2DBLH

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
219
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYAFTNYGVNWVKEAPGKELKWMGWINIYTGEPTYVDDFKGRFAFSLETSASTAYLEINNLKNEDTATYFCTRGDYVNWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
total genus 37
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1994-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dblH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dblH02
1IL1B 4P2OB 5CZXD 3ZT6A 3SDXB 1JHTA 5B3JE 5BQ7A 4TQEL 1UM4H 4LCUB 1TZIB 2J88L 4O00A 3O2DL 5IB5B 5JLZA 5DUPH 3UCRA 3BPLC 1AGCA 1HOCB 2HVJB 1U8MA 3A6CH 3JV4A 1OB1B 2ORBH 4LIQH 3GI9H 5I15H 3U7YL 1XCQA 3GI8H 3DGGB 3ZE2F 4CJ0A 4WFHD 3W5MA 2CRMA 2YD1A 2AQ3A 4NPYB 1EUTA 4NSKA 5J6GB 4CW1A 2B2XH 3KGRA 4ZFZB 3U7YH 1MAJA 1F58L 1IGCH 2ITDB 2VISA 4HUMB 2Q87A 5JIKA 4ODSH 4YPGA 3ISWA 15C8L 4NKMA 4HQQL 4NRZB 4EDWL 5FO8A 4CADA 1JGEA 4K07A 1KTDA 3MV9B 1OCWL 2CIIB 2X7LA 1GXEA 1TVHA 1IEAB 1KG0A 2YWZA 4ZFZA 4X83A 3GSNA 5GRUH 3RWFA 1FFNB 3RVTD 3VMNA 4AEEA 4PGCB 5DRZB 5T3XE 4FFVC 4PR5A 3EZJB 2VXSL 2HKHL 3SHSA 2P43B 3BPOC 2GTWA 4CN6A 3LD8B 5D7SH 3ZYOA 1A7RL 1UVQB 1MCKA 1U8MB 3ARTA 3LB6D 4LLDB 4P4RB 4PJIA 4R4NC 1DLFL 4KFZC 2IEPA 4O58H 3U9PL 2FWOB 3MRDA 1GRWA 3UTQA 3MRLB 3DETC 3WDJA 1ETZB 3TJHC 4Q0XL 2ZOKA 1CGXA 4PJ8A 2IH1A 2F74A 2IBGA 2BVTA 5DRXB 4OIIH 5D7LE 1K4CA 1ZT4A 3WLBA 5HGAA 2DKSA 3AS0A 1FZOB 3RWFB 3QDME 3WL9A 1GZPB 1MI5E 3MO1A 1ZHKB 1LEIA 1DBJH 3UEZA 4OLUL 1VPOH 4N68A 4R97C 1K8DA 3BZ4A 5CZXC 5HI3D 1PX3A 1MI5B 2ICWB 1SYSA 3BUYA 1RZIA 3FQWB 3S37H 2YUVA 2QQKH 4UTAL 3QZWB 4MXWH 5D72H 5KW9H 4FABH 5F6IB 2XZCH 1MPAL 3FAXA 4FQCL 2APWA 5FUCE 5TDOB 1UENA 1VDGA 4GG8B 4XP1H 1QKZH 1X4XA 3FZUC 1LNUA 3BH9A 1IC4L 4ZYKA 3GHBL 5DEFA 5M95B 3JSSA 4QHKJ 1F4HA 3DGGA 3OZ9H 5MENE 2CLVB 2FSEB 4HS8H 2I07B 4M5YL 4HBCH 5T33H 1CE6A 2QSCH 4BM7A 3VXUB 4M00A 1MRDL 4L3EE 3UC0L 2DIJA 3T0VA 3RGVA 3PXJA 6CGTA 1MJ7L 4WTXA 4W6YB 2FB4H 1TVBA 3DXAA 4OAWB 4G6AD 3FMGL 1JHLL 1UCTA 4MMZC 3AY4A 4F57H 4LQFL 5DDHA 1YEJH 2BHUA 5FGRA 5E70A 5TF0A 2GAZB 5HVWA 3VG0H 2AK4D 3DV6B 1YEIL 4CMMA 4BQ6A 1K85A 1CLOH 4NGHL 1DVFB 3RDTD 3GMQA 5JUEL 5JOPD 3UYPA 2E8ZA 1BPVA 5E1HB 5BZWB 2NZIA 2HFEB 1H9VA 4P9HL 1MAKA 2IG2L 2ZCLH 5DD5H 4ODHL 3TH4T 1W0VB 3P4OA 4EUPA 3V6ZB 4PG9B 3IB4A 3WD5H 5E5MB 5T5FH 4KWUA 4NQED 3BZFB 3H2WA 1EGJA 3OKOA 3QDAA 2YD8A 4JRXE 5BS0B 1CBVL 2AK4E 3G6JE 4KXZI 4DWHA 2HFGL 5JXED 4LF3B 2PW1A 4YGVB 1A1NA 2VL5B 1D5MB 4LSVH 1K9TA 4JFOB 4L4VD 3T0XA 4X6DB 4M5ZL 2NYYD 4DKFH 2KDGA 2X4QB 1RZJH 2C3GA 3OAZH 2GIYA 2V6HA 4JPVH 4YIQB 4X6CE 4MB3A 1EHNA 4FFYL 4BSWA 4YLQT 4N1HB 1NCBL 6FABH 2Y5TB 4QHMB 2BRRH 4MHHG 1NGYA 1KJ2H 2VLJD 4OZHE 1KIRB 1PQZB 3WS6A 2VXUL 1P4BH 4AL8L 3ULSB 4ZYKB 5TH2A 2QQNL 4FQXA 3K2MC 1WBZB 3VXTA 4ZNCD 4MZ2A 3P0YL 1LP9F 3BEVA 1NUGA 2HKFL 3PWJA 4P2QB 3I02B 1NFIA 2NTSP 3ALXA 1NMCC 2OSLB 4QNPE 5DGRA 1F3RB 5EU5B 2QKIB 4EZMA 3CVHA 1H3GA 3LQAH 4P5KA 3AAZA 3GSNB 1N6UA 1B4JH 3QO1A 2R69H 3RI5K 3B9DA 2HTLC 5J1AA 1GGCH 2Z31A 1QVOA 4LHQB 2YEZB 3FB8B 2BC4A 3UDWC 1U93B 3VFOA 5DJAA 3BJLA 4KVNH 1CE6B 1HXYB 3I2CL 3D48R 3QDMD 4UT6H 4NKMB 4JN2B 3U9PH 1JF1B 4IJ3B 2FX9L 1DSFH 1RMFH 5K9QI 3OGCB 5I66B 3S36L 3RWCA 1HDMB 3F12B 2EC8A 3I6KB 1INQB 3IDIA 5A40E 1CFBA 5KBNC 3FFCD 5L9DH 3HR5B 3VFTA 1A9BB 1BJ1H 1DBMH 1ZANH 5IUSA 2F53B 5KZCD 1AGEB 4QTIH 2X1WL 4EUPB 5EZLA 1KYOJ 4AYFA 5MENA 1PGRB 2YSSB 3FN0H 4IRZL 1CFTB 4NUJB 3D69B 4PJ9D 1IT9H 2Q7YA 4HX1A 2ZJSH 4N0CC 1DBBH 1NFDB 2NW3B 3X12A 35C8L 5KSAC 3HI5L 2FECL 5IJKA 3E2HC 1N3NA 4XCCH 1KENL 1NJ9B 4DVBA 3BIAX 3OKKA 1WT5A 5KSAB 3L5WB 3GJFA 5JPNA 1VHPA 2J5LB 4ODSL 4UTAH 3O2WH 4O2CB 1NL0H 5FGBC 5C08E 2WK2A 2IH1B 1P7QB 5DQJB 2CJUH 2X4SB 1CLYL 3UTSE 5SWZB 2XYCA 1NQBA 3BWUC 1QSEA 2Y23A 5HDQH 5C0BD 4OF5A 3PWLB 4XPFH 3F7YB 1DL7H 4S2SA 1DQJA 4Y16B 4HEME 3CDFA 3QEHA 1EX0A 3D25B 4NRXA 2E7CA 3REVB 1YEKL 3NCFB 4MLSA 3DRTA 4LCWD 3HAEA 2YC1B 4Y5XC 2NXYC 1UCBH 3LKOB 1KCRL 1T1ZA 2B1AL 3BH8A 3FONB 4O58L 5JA9A 1HKFA 3SDDA 3MNZA 1RURH 3TO4B 3E1F1 4MCYA 4ZUSB 1J11A 1RJCA 4PJFF 3OKDA 3CAFA 2CD0A 2GTZB 2EH7L 1AKJA 5DXWA 2X10A 3IXAB 4HDIA 4PTUB 5C0DA 4LFHD 3JWDC 3ETBF 4JFDE 4C56A 1YY8A 4JFDD 3O4OB 5EA0H 4X6CA 1I1YA 1BEYH 1SYVB 5HHVH 2NXZB 4X5XB 4K7PY 5T3XD 4WEMB 4HK0B 3O2VH 3PJSB 