2IQAA 5TH2B 1MLBA 3QIUD 3PWPE 1TDQA 4XCEA 3ARBC 3V7MA 5D6DA 3EFDH 2YXMA 3FAWA 1UENA 3MREA 2XT1B 4JAMB 4G7VH 1GGYA 5D93C 5D2LE 3PJSB 5DGQA 4GKZB 2PCPA 4XP5H 3EJZC 2VDOH 4LEXL 3S4SB 3QIWC 2VABA 4RMRA 3DARA 4YJZL 4OCLC 2X7LB 3OBAA 3RU8L 1LEIA 5BRZA 1IKFL 4K3JH 3L6FB 3HS0B 1XR9B 3JWDH 4JFDD 3DX7B 1S7WB 4PR5A 4MXVE 3QIWA 4L3ED 3TZVA 5DS8A 3UJIL 4MD0B 5I1CL 2YEZB 1T03H 4X99B 1KGCD 3B8YA 2AQ3A 1JF1B 4IRJA 4OM1H 2GFBA 3GSNA 1MHHB 4MA8H 5HI4D 1JNHA 3PHQA 5BMFL 4C58B 1JNNH 1GAFL 4Y19A 3S3JA 2R29L 1B0GA 3BD3A 3I84A 4C57C 5FF6A 5IVNA 3I2CL 1HINH 1JHTB 4HH9B 3KJ4C 1U8KB 1XGUA 2A6DB 1FLRL 1ZXQA 4MA7H 1ED3B 3QIBA 4Z78A 3BFOA 4KK5C 5EUKA 3GB7B 4L8DA 3H2WA 3MODH 3G5ZA 4TTDC 3TIDB 1MJUH 1E6JL 4CVWA 3MLXL 5I0DA 3WDJA 5IHZB 1RUQH 1V5JA 4P57B 1FE8L 3P4MA 3WNPA 3ULUL 4U1NA 4OIIL 5FKAA 4NZUL 4YFDB 4FQXB 2FBJL 4QTIL 4X7SL 3MRPA 4LU5H 2C4FT 1IAKA 3BGMA 3H9ZA 5F7YC 2MQCA 4L4JA 2CDFB 4PJBB 4YPJA 3PGCA 2BNRB 3IETB 3FT2A 5AWNH 1ZWIB 4FXKB 1IC7L 5JR1H 4KDTC 4N5ED 1S7XB 5ABDE 4FZ8L 4JGUA 1S9VB 3D87B 5CSGA 2NXZD 1CLOL 5FKPA 1L9NA 1T1ZB 3I6GB 3VGAB 1KIRB 1XGQA 3MRRA 1MAML 4POZD 1RHHB 2DBLH 4EN3C 4OCRH 2FX7H 4Y1AB 5DEZA 1Q94A 3X12B 2FJGA 3GI9L 1KFAH 2IBGA 4P23C 5T1LD 2YWZA 2JJTA 3KLAA 3SGDH 4K71B 1MJ8H 1ZT7A 5IHZA 2VLKA 4LBEB 1JWUA 4OLVH 2OR9L 3KLHD 3LD8C 1OF2B 1XGTA 1OT2A 3KXFE 4PJGB 4JKKA 5D96C 4F58L 1KT2B 1AXIB 1A7RL 4UU9B 4HXBH 3TBTA 1G0DA 4GUPA 1GIGH 4NJ9H 4DUWA 1PY4A 3X12A 5F3HB 4UDTA 3IFLH 4HIIA 4LSVL 5ETUA 5IT2H 5EZJA 1FVEA 2BNRE 4NQVB 4NN6B 4TQEH 3FO1B 5CJ5A 3CFDB 5HYIA 3CXDL 1AXTH 2Q7YA 3QFJD 1FBIL 3DIFB 3G04B 1WEJH 4JFQB 5ESQB 4MJ5B 4C83A 1UCTA 3U46B 2XN9D 3GIZH 1T89A 3ARBB 5IMMA 