1KN4L 4X6CB 4MB5A 1OM3L 3SE8L 1LMKA 4NQDE 3RWDB 4ELMF 4WENB 2R0ZH 4PTUA 1CDGA 4I3GA 1MFEH 1A6PA 4PJ9A 2QADD 3T4AA 5F96H 3MRFA 4ZPTA 5FK9B 1WIOA 3P0VL 4BA8A 2OR8A 3EFFA 4S1SL 4HUVA 4K7PH 3T77B 1BM3H 3NAAL 2KBGA 2NX5A 4CGTA 4OLXL 4AM0A 4AK1A 3WKMH 1QFWI 2HP4A 2Z9TA 5C0AA 4C4KT 3VJ6B 1IJ9A 1SY6H 5A16B 2VDQL 3HAEB 5CINH 4XCEA 1U0QA 3H42L 3D1MC 4QRPE 3VXOB 2BOCB 1H3WM 5CP7A 1U3HD 1AC0A 3O8XB 1I4FB 3IRZA 3KWWB 4XNMB 1FE8L 4IOIA 5DRNB 2EDRA 3GSXA 1V7ML 1TJIH 4QXUL 1ZT1B 4XPHL 2YN5A 4ODVH 4BKLB 2OM5A 4NBYB 4U6HB 1XR9A 3S35X 1D5BB 4Y1AD 1UYWL 1OD9A 3B9KD 4YX2H 4GUPA 1S7QB 4Z95L 2P5WD 4PP1C 2JJTA 3PL6B 3QFDB 1MQKL 1MWAB 1CFQA 2YXFA 3RWJB 4YWGL 2YA2A 2VXQH 4GMSL 2X4OB 4V2BA 2FIKB 3BRGC 1E27B 2X1XR 5LJYH 4KKNA 3NCJL 5DO2C 2NY3B 3KPPA 3VI4E 2FHBA 1KB9J 4CVUA 1M7XA 2VZUA 3HPLA 4PJXB 4PGJA 5BS0D 1S7RB 1SEBB 3S34H 1KT2B 3HTLX 1CFTA 1TTGA 1HOCA 2OP4L 3OF6D 3WIHH 5J12B 3T4YA 2M8XA 1RU9L 1QBBA 5I2IB 2ZG3A 1CL7I 4NQEA 5JW5B 2X09A 1K3IA 2NY0D 3IDGB 4KI5D 4BFBD 1IGTB 1ZA3A 3BMWA 4M48L 3LSOB 4LPWA 5C09E 5ETUB 4L4VA 4HH9A 4L9LC 4KRPD 1I1AB 3TH2T 2XZQH 1FVCA 1FHGA 2IG2H 1RIUL 2ZCLL 4HJJH 4PJGF 3KYMB 1U93A 4G3YL 3RVVD 4PD4K 1NEZA 3ULVE 1T22B 5JXAH 2ESVB 5E6ZA 3RUGE 1NAKH 4QO1A 5CJXA 3FN0L 4IRZH 3RNQA 4YHYB 3AC0A 5FA4A 3S4SA 2VE6B 2H3NB 2IBBA 3K81A 1UT9A 3PP4H 2HT2D 4I18A 2DQUL 4ISVA 3WFCH 2Z8SA 4G43A 4XAKE 2LFGA 2GQHA 4HKJA 2BX5A 4MA1C 3AB0B 4XPFL 2R0WL 2H2PC 5DK0A 1SJXA 2KUTA 1R3JA 3KR3H 5C0CE 3KXFE 5IW6B 3WIHL 4Y1AA 4KJQD 4BFIA 1M05B 4M8QA 2B4CH 1GZQB 3TO4D 1T2QH 4N5EC 2Y6SD 3IJYB 3AFLA 3ILPB 3T0DA 1I75A 2PYFB 3C8KB 4Z77A 2DYPD 1JV5A 5J11B 1YDPB 4GW1A 2DQHH 2J88H 2BVUA 1E4KC 2HKFH 4HWZA 3SGEH 2AK1L 4QNPF 1DP0A 2YPLB 3QWOA 2P7TB 5JNYB 3PWPA 2ZCHL 2E6PA 3GRWA 5I71C 3TBYA 1H8NA 3IT8D 3IF1B 5KOMC 3ET9F 1BQLL 4JFEE 5AZEL 4FN0A 3QO0A 2NPLX 3EDJA 3SDDC 3MLZL 3PGDA 1P4IH 2CMRL 4MXQD 3D0LB 5T1KA 3IS0X 3MRJA 3STZB 4HC1H 4JFYA 4OB5H 4KRPC 2XKUA 4UBDC 3ILQC 3FB5A 5B8CB 1MHPL 3MBEB 4R0LC 4RGMB 4UDTB 3C08H 4XP5H 1G7JA 3FB7A 1S7SB 1J1PL 5I1AA 2H1PH 1MLCA 1RZKC 2DQCL 2DLEA 4QF1A 4RGMC 4N1EA 1D7FA 3SE3C 5A2JH 5IM7B 1OW0A 3MRNA 3WHXB 4FP8H 4UV7L 3SDAB 1L4IA 2V17L 4UB0L 2G9HB 4F3FA 3B2VL 2N4IA 4O02L 4K9EH 1BVZA 4XNYL 3VD5A 1YNKL 3TPUA 4D0DB 4F9LC 1BAFH 1U95B 4KPHL 4GQ9H 5DHYB 4NN6C 2YBRB 2IBZY 1WT5C 5AG9A 4RGNB 5LQBH 2EC9T 4E41E 1RUPL 3D0VA 4U05A 4FOMA 1ND0B 1NBYA 3DYOA 3B3IA 2I60L 1HCFX 1IBGH 4HCRL 5DEFB 1OGTA 3E3QE 1TJHL 1XGRA 4OKVA 4F58H 4JO1L 4KV5F 2ZSWB 1MWAL 4HIEA 4NNXB 4PJBA 3HZKA 4CUCA 3MNWB 5IMMA 3ULVL 1D5ZB 1F45A 4CBPA 4JY4B 4NWUL 2BVQA 1KB5H 5MERB 3AM8C 1Z9LA 2Z91B 3S37X 5DK0B 4F7CA 4P2RE 1T7VA 4L4TA 5JOPE 4TRPH 3WNKA 3GNML 1BJ1J 3QUYC 5C0JA 4NZUH 1T1YB 2CUHA 3RAJL 2EDYA 3TO2B 2FR4B 4I48A 3CSPA 2GSGA 3O6ML 3VU2A 2OTUB 2QTEA 2ITDA 1AGFB 5AYUH 4GKNB 4QEGA 1F13A 2XTJD 4JQVA 5D1ZB 3O11A 5AUMB 4GBXB 4PJFE 4U1HB 3HMXA 4DEPB 4TQEH 3QUXC 4LGPB 3BVNB 2XIDA 3ZT7A 2VRAA 5JMOC 3C5JA 1XGPB 4I9WE 4GO6B 2MKWA 3QFJA 4PRBA 5DMGC 1N26A 4LCWE 1C16B 4UI2A 3ROLB 4HLZG 1XAUA 3VD4A 2WANA 2CLRA 1W72B 1ITCA 1LD9A 4FXGA 2HLAA 5ISZA 4NQEB 5FUZL 3FKUS 3QA3B 2FX8H 3BGAA 4OZFA 3K3QA 1I1RA 5J6HB 3BPCA 1CLOL 5E6YA 1MHHA 3DUHA 2VZOA 4UT7H 1LO3L 2VQTA 1A7NH 4JM2D 4D0BB 5F1IB 3U7WH 1CR9H 4QTIL 3X11A 4XVSL 1ZV5A 3MLXH 3M17A 3MV7E 1HSBA 4WFEE 4MNHB 2PO6B 4KAQH 3BOVA 3BVNA 3T0EA 1U8JA 3GSQA 3PL6A 3S96A 5I16B 3BGFB 4HJ0D 1YPZF 3DHJA 3IYLW 4KHXH 3BSZL 3W9EA 3QRGH 4PV8A 3KPMB 5KJRL 1NCCH 4DFHA 4YHNB 43CAA 3F62A 2NXYB 3QIBD 4OZGE 4XNXL 2H26A 3UTSB 5F21B 2IALA 4BZ2L 5IBLD 1F4WH 1U8NA 5BXFA 4AEIH 4AT6A 1EMTH 2A9NL 3X3FH 3WXWL 5HJ3B 4OIIL 4PGZA 3MLWH 4OLZL 4EKXA 4AL8H 5D1QD 4E42A 2P5EE 4JO4H 1IFHL 2VAAB 4LLUA 3QNZA 1C7SA 4NRXB 4XZUB 2UWEF 5KSBB 2XT1B 1CGSH 4MNQD 1JTTA 3NTCL 1JWSB 2Z4QB 5I17A 2WUCH 3C5JB 5I73C 5INCA 5CJQL 5L2KB 2WAHA 2OQJB 3GDBA 3HG1D 2W0FB 5SWZA 4APQC 4BFIB 4HXBH 3VW3H 3DX8A 4Q9QH 1RI8A 2Q76B 1NLDL 1JWMB 3DRQB 1CDYA 3VRIB 5L2KE 1TZHB 4OGXH 3VXRD 2NY7H 4B5EA 2BY2A 5C0DB 2YD9A 3GSVB 4HKJB 1AHWC 3FQRB 2MFNA 1IZJA 4H20L 3PWNB 4MD4B 2DLHA 4RAVB 3FO9B 1TZGH 1MCJA 1C08B 2X44D 4EXPX 3S4SG 1KFAH 2ATKA 4JGMA 2DQDL 1ZLWH 4MA7L 5I8EB 3IFPA 5I1EH 3WUWA 3NFNA 5E4IA 2D4DA 4MD0A 5SV4A 4WV1A 1TZGL 4OCLC 4P23C 3KLHD 3REVA 