1XF2B 3SY0A 5AEAA 4UT7L 5C0CA 1B88A 3DI2B 3LKRA 4X5WB 1CFBA 3RWFB 1WCBA 4S1DD 3U30B 3JV4A 2W0LA 4MQSB 4WFFD 3LV3A 3STBA 5IVXE 5E7BA 3KR3L 4XRCB 1T7VA 2F15A 4X6EA 5DR5H 5CZVH 5DJXB 4QRPB 5FYKH 1CDJA 2AXGA 5D5ME 2GAZA 1MRFH 5IQ7L 2A83B 3LS4H 5FECA 1CDYA 5CUSH 3RWCA 4O2FB 5DHYB 1TJIH 4FFYL 4Z5RA 1XF4A 4NQCA 3MJ7B 2FZ3B 4PB9L 2FJHB 3IFPA 1ZT1B 1EBPA 1N4XL 2IANB 4OBRA 2BC4B 5I1LA 1UWEH 1DBJL 1MCPH 2W65B 3ZDZF 1PLGH 2A74B 4W81A 2IALA 4EXKA 5FB8A 1F3DJ 3HE7A 1AE6H 5F1NB 5A2LH 2LABA 3TC9A 4U6XA 4M43L 3C09B 1L7IH 1MRDL 1C5CL 3RNQB 3VH8A 2OXGA 1DVFB 5SWSA 2ITCB 5TE7H 3MUJA 5HHOA 1ZAGA 5MI0B 4WTXA 5D1ZD 3U30C 3BIKB 3LHPH 4KFZC 1FFPA 1RZIB 4G8GE 2PUQT 4L3EE 4UIMA 3RL2B 1H5BC 1S5HB 4XMLH 4MX7B 2GT9B 3KYNB 3S34H 5I8KH 1U42A 4YX2L 3PDGA 1P4IL 4JFXA 3K4ZA 3IU3B 1J7VR 1UWGL 5IBLC 1CK0H 3RVVD 3CVIH 1H3GA 4MD4A 5FO9B 4OD2B 3G9VA 3VFRA 5B38B 4PG9A 3LY6A 3UTSA 1P7HL 4YFLF 3QPXH 1A6UL 3LKQA 3LKQB 5I1IH 5KBNC 4HFWB 1AD0B 4PJEA 1F3DH 4HS3A 4ONFL 1E27A 1IQDA 4U1GB 3ULUH 3OB0H 3S5LA 5GS0H 5HDBF 1NCAL 4L4TA 1JPSH 2VXUL 3BT2L 1RMFL 4TTDD 4WI9A 2H8PA 4HUNB 1EJ6A 2HJFB 4M5ZH 4I3GA 2QQQA 4RGOL 4QRTB 4JFXB 4LLYA 4WJ5B 3BGAA 3GMRB 3DSFH 3MRGB 3TJEL 2DQJL 3WNOA 2IGFL 4LSUH 4BSJA 2FL5B 1I1FA 3SE4A 4D9RE 1X5YA 4LPCA 3AC0A 4PJHE 4Z7VE 1NLDL 1X3DA 3U1SL 3BEVA 2EKSA 2VDRH 1I8IB 4S0SD 3MLZH 5DWUH 1N26A 1ZHKA 5IVZB 5EN2A 5HDBE 3HC3L 1O5DT 1A0QH 3LKOB 3CDGB 5D93B 4D8PA 2E6JA 5C0FB 4KKAC 1NBYA 1CFQA 2HJKB 5ACLA 2DTML 2X40A 3HE7B 4BH7B 2OTWA 1CTOA 2CLZB 3KPQA 4AK1A 1ADQH 5DC0A 5C6WH 2P8LA 5JW5B 1OT1A 5D1QC 4LGSB 5DJ0B 4YXHL 1CBVH 2QQNL 4TVPE 4WHCA 2QQKH 1FVEB 2EXWC 4ZTPH 3MRBB 3QJFB 4XVUC 5DA0B 1WZLA 2F53D 3DTXA 2DLTA 3RQ3A 1EPFA 3KXFD 1N0XL 1JMXA 1A3RH 4KHXL 4MNHB 2MHAA 3GMPA 1CE1H 2AV7A 3G6AB 5MERA 1R0AH 5IT2L 4L3CB 5DVLA 2I60H 5GZNC 5JIIA 2V7NA 3ARDC 3DURB 1M7IB 1PD6A 4I2XB 4JQXA 3UYOD 5IMLA 2DQGH 5A16A 2XPGA 3L3OB 1GOHA 3QWOB 3KLAB 1AQDB 1FNSL 1S7SB 5DEFA 2QSQA 1AO7A 1VFUA 2EC9T 5HXMA 1IGCL 4ZFFA 3OKDA 1R5VB 2FJGB 2A77L 3MLWH 3HC0A 2EIZB 4IMKC 1A6VL 2PN5A 4KVCL 5EORL 4XCNB 4LF3A 4IRSC 4UTBH 3VXOB 4LASH 1AGBA 5DI8A 2WWKO 5CJXC 1DR9A 5JHDA 1JRHH 5BS0B 3PL6A 5CZVL 3HRPA 5J1AB 2BRRH 5CD3A 2CKBL 2YBRB 3EO0A 2IPUK 4HKXB 1LVEA 2ATKA 4K23L 3PABA 1FJ1B 1X7QA 2DLFL 5BV7L 5CIPA 5CUSL 3E3QE 3QNYA 5GGUB 1S7RB 3L1OH 3MRFA 1JZ6A 4PJIA 1V7ML 5BW7C 1Z9OA 2WBJB 1N4XH 1ZHNB 1GZPA 3WBDA 2Y7QB 4G9FE 3UAJC 1YMHA 2A0LC 1P4LA 2X4QA 4G6ML 2HMID 2CRMA 4LHJB 1TJHH 5KS9F 2XKSA 3MFFB 3TN0B 2A6JA 3MCLH 1FZMB 5EOQH 5GIRA 2Q8BH 3KYOA 3B9VA 1MF2L 4UILH 3D0VA 5JIPA 15C8H 3EO9L 3KJ6L 4ZAKC 1GXEA 5F97E 2XTLA 4OCYH 2E6PA 4NHCL 1XAUA 4UTAL 1INQB 2BNRD 4KVNH 5HI3C 1JNHB 5D1XD 3VFNA 3ARFC 3QDGA 4PYGA 4P2OC 5B39G 1P7QA 3UBXB 3AAZB 4D9RD 4BFGA 1HE7A 5KANI 4MB5A 5KTEH 3MV8B 4LOUC 2IALB 5T3ZL 1NGZB 5H94B 1IAOA 5C08B 1KEML 1I4FB 1KBGL 1LEKA 1J8HB 2K7PA 3NZHH 2CIIB 1RV6X 3GI8L 4WI3A 4U1NB 2DQTL 4F9LA 1KCKA 2JJTC 3EOAB 5I66A 2Y23A 4Y89A 4RAUA 4LARH 4FTVA 4XVSL 1U95A 3V8CA 3NFSL 4KH2A 2YMXH 4QEGA 5B39B 1U8NB 2E27L 3D85A 1MAKA 5GHWH 4FZEH 2YZ8A 1YN7A 4BZ1H 4KJWD 1J0YA 1VCAA 4KKCC 2AJZA 4RBPK 3WIFB 1I7TB 2WIMA 3GJFK 5B3NA 3CFEB 4E0RA 1AP2A 4R97C 3ETBF 3KPLB 1P2CB 1TPXC 4WFED 5K33A 2HN7B 4KK6D 2H3NB 1YEFL 4HUUB 4HGWA 5GJSL 4DVBB 3QDJD 1BAFH 1HCVA 4XPBL 1UG9A 3NCEB 1JF1A 3O41B 4YHIA 3U1SH 3AS3A 1NLBH 1RIUL