2HMIC 2UYLB 2IMMA 3IKCA 1AQDA 3CMGA 4PRIB 2J2ZA 3K4ZA 4WFGE 5HDBE 1CGVA 2BXYA 3CXDH 3D3VE 1OGAE 3KS0J 2D7PA 3FB7B 3BXNB 3TVMB 3MBED 5CCKL 1IGFH 2VZ1A 1F4AA 4M43H 1NCWL 3PWNA 4MD4A 4KDWA 5J3HD 5C0BA 3FHAA 5KTEL 3MRJB 4YHOH 4X8JB 4WTWA 3C09C 1U8HB 3NCYP 3TPUB 3T3PE 1JN6A 3CC5B 1UA6L 3BQUD 1LGVA 3OKKB 1PBYA 2HT3D 1F2QA 3EYVB 2XKSA 1OAXH 4JB9L 4DVRL 4ZS7H 1RV6X 2FJHB 4P5TD 4TNVK 3ARBC 1IQDB 3SE4C 5C0CD 4XVJL 5IIEB 4M7KH 1Z5LA 4G8EA 1J0ZA 4P4KB 4XXCA 3HUJE 3O3AA 5EUOF 3SE3A 1AH1A 1MEXL 1U3YA 2CGRH 2R23A 3AREB 2P8LB 4G9FD 1X5IA 2DTML 2Y07L 4ZAKA 3R8QA 3HZMB 4JFEA 1XGUB 3ULVF 3PWPE 1BQUA 1RUPH 2CKBL 3T1FA 3DBXA 4JFQA 3QUZC 1KN2H 5J13C 1UH3A 3R06A 3P11H 3MUZ1 2EEDA 2F5BL 3DURB 1T0NA 1BZ9B 5JNYA 5J13B 2ADGA 2VLRB 5IHLB 4X7TB 1KTLB 1MRCH 4K9EL 5IT2H 4I77L 3KG5A 3PQYD 3MLXL 4MA8L 3IDNA 1QVOB 3CH1B 3UPRB 2AV7A 1QSFE 2D9QB 4HIIB 5C9KA 1N64H 5I76B 3SOBH 4N0UA 1RU9H 3ZHKA 2HVKB 2NY5L 1V7NH 3OJ2C 4OKDA 5CP3A 5EA0L 1T22A 5B3JF 5C0AD 3S88H 2WBJA 4FQHB 1SMAA 4WWKB 3RJDA 2FATL 3FQNA 5TE6H 5BS0E 3PV6B 5B38B 1A7PL 2EIZA 4D0BA 2RFXB 4LLUB 1G6RL 4V1DD 5D1ZD 1OTUC 3I75B 4G6JL 2EE3A 4X5LA 1JHKL 2V5SA 5AZ2H 5IK3A 5I75C 4MHHI 4OCXH 2OCFD 5ESAB 1JF5A 4DOHE 3RKPA 3K8LA 5DC4B 1S7RA 1D5MA 1ZLVH 3S98A 5HYJD 4KTDL 3ULUD 4JZJC 2VO5A 2DYPB 3WDIA 1TMCB 1NGXA 3H42H 5TFSL 5FO7B 3KWWA 4XNMA 4A6YH 4OCNC 4F37K 1MREL 5E95B 2N7BA 3H9HB 5HI5D 1NANH 4JGUA 4NN5C 3A67L 4EDXB 1FZJB 4GUPB 4ZUUB 3C5SA 5T3ZL 3TEUA 1MQ8A 3O0RH 4ONFL 4F7PB 1FDLH 2D03H 3V5HB 1EUUA 1KENH 4OFDA 4ZD3L 4ODHH 5IW1B 4KK5C 4HUXA 2APXA 1CLYH 4I9WD 3O8XD 2AJVH 2IADB 3F7RA 5FHAL 2FIKA 4NNYA 3LZFH 3CXHK 3O45B 3V0WL 1CFSA 4WFHE 5JOEA 5TQ0H 4N0UE 5CGYC 3H9SE 4IOSD 2GUOB 5FHBH 3TV3H 4YHZL 4UDUA 4PRHD 1K4CB 3V95A 3BAEL 3WLBB 2VDNH 2R2BA 3ZDZE 4U1NA 3ZTNL 4XVUD 2BVEA 2NW3A 1LO2H 3VXSB 1FRGL 1JIBA 4LDOB 1WEJL 3VFRA 5C0EA 4XVSH 1HHGB 1ITBB 1OSPL 1A02N 5E9DD 1QD0A 3GZKA 3OX8A 1XF1A 1D3CA 5E8DH 1BZQK 3O41A 4PRDA 3VXSE 1TENA 2I27N 3CUPA 5IROC 4R4ND 1Z3GL 1RUML 4MDJA 5INDB 3MJ6A 1Y18A 3LN4A 1UXSA 4YO0A 3LHPL 4MNQA 3LKOA 3QXDA 4GAJH 4OSUH 1CD1A 4YWGH 5KSUB 5ANMB 1MPAH 2VERN 4LLMB 4KK9D 1FGVH 2GK0B 3MCLH 5FCUH 5IJVB 1X5GA 3TYFA 4HFWA 1A4KA 3S97C 4HUXB 4MQ7A 2R4SH 2WBJD 3MLWL 4OLZH 5ANME 1A14H 1FGNH 1ZVSA 4JANB 4TSAH 5GJSL 1RZKL 1JWUB 2D7TL 1SM3L 4KKBC 1P7QA 1IARB 3T2NH 4QT5A 4CVXB 1HKLH 4M7KL 2ITCA 2HLFC 3TIDA 3L5IA 3EIFA 2DM2A 1MCSA 1NC4A 3SCMA 3V4UL 3I3BA 3U0PB 5EU3A 3JBG7 4JO3L 2QBWA 1GGUA 3AXLA 4XCNB 4F37F 3VXSA 1MI5D 1OT1A 3VXMD 2AJXH 3UMTA 1MCIA 4X4ME 4KGLA 4CVXA 5HHME 1KB5L 2XQYG 4OZGF 4RAUB 2FZ3B 3EO0A 1WTLA 3PE9A 2E9WA 4YEFA 3ZTNH 1PLGL 4JFDA 4C56E 4DCQB 2HKHH 1RPQA 3MRNB 4GSDL 3WHXA 3EYSL 1F6FB 1G9NH 2DIBA 1OAUH 4KK8C 4JVWA 3RWCB 1JGDB 3EYFB 5EO0B 5FO8B 5ANMA 1CBVH 3F7YA 3G08B 1CG9B 1I1AD 4IRJB 4EXKA 1TITA 4HXAL 5E5MA 3RU8H 5AD0A 4P3WA 2MCG1 4JCMA 1BX2A 2J8UE 2IC2A 3FB8A 1H3VA 3V4VL 5T3ZD 1UQSA 4NOBA 4P46C 1S8DB 1XIWA 4MAUL 2BERA 4UNTA 3QCVL 2UZYB 5KSVB 3QUYA 5ALBH 1KJMB 2DJSA 1OGAD 4HT1L 2EDNA 4PJ7B 5BOPA 1J8HB 4KROD 3D39B 4U7SA 1N3NB 1X5XA 5FYLD 2QQLH 5BVJA 5I1CH 4HLJA 3SKJL 1NCBH 1DUZA 4RWHA 3IFLH 3U0TA 3HI1B 4Z7WF 1QBMH 5DMIH 3WFZA 2F8XC 1JGVL 4QHUA 2W9LA 3D69A 1S5IH 2X40A 1P84J 5DJXB 4CN1A 1PLGH 1HH9A 2VLMD 3VFWB 3ILPA 3ULUC 3LKQA 1T5XA 4NDMA 3CVHB 3ZE1E 3BW9B 3RIFF 1A6UH 3U6RA 4DQOL 4L29B 1RUAH 1J0IA 1FIGL 1UWXH 4YHPB 1CIUA 2ADFL 1IFHH 2X4PA 3FQNB 2A38A 2ZSVA 1OTUD 1YUHB 4GMTL 5FA3B 4PJHF 3VFUB 4KDVA 1EHLH 2DTMH 3RP1A 4UNVA 1TCRA 5MEPA 2Z31B 5BS0A 3QZWA 1OAYL 5SX5K 3EYVA 4FABL 2A0LD 1JFQH 2Z31C 4UT9L 5TF1L 1QBLL 3QHZL 1DE4A 5GRVK 1T2QL 3AS1A 2CLZA 4LPYA 4GRWF 1TXKA 5JUEH 2W92A 3CZFB 4R7DB 1KACB 2DYPA 1TCRB 4GW4B 5D93B 1PG7W 2EE2A 4HZLA 1JPFA 3QAZC 3V6FB 4OUOA 2VLRE 2W9EH 4JN1L 5ALCL 5L9DL 2Q20A 1LO2L 4YHPA 4P5TA 4LIQE 5C6PB 4LRIC 4Z7VE 3DX6B 3IKCB 2C1OB 2AABH 3RL2A 2EEAA 5GRZA 3SEPA 1FG9C 3MQIA 1FAIH 2A6JB 1U58B 4E0RA 4WUKL 4HGWA 1QLRB 3KLHC 1MCRA 1T83A 3TYGL 3VA2C 1VFUA 4OJFH 3VXUA 4WCYL 5BVJB 1QBLH 2VLJE 2DD8L 4NIKB 4X6BA 3LEVH 1NBQA 3I3EA 4ZFOL 3V7MA 1Q9LA 1ZOXA 2VDLH 5IQ9A 1TJGL 3KPOA 4U33A 3ZKXB 4ZO9A 4LCYA 4UIMB 4ONOA 2D31A 3ARBD 3ZKXC 1J1OH 2VABB 4XXDA 3QCUL 1ZA6B 1A5FL 2JE8A 5EG6C 1NGQL 3NN8B 5D7IB 4XNUH 1Z0MA 1GHFL 4U4BA 1HHJA 1B4RA 1UCBL 1IKNA 1QSFA 2VLKD 4M9PA 4A6YL 1MJJB 2ZCKH 3LS4L 1BLNB 4FS0A 2ZUQB 4JPWL 3VWJD 4PD4J 1NMBL 5IW3A 1I9IH 2ERJC 1FQ9C 5IJVA 4P2OD 5CLWA 1RZJL 5DUML 2QJDA 4ZUSA 2GKIA 1MIEL 2A73A 2Y72A 4NJ9H 1IILE 3U0WL 3EOBA 1U8QB 4HFUL 1ZVHA 2FZ3A 3ECBA 2ED8A 4MD5B 8FABA 2UWEE 3QDHA 4KZEH 1GCFA 4G6ML 4OZHA 3WXWH 1MY7A 3UTQB 2OXGA 1JVKA 4WFGD 5IEHA 4Z7VF 4G8IA 1V7MH 3GSVA 4U6VL 3KXFD 1MVUB 2GITB 1QLFA 1VKXA 4H1LB 1FBIH 1ED3A 2JK5B 2CRIA 1X6NA 4G42A 1FFPB 3BKJH 4JM2F 1AD0A 4Z5RA 4YEEA 4YDIH 3FRUB 1CLZL 5EOTB 2NY5H 5DEZA 4LPUA 4CAGA 1A1MA 3T0WA 1QG3A 4A2LA 4KKAC 4OLXH 2I9LB 4WIQA 3S8WA 1A4KB 1MCWW 1T89C 15C8H 2VZSA 5FOBA 5EDXA 2GW5A 3CZJA 4APQD 1NGZA 3PXHA 3S5LG 4WU7A 3TIEA 3OB0H 3G5YB 4PJEE 5EOQL 3P11L 2OTWB 5D7KD 5IFHL 2F54E 1B0RB 5C1MB 4YPGB 3ZKNC 4NO5A 1S7XA 1D6EA 3C6LD 3DV4B 4IMLB 4NO0A 3UX9B 3MRPA 4XGZA 1FG2B 1R3KB 2PETA 4NWTL 1FNLA 1MHPH 4PJ5A 1NDGA 3BRDA 3WV0A 3RBSA 1KG0B 1TVHB 4XVUC 4PJCB 2CQVA 2DQTH 1IQWH 1UEMA 5FYJD 3VFMA 3NGBB 4KMLB 2IMNA 1SY6A 1MLBB 1NGPH 5C2UB 3ELAT 4GG6B 4TSAL 1OB1A 3T8XA 3RWEA 2MCPL 4ZO8A 5D7LA 1JWMA 4OGZA 1IAIM 3TN0A 3C5ZA 1AO7B 1VPOL 4M93B 5HGHA 3QUXD 4LCUA 5IB5A 1CXIA 1VGEL 4LDLB 3WS3A 4MNHA 3BSZH 1KLGA 4LSQL 5GZNC 5CJ5A 5AWNH 3G04A 4BQ9A 3X3GL 5C0JB 2MQ3A 2AJUL 3D39D 4N90D 3BHBB 2VDRH 3MFGB 2EEBA 2P8MB 5F9DC 1EVTC 3ARDD 1CR9L 2V5TA 4TVPE 1A2YA 3PUCA 5HHMB 4MJ5B 5IFHH 4NO3A 5BQ7B 4XBPA 5H35A 4ZOCA 4PRPD 1F97A 4JEGB 4NM4L 4RDQG 2H26B 1AQKL 3EJYC 4U6XB 5H37G 3MA7A 7FABH 5D7JB 3MYZA 4GH7B 4R96B 2EE6A 2C4FT 3LY6A 3DX7A 1CGUA 1T04A 4M8VA 4QXTB 1HHKA 4YHZH 3TV3L 4WO4C 2W59A 5E8NA 1U8IA 4FTVA 3MV8B 5DTFB 4LARL 4PYHA 1KPVA 2QADB 3K2UL 3O6KH 4XHJC 2ZNXA 3TVMC 5TQ2H 3B6SA 3NPZB 4MQXD 1AGFA 4FXKB 1PSKL 1O5DT 3JWOL 4PY8I 3SPVB 4Q9BA 4KRPB 3WHE1 5FUCC 2XWJB 1E4WL 4TULH 4Z7WA 1CN4A 4KQ3H 4H88H 1LP9B 4QCIA 3O3BA 1DBML 3I75A 2FB4L 2AQ2A 3SDAA 3QUMB 5IHZA 2JKXA 1QPXA 4Y5VA 4CKVX 4WHCA 3BP5A 3TA3A 5CHNA 3T0BA 5EOCJ 3I84A 2B2XL 1KNOB 4ZDHA 2C7UB 3QEUA 3OV6A 2BFVH 3EO1A 2RR3A 2DM4A 3I50L 4LCCA 4G7VL 4O5LH 1IGJB 3BDYH 5FGBA 3OAUL 5T1KD 5CEZE 3ULVD 3MFFA 4N0UB 5FYKD 4ZXBC 2Z35A 4RWYH 4OFVA 3BPLB 4F33B 4KTDH 3I9GL 3QIWA 3ARGD 1CK0H 4KKCC 3IU4H 2P5EB 3D3VA 5JDSB 3VMPA 1G6VK 3BT2L 5SWZD 1Q94A 3GBNH 5DMYA 3NH7H 3TBSB 3BN9C 3B9KB 2A6DB 2DL2A 3P9MA 5BRZB 2X1PA 4OFYA 2GJZB 3MYJA 3QIUB 3U46A 3NPSB 3OKNB 1TVDA 3DBXB 1N4XL 4JFQB 3CX2A 4WWID 2BNRD 6FABL 3V6OE 2PTUA 1FH5L 4XMPH 5E2TH 2V7HA 1GC1L 4H1LG 5IW6A 4RGOL 3QI9A 3OBAA 2X6MA 1FL3B 5JHDB 3BDYL 5GZOD 4ELMA 4GRWH 1T3FB 3U7WL 4X9FA 2PCPB 3BIKB 5KS9E 4ISVB 4PJHE 1T7XA 1A22B 4Z7UF 5EOQH 3SGDI 2NMSA 4JRYB 4G9FE 3VFPB 4PP2A 1FZOA 2YS4A 2A77L 2LTQC 3WLWC 2V2TB 3MRMB 3O81A 4DUVA 5ALBL 2VE6A 3CD4A 4DEPC 1T21A 4S1DC 4ZPVA 3QIUA 1W72H 2VXVH 1DBKL 2W60A 4JKMA 3H0TA 2DWEA 3CFIC 5GGQL 1MCHA 3D3VB 3K4AA 4YDJB 4AENA 1CXFA 3TA3D 4EIGB 3ORJA 5HGDB 5FHAH 5CAYB 3PP3H 5HHPA 1J86A 3BQUA 3VG0L 4MQTB 2ZG2A 4GG6F 4XPGL 1EA9C 4JG1H 4GSDH 4ETQA 4HQQH 3MFFB 3LKSB 1HK6A 3BIKA 1LQSR 5CMAA 1OQOA 1RZIB 5D2NB 3U36B 1A6TB 1JUFB 1FVDB 4G9FA 4KI5C 3MOBH 5DVOA 3BPNB 3KXFB 3QDJE 5T5NG 5BZDA 1KNOA 1S9YB 5D9SA 2D9CA 5ESVB 1YMMB 5KN5A 3MCKA 4FQQB 3KR3L 5C0CA 2H2PD 3WL9B 3D85A 2J8UB 3MRKA 3CVHL 2DWDB 2E27H 4IMKC 4M7JH 5H37H 4PJ8B 3HMXH 5CIPH 5K9JH 5L7XH 3L3HA 4CMHC 3VGAC 4KJPC 5AZ2L 5INCB 1JNNL 3KVQA 3WN5B 1WQVT 2WINB 4HIHA 4F9PA 2DJUA 3IU3A 5GGQH 2MSPA 4XWGH 5IVNA 1FLRH 2VOTA 1I1AA 3TCLA 4WO4D 2FHCA 5C8JB 5HPMA 1MHHB 5EO1B 3FT4B 1E6OL 4QRPB 4WI9A 3OJDB 1QFHA 3DTXB 3QXVA 3LRSA 2BCKA 3C6SA 5GGSY 1IQWL 1TJHH 2HRLA 5LXGH 1R3IL 3O45A 5DA4A 1QO3B 5D2LB 3IETA 2OJEB 3SQOL 3TCLB 4K3JL 3Q5TA 2Y9RT 2LU7A 3FQTB 4ZTOH 4LPCA 4Y4FC 1JMZA 2V5YA 2YD3A 3MNVB 4LGSB 5EOCL 2J8UF 1SEQL 1MJ7H 4PV8B 3V5HA 3TN0C 5IV2B 4ZUWA 5GHWH 4XB7A 4M9OA 4F15C 3WS3B 1U92A 3SKOB 2F54B 3L5XL 1G7LA 5B4MC 4D0CA 2HWZH 2W1NA 1XR9B 5EWIL 3GIZH 2R0KH 3SDXF 5CEZH 1IAMA 4MNGA 4P4KD 1X6LA 3VXRB 3SJVD 3U83A 1NGXB 4HW6A 1JGDA 2R69L 3Q5YA 5ACZA 5JW4Q 5ITFB 5FV2A 1EMTL 4HUUA 1PVHA 1QO3A 4OLWH 3AMLA 4XWOD 3VH8G 1R5VB 2X4TA 2EDOA 3VJ6A 1QSZA 5GQBA 1AY1L 4QRPA 2PXYD 1ZEAH 3BO8B 3VRLF 4QGTA 4KZEL 1P5VA 4FNLL 2I5YL 1MCEA 2XTJB 1C5BH 3A6BL 2NXYD 1ZHLB 1OGAB 5EO9B 3PV6A 1IKFH 3SGKC 1S78D 4OSUL 3WN5A 1XGPA 4JRXA 1GGIL 3U9UB 3TFKD 1JRHL 2JIXD 4NQCB 3RWDA 4WVRA 1OAZL 5CCKH 4Y4HB 5GGSB 2DQUH 1P7KB 3NIGE 4Z7UB 4FTVD 1BFOB 5DD3H 4PJHA 4WEUD 4OCXL 3OMZA 4Y4HC 5J4MA 4Z76B 3VFVA 1ZT1A 1A6VL 1I1FB 2DQEL 2HN7B 4PLKC 3R8BB 1DN0A 2AJZB 1ZLSL 2FGWL 4W70A 3CDCA 5BJTB 1JCKA 4NBZB 3O2WL 2GTZA 4LLMA 1D5IL 5IB4B 1F42A 1H8SA 1K6QL 4YJZL 4GBXC 5K9KA 4ONGL 1WF5A 2ICWJ 2EDHA 1A6TA 2UY6A 4TNVF 3ARFA 4KVCH 3C6SB 2C4FU 3JWOH 1LO5B 4X9GA 4X4XB 2EYSB 3OF6A 2B8OT 1ZWIA 1AQKH 1CGWA 2F58L 4N0CD 2ZJSL 3V0AC 2UWEA 4OCYH 3D0LA 4WI2A 3HE7D 1WWCA 1SBSL 3MV11 5E6ID 1TPXC 5BV7L 4Y16A 1OAUL 4YXKL 4QYOB 4JLRA 3ZZ1A 4JJ5B 4E41B 3HMXL 3W5NA 2AI0H 1I3GH 1B0GA 3NIFF 1H3UA 4G8EB 4P4KA 5DD6A 2CUIA 1YYLH 1HHJB 3L3HB 4U1JB 4OM1L 3E8UL 1YYMH 4JG0L 2AERT 1W8NA 1QOKA 3NTCH 4NZUL 2Z8RA 1VGEH 2J8UA 5IHBA 2EIDA 1U91B 2QHRL 1P7HL 5CEXB 5HYQB 3KLAB 2GSIA 2WQRA 3L5WA 5JPNB 2EZ0C 3WFHA 2OYPA 4OTXL 1B4JL 4IRSD 3TZVA 4RFOL 1EFQA 3O9WD 1IAKA 2R4RH 5BV7B 3CVIH 1D9KA 1CL7L 3IDYC 4AQOA 4AIOA 1P9MA 1FV1B 3STLB 3QAZB 5ESQA 1MFDL 1P7QD 1QRNB 3P0GB 2G5BA 4NM8H 2QSVA 3KPNB 3EYQD 5TE7H 1PFCA 5C0IB 3MJ9L 3VDCA 1YEFH 1YNLL 3L5HA 3D3VD 4PGDB 1BQHG 3V6FA 1RIVH 2WUBL 3GIVA 4KTYA 4K3DH 3S88L 4OI9A 1QUNA 5I1DA 4N5ED 3V6OC 3WLWD 2IAMA 4U3HA 4XCFL 3QWRA 1HXMB 5CINL 1NC4D 3KPQB 3U2SA 3LKNB 2Q86B 1DDHA 5JXEC 5ICZB 3AAZB 4DKAA 3W11D 5DJYA 2WWKO 1HCVA 4RGOH 3HMWL 3V5KB 4B41A 4HS6B 4K8RC 5FUZH 1VCAA 2VWEC 5CHNB 1MF2L 2YPLE 3D39E 2X4PB 4ERSH 3MLTA 2ZSVB 3MX0A 1KGCD 4LHUA 2Q3ZA 3IDJB 2C9AA 4MQXC 3T04D 4R8WL 1G7MA 1A9BA 2XACC 3BDBA 3WEXB 1CFQB 3Q1SL 4WI7A 5HHOB 3GUTA 2IJ0C 3VI4F 3RNQB 3EOYG 5FA4B 4NT6B 3L3JA 2DQFA 3QUML 4L5FH 4KKCD 4FTVB 1CK0L 5DTFA 3BZEB 3IJSB 3QPXL 1Q94B 3G9AB 4JZOA 4XAWH 5T3ZH 3QG7L 4NKDA 4OF3A 5E8PB 1KJVA 1HQ4A 5CD5D 3BRFA 1I85C 4N90E 4ORGA 5CJBA 1Q72H 4YHNA 3LN9A 1GGIH 5EU6A 2F53E 4YFLI 3VWKA 4F33A 3QIUD 2UVFA 1XIWC 2FH8A 3CSYB 1A3RL 4PJ7A 3MLYL 1IGYB 1GGTA 5D7JA 4HG4K 5KTEH 3HPJB 4OQTH 2R0WH 4KROC 3RX8A 1IC4H 2VLLB 4GXUN 4M1DL 4U1SB 3QXUA 3EO9L 3IDJA 3OR6A 2P8PA 4JZNB 4NC0B 4UV4L 5BW7A 4OD1H 2QR0A 2VSDA 4IRJA 2PYEB 1TJGH 3LDBC 5IIEA 4NO2A 3FQUA 4G6FB 1R3LB 5EB9A 4XT1C 5KG9A 2O5YL 4K3EL 3RWJA 3BW9A 1AXTL 3C6LB 3QYCA 3SPVA 3WJJC 2EDJA 1KIPA 1RK1B 3X13B 4Y1AE 1INDL 1PX4A 1I8LA 2D7QA 3BGMB 4R9HA 5F44A 4F57L 1KYOK 2GJ6A 4ONGH 4ZXBB 4F80A 1TIUA 3MV8A 5KS9B 5TJWK 4L3EB 2AW2A 3L3DB 3BDXA 2NY6B 4H1LA 3UPCA 4XX1E 2DF3A 4LF3A 1MLBA 3RZWA 4IIQC 4RBPH 2J1KA 3TJHD 1LVEA 5EUOA 4WWKD 4LAJH 3LPFA 3PIQA 3ARDC 2FECI 5D96B 3QEQD 3I6GA 4NKIH 1IM9A 3FHQA 3P30L 1F4XL 3BPNC 2VDKL 3ARDB 3SCMD 4O9HL 3NCJH 5CJQH 1U8QA 5DUBB 2RGSA 4I48B 3QEGH 1ZVSB 1YNTB 5GZND 2V5MA 4KKBD 3HRZB 3VRJB 1MQKH 1XCTB 1S3KH 3GO1H 3AROA 4YXHL 2IQAB 3TT3L 5MERA 4YX2L 2KH2B 4OZIE 3D9AH 2CSPA 1MCCA 1TCMA 2W65A 3HUJF 5GSRB 4CDGC 1L6ZA 3VDAA 1ZXQA 3MZTA 2IH3A 1AD0B 1FFPA 4JKPH 3PIQB 2OI9B 4FG6C 3VWJB 4ZG1A 3O41B 4PRDB 2Y25A 3P0YH 4OM0L 2OI9C 2NY2B 5IOPB 2VXUH 4XBGB 2H2SD 1KCVL 1QR4A 2ZKHH 4M7ZC 4Q9RH 1QNZH 2GTWB 2VDOH 4LSSL 2AJ3A 4Q7DA 5IFJB 5AYQA 1ZLWK 4HS3A 3ROOA 3ZYIA 2IPTH 5DJ8B 2CK0H 1K2DB 1G6RA 1B0RA 3N1QC 5DFVC 4ZUVA 2GUOA 1KPUA 2AI0L 2ENSA 4MQ7B 1Q38A 4KQ3L 4DGIH 2YR3A 1IEAA 1AXSA 4JR9L 1DVFC 3RVUC 32C2A 3D9AL 4CL7A 3L7FA 4F58L 1NGWA 4NC1C 2P42B 4HWBH 4GW5B 3LQZB 1QSEB 4KY1H 4WW2C 3GSUB 4X7FC 2V9RA 2JCCB 4J3OC 3FB5B 3ZDYF 1P6AB 4GW4A 2MKLC 4PJGE 4J23A 1FZJA 1RJYA 5JDJA 3QUKA 2X89D 5ILTH 4ODXB 3AGVA 4XWGL 5HY9A 5C07E 3V8CA 3RZCA 2XTLA 3TBYB 1XGYH 2EDEA 5DJ8A 1XF4B 2JELH 2P24B 5EBLA 3MV9D 3DGCR 1NBVL 4M5YH 4OF8A 1KIQA 3MGOA 1NFKA 3MRGA 5IVZA 1T5WB 2A6JA 4Q9QL 1MIEH 1QLRA 4MJ2A 1DCLA 4Y2DA 5JW4N 2CDGB 4WY7L 3SDXA 1CICC 3QIBB 2F15A 4GRLC 5DQ9B 7CGTA 4M7LL 1Q1JL 3MLZH 3GNMH 3HZVA 4Q9RL 5I18H 3RWHB 2I5YH 5C0BE 3H7BB 2HTLD 3VFOB 2VLJB 5JO5A 3HC3H 3BKML 3CZFA 1N2RA 3KPRE 4K94C 3ULUF 3D39A 1PEWA 4Q2ZA 3NFSH 5BO1H 1EXUB 1ORQB 4P5KB 1XEDA 4ZUWB 4P5MB 3RVWC 2R56L 2FJGB 3KPRB 3RPKA 2SEBB 4HCRH 4NKIL 1VEMA 5JZ7D 8CGTA 3JTSB 2DQJL 2XV6B 4X7TA 5MI0C 1S9YA 2VN4A 4NQXB 1MRFH 3G5VB 3G08A 5DA0B 3SJVE 3RWHA 3QHFH 2GY5A 3R06B 1FVEA 1Z6JT 2GJJA 1WAAF 3GHEL 4PRNA 3S36X 2X70A 4HD9A 4JFDB 5BV7H 4TSBH 1DFBH 4IRJD 4IS6B 5FYLL 1GJIA 3KPPB 1P4LB 3MA9H 4YGVA 3VGBA 2SEBA 3QCVH 4P46D 4HPYL 4LLVB 4Q6IC 5T5NF 2NCMA 1N0XL 3WSQL 3ARQA 4W6WB 4UV4H 5FM5M 3UZVB 1NC2B 4NCDA 3UJJL 5HVHB 2BHYA 2FGWH 1BQLH 5F7WC 4F7TA 1A7OL 1KB5A 3LQMA 3T0EE 1RJZA 2NNAA 4P48A 1DTUA 2BSRA 1EHXA 5LG1A 5IFAH 1KUMA 4NQSB 4YE4L 5ESVA 3VXNB 4XPBL 5KSBF 4XP6L 3PABB 2M26A 3T65B 1AI1L 4M61A 4HXBL 2GAZA 3GBML 1E28B 3O9WB 1I8IB 4MNQE 1L7IH 3W2DL 5HGBA 5L6YH 1FZMB 3MV7D 3QEQA 1BQHB 3IRPX 4NKQB 3HCVB 1IMHC 3AY4C 3ZL4L 2Y36L 3ARFB 2VLKB 4KUCF 5E00A 5T1MA 3OKMB 3ZE0F 3F58H 3NGBC 2HLFD 3JUYA 2G5RA 2R9HD 1WAAE 5I73B 4IDJL 4N0YL 4PJ9B 1A6AB 2GSIB 2CRZA 4A2MA 2E9BA 4MYWB 3MC0A 3F7VB 4OZIA 3U7AA 1AGBA 1N59A 1AGDA 4CVWA 2XN9E 2ED9A 2YN3A 2OZ4A 1N7MH 1M05A 2HT4C 2XZAH 4U3XA 1KELH 2UV3A 3QWQB 2JF1A 2AJYH 2W0FA 4H5SB 5C86A 3RVUD 4U2YA 1RIUH 4FQ1H 4J4PA 4UUJA 5DR5L 4ZDHB 3FMGH 4HDIB 2C4XA 5EC1B 4ODTL 5IWLA 2J4WL 4MJ6B 2IADA 4QRSB 5GGRY 5DLMH 4ZNEE 3QQ4B 1WGOA 1F4XH 2EIBA 4PJAB 3SO3C 2XWJA 2HYMA 1O7VA 4X4YB 1G6RB 1BECA 4G9DA 5DK2A 4RAUA 1DUYB 5HJ3A 4JFPB 1YZZA 2BOBB 1K4DA 3VGFA 1KPVB 4HKXB 2J12B 3OX8B 1BEYL 4I13B 4PBXA 1MELA 1EZVY 5E2JA 3NVQA 5ACMA 1HE7A 3AXLB 4XCNA 3W0WE 4JRXB 2AJZA 1HILA 2JJSA 1WZKA 3BP4B 5TQ0L 1H5BB 4X98B 1F6LL 2Z35B 2H9GA 3BO8A 4KDTA 3DIFA 3DX8B 3KPRD 2D7MA 2ILLA 2Q7NA 1BZ7B 4MJ5A 4NNPL 1UYWH 4RMSA 5TE4H 2YPVH 5D7KE 2XWBB 2BNRB 2ADIA 2P5WB 2MTPA 4DVBB 2D3VA 5CEYA 3TJEH 1KPRA 1S9WB 2DJ4A 5DFVD 2N56A 2OZ4H 4R4BA 2G60H 1HQRA 1YMME 1DQDL 1NFDA 3MRBA 3FO1B 1FZKB 4YO0B 1UA6H 1YMHA 2P8PB 1NFDF 3IFOB 1R5WA 1A3RH 4J1UA 2KQMA 3H9HA 2H2SC 2UZIL 3UYRL 1LD9B 2AXFB 3OXSA 3R0NA 3JVGC 4M1GL 4U6HA 5HDOA 3HNSH 1VGKA 3FOLB 4ZO6A 3ULUL 1TPXB 4YNYB 4JO1H 3WUWG 4LMQI 4LFHG 1NMAL 4OCRH 1I7RA 2XPGA 3TYGH 4YDIL 3MRQB 1U3JA 4FMKA 3MXWH 3SKOA 1WZMA 1ZE3C 3VFSB 5DURB 2OTUA 3PGCB 4LHUD 5ERWA 1V3JA 1FZKA 3KLSA 4JFFB 3FO1A 1UB6B 5T1LA 4GQ9L 4W81A 4YHKL 4GKSB 1YMMA 1DEEB 5DJDB 2I25N 1HWHB 1UWXK 4LSUH 5I74B 4MJ4A 5DJ2B 1NUNB 3H3BC 2Z0BA 2V2WB 3OG4B 1NAMH 5BV7C 1T20A 4WWKC 2W0LA 3RVXC 5DSCB 1JZ7A 2ZUUA 1F90L 1QR1A 2Q86A 3DWTA 3GJEA 5EPMB 3Q6FA 5CD5C 1DDHB 5F7FA 3W2DH 4YAQA 3X3GH 2YD7A 1A1OA 1RK0A 2XWTA 5IESL 1V3LA 4LLQA 1OP9A 1CS6A 3CH1A 25C8H 3UPRA 4WTZA 5I1DB 3EKCA 3DVFA 4GOSA 4P2QD 5F7KC 2XNAB 1FLRL 1WCBB 2EICA 3UBXG 2XICA 5D2NA 3U36A 2ZCHH 5BMFL 3CNKA 5HDLA 3MRPB 3RY6C 1L0YA 1G7MB 2HTKD 4F3FB 1G7IA 5E8OA 2MJWA 1G7LB 3IFNL 3M1BA 3RWIA 5HYJB 1U2CA 3REWA 4QTHA 4DUWA 1FV1A 3HE6B 1HI6A 3GEWB 4JM2A 4WUUD 1LEKA 2VDML 4I1NB 1EFXA 2FBJH 5F7DA 2HG5B 4WWKA 3CSBA 4UUJB 4Z78B 2ZP0T 5HYEA 3GGWA 4DW2L 2VLME 3ZKMC 3DVGB 4GAYB 5CWSA 3QEQE 3GHEH 4TPRL 5T3XL 1UKQA 3B2UC 1JZ8A 4XTRC 4OM1H 2CDFA 3MLVH 5JOFA 4PIRF 2J4WH 2C1PA 3WIIH 5HGDA 2FBOJ 1CF8L 4L8CA 3HA0A 4EBQL 3QDJB 1M4KA 1Q9OA 2XG4A 4NQEE 3SE8H 1NBVH 3SDDD 3CLFH 4WI4A 3GMOA 4QRQB 2DQIH 1Q9OB 5H8DA 5I17B 1U3ZA 3JTTA 4P23D 3RPIA 1KLFA 1OP5K 4HJGA 4UT9H 2CKNA 5D71L 3STBA 1RUQH 4LHUG 2NY0B 1YJDL 5KOVC 4HPOL 5ESQB 3HE7A 1P84K 4EN3A 1E4XH 4WO4B 3GGWB 4LEXH 4M7JL 2GJZA 4I5BB 4G8FB 2D2OA 1CDIA 2EH8H 4R2GC 1YN7B 2UZIH 3HI6H 2B1AH 4K71C 1IEBA 2LABA 4LSRL 1A4JB 4MXVF 1X5HA 3U4BL 1RZ7H 3LVEA 1KGCE 1KB5B 1I9EA 4B7IA 2WP3T 2NY1C 3O6MH 3OKNA 5M94B 1DJSA 3K46A 4DZBA 4BZ1H 4LQ1A 5I1LB 1T1WB 4RQQA 3S96B 1E4JA 1GHFH 1FGNL 5JDSA 1I8KA 3MUY1 3EYQC 5D6CA 2H45A 2WNGA 2ADJB 1EERB 3RRQA 3VWKD 2O5ZL 4JREB 1F4WL 4UAOB 2V9TA 2VXVL 4OLWL 2CR6A 4ZOBA 3TT1H 2ARJQ 1CFVH 3IDXL 4S11A 2YK1L 4P9HH 4AEFA 3BP7A 4IRSC 4Y2DB 5JIIA 2IALB 4JHAL 5MHSE 3CPLB 4HIXL 2FEDD 3EDDA 1F90H 2DQIL 3DHMA 3U0TB 1YEIH 3GIZL 2J6EL 3SOBL 2OR9L 4W6XB 2R8SH 1MUJB 4DKEH 5F93C 2WLZA 5ENWA 4ELMB 3ZDYE 5IEKA 4AJ0A 1BWMA 4H0GA 4CDHA 5C0GB 4X6FB 1OD7A 3BGFC 1BGXL 1DBAH 2PXYA 4P46B 3QHFL 1AO7A 4HAFA 4J3VA 5DYOA 5I16A 4JN1H 5ALCH 3GSOA 1KJ2A 3DX9A 5EOCH 5DSCA 1REIA 1MFNA 4TNWF 3QIWD 5ELIA 2DQCH 3MMEB 5E6IC 3QHTC 3ZHLA 1PSKH 2VLJA 1VSCA 3HE7C 3S5LB 2C3HA 5D1QC 2JIXA 1F4YL 2DDQL 4OM0H 3JTTB 2ED7A 3F65A 4GLRI 3CX5K 4P2RD 4U1LB 1T0MA 4P2QE 1U8PB 5A2FA 1UZ8B 4J4PD 4OZFB 3EGSB 3RQ3A 3CH8A 4J6RH 3P3YA 4NUGH 3PGCA 1KPUB 5ERWB 2W0KA 3SGDH 1JI2A 3H8NA 5D1XA 5CLTA 3SDYL 4LCWA 1F8TH 1J0HA 1H15A 4NNXA 4PJBB 4QHUB 5BMFH 5L8KB 1IL1A 4P2OA 5ECJE 4O2EA 5EZIL 5EO1A 5C9JB 4WU7B 5FK9A 4G7VH 4O5LL 4JPKL 1RZ8B 4PJ8D 1YMMD 3BKCH 1S7TA 1BFVH 4MAYC 4WI6A 1NFDE 3S3JA 2E9JA 2B39A 3EOAA 2X5PA 3VXUE 4KKLD 5GSVA 3W9DA 5HHQB 3TN0B 3O2DA 1S7QA 2XXMB 5I19H 4LCIH 4QCIB 3U1SH 4PJGA 4XPBH 1HSBB 4TRPL 5EU6D 3T0EB 5GS0C 4NP4H 2WIIB 2BDNL 1E4XI 5TDNA 1O7SA 2NR6C 4XNUL 4R97B 4TSCH 3MR9A 1AC6A 4M4RA 1XGYL 3GSUA 5T1DL 4M3KB 4BSJA 2ZPKL 2PXYC 1J1OL 4KGJA 2VH5H 4FQPA 3SDYH 3S9DB 4NRYB 2Z91A 4J6RL 1M7DB 2VXTL 3H9YA 5DWUH 3U30B 4Y5XA 2XFXB 4Y19A 5I1HH 3V4VH 3MNZB 3PNWB 3KNBA 3EO0B 3ARDA 1PAMA 4KMQA 1XMWA 7FABL 4H20H 4PY7A 3MA7B 2JLLA 4KRNA 3E6FA 4CVZB 1C16A 3ROLA 3MRIA 2DKMA 4P9HC 4AH2A 3MJ7A 5C0AE 3SKNA 2ICWI 1HEZA 3ULUH 3DSFH 4PLOB 4N0RA 2XTJC 1QBAA 1FYTD 3TGXA 3NCYS 4Z18A 1UKTA 3MV8D 2ARWA 5I1LA 4GKZA 1AR2A 4XNQA 3TN0D 4TNWK 1YN6A 4BH7B 4R26H 5LGJB 1U95A 5FDWB 2PTTB 5JOFB 1YEEH 2BNQB 3N1FC 4PJ7F 4PFEA 3UJTH 5KSAA 4FNLH 2ENYA 4NNYB 3JWDH 1GGYA 1XCTA 3ULVH 4R6UA 1J0KA 3EJZC 5JHDA 1YPZA 2HJFA 1OAKH 4F7EB 4G9FB 4C83B 5C92A 2ERJB 3HG1B 3ALPA 1CI5A 4FZ8L 3MV8E 4PGEA 5C6TL 1WFUA 4NQSA 2AXGB 5L0QB 1HHIA 4FQ2L 4HX1B 3S6CA 5IKCB 1UM4L 4ZTPL 4DZ8B 2E7LA 1OF2A 4ZS7L 2UY7A 5FYKE 3RGVD 5LVEA 1FG2A 1R3KA 3VA6A 3ZE0E 3LPGA 3BT2H 3QH3A 5HI4C 1LK3H 3F12A 3I6KA 3L7EA 5FUOH 3VI3F 4QRRB 1KEGL 5CBAB 5E1AB 1P4LA 4LKCB 1NCWH 3FFCA 3B9KA 2X1QA 4L4VE 1EBAA 3PP3K 3UTSD 1QFPA 2YPKA 3P9LB 4XAKD 1WLHA 3ZKSD 3B8YA 3CFCL 4RIRA 4KJQC 2GJ6B 4Z0BH 5CEYB 4F7TB 3LRHA 1N64L 4HH8A 2XA8L 4MXVE 3GUTB 3QEQB 4XC1L 4OCYL 2Y5EA 2LAGB 3MGAA 1IGJA 1WFTA 3DUUB 5D2LE 3SGKA 3S3PA 4OQTA 4PJDF 4XP4L 5DRWA 4NUJA 3UTTD 1D5IH 2X4UA 2AJYL 3LN5A 1X9QA 4NCC1 4PRPB 2COQA 5IF0A 4P3CL 4HV8B 3LKQB 1Q0YL 4XX1G 4LVNC 5EUOE 2NY6C 3O6FA 3QWOB 2YPLA 1GOFA 4IJ3C 3WUZA 1EHAA 5AYUL 5JHDE 5CZVH 3TO4C 5E1AA 4WHDA 4MJ6A 1RZ7L 3WDHA 2HJKA 3QJFB 1WSST 3QO1B 3PABA 3FL7A 3G6JF 1BVLB 5IWLC 3PGFL 1YYML 1EGJL 4X9IA 3N50A 1R3JB 3QHZH 4ZS6D 4N8VB 2R1WA 1NC2A 1BP3B 5JPMB 2HT2C 1N6QL 4G43B 3OB8A 4X4MA 2CUMA 1IAKB 5HI4D 3GMQB 2DN7A 2J5LC 3C5ZD 3VD9A 5HHNB 4TVPD 3TVMD 4YXHH 3TBVB 2LVEA 2YXMA 4ODXA 1U91A 1IGML 5JQ6L 5A3IC 3LKNA 2BJMH 4LKXB 1CFNB 3SKMB 5GRYA 4H26B 4KHTL 4TTDC 5EZJB 2AK4B 3G6JB 3RL2B 4DKDC 1YN6B 4BH7A 4TUOB 3KYMA 1NH6A 3H9SA 5E4EC 3T8XB 1BVLA 1U3HC 3DVIA 1CU4L 1ZGLM 2QEJA 5F6HI 3TPKA 1W0YT 5A2KH 1BZ9A 2FHFA 1R24B 5CSZB 5IMKA 5DRNA 5FYJL 3M07A 2NY0C 5FYJU 3GSXB 1DLHB 2VDQH 4M61B 3SN6N 2DS4A 3T2PA 5HTSA 1U6AL 4BJLA 2DMCA 4JFPA 4K7PL 1R5WB 1QYGH 1JZ2A 4HT1H 4JFEB 2EYSA 3BH8B 1VFMA 4N8CH 5F3BB 1P53A 3X14A 1OP3H 3SE9L 4WW1A 4FRWA 5ICYB 3NABH 4RMWA 5DR5H 3PL6C 2D0FA 1AIFB 3C2SA 2R8SL 3LH2H 1E27A 2BJML 1NGZB 2GEEA 2ZZUT 2NY1B 3MXVH 3O2VL 4UILH 5IVXE 3RGVB 4MNQB 2RB8A 4PJGB 1UXWB 2X4SA 2YUZA 5F7UA 5C6TH 2GJ6E 25C8L 5D7IF 4RCAA 4K94L 4X0KB 5DEGB 5C09D 2BVOB 2VITA 3H7LA 5DD1L 4BELD 4BFGA 4JREC 1NGWB 4JLRB 2IAMD 3O8XA 1ORSA 3W0WD 1WVZA 1I7RB 3HC4H 3VXPA 4NJAH 3HUJB 5EC2A 3RTQA 4X99B 5E9DE 1C5CH 4PY7B 3EYOB 1KCUL 3L3IA 1Q72L 1FN4B 5GRJH 4HKZA 4RRPA 5D96C 3KS0H 1RD6A 3ARGB 4NFBA 1I9RL 1T2JA 3O4LA 5H94A 3K4DA 4JQVC 4MAYD 3LS5H 5HDQL 3U4BH 2I26N 3O3UN 3HUJA 2FX7H 3RY4A 3T3PF 3IFOA 4R2GB 4TOYL 1Q9KB 5MEOA 1WBXB 1G7QB 3DROB 5E08L 3PHOB 4RAVA 2EXWD 1VACB 2JELL 5IW1A 4OZIF 1HHIB 1UWEL 4QKXB 5IKCA 3QXDB 4X0KA 2P1YA 3VWJA 4HK0A 5CD3A 3DI2B 4G3YH 5F1SA 3AB0C 3VXMA 3AM8A 3BI9X 4YFDB 2VABA 4XXDB 3I6GB 5FV1L 1CF8H 3WKNA 1J5OH 4P9MH 1YY8B 2BXZA 4FFZH 3L6FB 3S3SA 3SGJC 5GGVH 1NCAH 3EHBC 2YHGA 3G6DH 2AJXL 3PQYB 3JV4B 4HWEL 3MJ8B 1UZ6E 3ECBB 4XBGA 4I77H 4FZEH 2XZZA 2EDTA 3P4NB 5AWNL 1QKZL 3LRSB 3MJ7B 1LE9B 4HKXA 2VDNL 2OS7A 1PG7X 4P5TB 4PJFB 4UOW0 5GRWA 2QSCL 5I8KH 3BKCL 1CT8A 3Q6GH 1A3LL 3VXMB 3HC4L 1GOGA 2VZVA 4JANA 4M6ML 3AVEA 2MCPH 3OPZL 2H32A 4PS4H 1D9KC 4J12A 4HFWB 4YFEA 3FFCE 3T08A 4N8VG 5HSFA 1S7UA 3Q48A 4OT1H 5ESAA 1IGYA 5TDPB 4D9LL 3LHPH 3C6LA 4B7LA 2B4CL 4MDJB 3I02A 2AEWA 5C2BL 1WV7T 5FOJA 4TYUA 3W9DB 5HHQA 4U6TA 5LBSH 5MHSD 5EC2B 1QA9A 2APTA 5CBEB 3FJTA 3DNKA 2WBJB 1J0JA 2GFBB 1B0WA 4M62L 2W9DL 1R24A 3F8UB 5IMKB 4HMEA 3BE1H 5D7SL 4I2XE 2NY1D 5IBUB 1HINL 1BVKA 3GSRA 5F7NC 4ETQB 2NYYC 2HVKA 1I7TB 3FO0H 1QLEH 3CXDL 4I0CC 5FHBL 3FAWA 4LHUB 3SKMA 4G80A 2NX5E 1XGRB 2HFGH 3BJ91 4UT7L 3C08L 4CNIA 4H25A 3W39B 4MJIB 1JNLH 2ZOLB 1KTLA 5T1LD 2HRPH 4LASH 2QQQA 3SGJA 3THMH 1R3LA 5KG9B 1HSAB 1L9NA 4H88L 1T7ZA 5L2JA 4JHWL 4APQB 1DQLL 3WMSA 3MUGA 5I76A 4NCC2 2CRYA 4ZMAT 2VH5L 2G9HA 5MEPB 5I30L 2IAMB 2DB8A 5DYOB 4POUB 1BD2B 4HZAA 5BOZG 4YDKL 5L2JB 2YKLH 5KVEL 2BVQB 2HG5A 1QQDA 5E99H 5DHXB 2NY4D 2QSQA 4L1HA 5CFHA 1KCKA 1J87A 4M62H 3B2UD 4JZOB 1I8MA 1CGSL 5KS9A 3X17A 4HBCL 2DQJH 3G5XA 4RGNC 4C54A 3GMPB 3N9GL 1RVFL 4JPKH 2DLIA 1WC7B 3U4EA 2FD6L 1HXMA 2CKBH 2NW2A 4GT7A 4N1CA 5F3HA 3CMOL 3P77B 4C55A 1WFNA 3D0VB 3RWGB 1VA9A 3MUJA 2I07A 5CKAA 3V52H 1J8HA 3WJJA 2VDLL 1KTKE 3L6FA 4Z7WE 5CBEA 2HTKC 4ZO7A 1A1OB 1RK0B 1YQVL 1BD2A 4RFOH 2QR0B 3TIDB 2CDFB 4AY0A 3ZDXF 1JHKH 4GG8A 4IRJC 4V1DB 1UJ3B 1UGNA 4P5MA 1INEL 2R0KL 1KLUB 5CEZL 4PGCA 1OAQH 4TSBL 1FGVL 1MLCB 5EZOL 3HNVH 4XBEH 1JHLH 4L4TE 1MI5A 3V4PH 1CXKA 3L5XH 2BNUA 3CSYA 4XP4H 3EYFA 5EO0A 5FGCB 5LKNA 4K9EC 3RY5A 5EULV 3GRWL 2WW8A 1IC5H 5I0DA 1QZ1A 3QFJE 3E3QC 3FQRA 4ORZC 3REWB 1GH7A 1HNFA 2JTDA 4NN7C 4PJDB 4WEBL 3DETD 1J1PH 2AQ1A 4L3CB 3GFUA 3RVWD 2XNAA 3OKEA 2KKQA 5ILTL 1JYWA 1FO0L 3LV3A 5GJTH 4JFXA 3CIQA 1NC4B 1RQ5A 3MLTB 2XZCL 1YNLH 2HJLB 3KPTA 3MGTA 5J9PB 1OAQL 4IHOB 1CLZH 4XCYB 4F2MB 4LLYA 4MAYB 2R2BB 3KNBB 1MFBL 2VB5A 4HWBL 2Y07H 5EBGA 4YBLC 5BXFB 2C1PB 4JFZH 4AMKL 1AKJD 4TVPL 1MFAL 1UZ8A 1NGPL 4PV9A 5E7BA 3QXWA 3QT2A 5K9JL 5SWSA 1T2XA 1T83C 3O3EB 3KYOA 3SDXE 3B83A 3G04B 1MCWM 2VNCA 3QNZB 4Q74A 5E8EB 1FNHA 3CVHH 4MCZB 2R2EA 1HIML 3DO3A 3RA7L 1C5CL 1MWAA 4YDLB 4OZ4B 5CBAA 3S7GA 1Y18B 3LN4B 3V6OA 3I50H 4IOFC 5DVNA 2VR5A 2F74B 4QHNA 32C2B 1GIGL 4FQLH 4U6YA 3ARUA 4JDVA 4HHAB 3FCTB 4NPYA 5D5MB 2ICEA 5FF6A 4KXZH 3ROOB 1PZUB 4JPWH 3VXQA 1ZHLA 3DSFL 1JPGB 2DQDH 2XFXA 2YD4A 1ZT7B 3DARA 3HG1A 2AXJA 4JFZL 4L4JA 4NKOB 3O6FC 1AGCB 2AK4A 3G6JA 5B21A 3OAZK 5C09A 1MFBH 3WYRA 5F7EH 5GRUL 2J7LA 3PHQB 4OLVH 2HVJA 2CDEB 3B4NA 4NGHH 3BKJL 5D70H 1X7QA 4XP9H 1AP2A 4JDZB 5DK2B 3EGSA 4KK9C 4JR9H 4AIZA 4YAQB 3NABL 5D2LF 4QXWA 1IC7H 2EIZB 3O4LE 3QWRD 1NANI 2YMXL 1KCSH 1PDKA 1B2WL 3L3OA 4JFFD 4PJ5E 2IFGA 4PB9H 4UB0H 2ADIB 2P5WA 3TLRA 2AVGA 4FQHA 4PJ5D 4OIAA 3OKYA 3GSOB 4F7MA 5I1JL 1FSKB 5BW7C 1EH9A 1DQDH 2FEEL 5DS8B 4GXUM 1BFSA 5FM5O 2OZ4L 4Y8DC 5SWQA 3OWEA 2ATPB 4PJBE 4FQQA 5C0CB 2E7HA 1MY5A 3BMVA 1U8NB 4S0TD 4JVPA 4PJCA 1CD9B 3RTQB 4I8DA 4RRPG 1W0WB 1J8KA 4EN3C 3RTQC 1EFXD 2XA3A 1QP1A 4GKNA 1MFDH 3MNWA 5IMMB 3O8XC 3S5LA 4D9LH 1ZHNB 4PRPA 2OTWA 3CFJB 1CD8A 4OV5B 2EO1A 2AXFA 1MAMH 4HHAA 5EBWA 4ZOAA 3SE4A 4WW2A 5ADOL 5IMLA 3L95A 4WJ5A 1AXIB 4X6FA 3GMOB 4UOJA 3TWCH 3X11B 1D5ZA 1F6AA 4PRID 4KTEH 1PYWB 3NIDE 5IBTL 3V5DA 3QDMA 3WS6C 1RSFA 5J6HA 3CC5A 2V2TA 2AV7B 4FFZL 4UIMA 5K9OA 4JQXC 4AG4H 5FO9B 4MAUH 3BPOB 3IFLL 1F6AB 5BCAA 5EFIB 4LRNH 5HPMB 1U8PA 3SQOH 3KXFA 1NLBL 5CIPA 4LOUC 2Q7YB 3MBEA 3QH3B 1FCGA 1JK8B 1HZHL 2EDFA 2BSED 4QXGL 3LIZH 4Z6AT 4LRIA 5I1EL 3G5ZB 5DFWH 5HYIA 4R7NB 1ZLUH 1IGIH 2WBWB 3VFGL 3PDDA 1KFAL 4H26A 3V52L 3WFDH 1A7BA 5IR1A 4P46A 2ZPKH 1JGLH 1UWEH 1A47A 2AJSL 5IF0B 5IV2A 1OT2A 4WU5B 4P57B 4HF5L 2VQUA 5HHXL 4D94A 5F9WB 1P9MC 1FIGH 2IANE 2IAND 2V7HB 2YD6A 3QQ4A 4RMVA 1NLDH 1G1CA 2R1XA 1LILA 2W07A 5TFSH 2VLRD 2BNQA 2VAJA 4FFYH 3W0WA 3WNMA 1FJ1B 4PJHB 5FYKH 4DGYH 3AMKA 4TVSa 3P9MB 2HFTA 4NQCA 4R7NA 4RX4D 4NJAL 1OWWA 5SX5H 3BEVB 3X12B 1AGDB 5JZ7C 1A9EB 2P5EA 2HMID 5IMLB 1LDPH 4UIKL 4DN4L 5C0RL 4EI6B 1IAIH 3MV7B 4RA3A 4HSQA 5I75B 2W91A 3I85A 1J88A 4P57A 1I7TA 4WV1B 1TQCB 2UZXB 3QIBA 3DSNA 4XNXH 4H0IA 2B4CC 5F3HB 2X4RB 3BD4A 3OPZH 3L3GA 3BESR 5HHOD 4HXAH 2GFBA 3P30H 3IAPA 4KMTL 5I1JH 1T5WA 4U7KA 5C0ND 1VFBB 2XN9A 5HYSA 1B3JA 3BP5B 3CLFL 4P2CG 3KJ6L 4EI5C 2NY5C 1UFUA 1X5JA 3KPLB 1D9KB 4OZGB 1LO4H 1TZHA 1A64A 4J2XA 1JTOA 1IGTA 2VYRE 1SEQH 3I3DA 3U82B 2EDWA 1H3PH 2FJFB 4R90H 4URTB 2CH8A 4U1KB 3PWJB 4P2QA 2NXZC 1G0YR 3PGDB 5EORH 5F1NA 3T1WA 1IE5A 3IJHB 4POZD 3MXWL 1KBGH 4U0RB 5KSBE 3FFDA 3VD7A 3L7FB 3BEWA 1EAJA 1I4FA 3UTPE 1PKQE 2Q6WB 5CZKA 4G6FD 4O2EB 1CZ8L 1NAMA 2H8PB 1M6OA 2O61B 1OL0A 3ME0A 1E6OH 4ONHB 3T2NL 4KK6C 2P44B 3QIBC 4QYOA 2XY2A 5MP6H 3VFSA 4YIQA 1ZTXL 4PLKD 3CMOH 3Q6FB 1IRAY 2DLFL 2APVA 5B39G 1A1NB 2IANA 2VL5A 2G75B 4GRLB 1AR1D 3T4AB 1XGQA 2XKNA 3ARED 1T7YA 4LCCB 3WXVH 4EUPH 2WSKA 5KANG 5F70A 2PR4L 1CE1L 2DICA 5EU3B 1RZJC 5IB4A 5HY9B 3LEYH 1TNMA 1KF9B 2ORBL 1AFVL 2F19H 4FZEL 4GS7C 2K1MA 5KVFL 3JTSA 3TJEL 4NQVA 4J1UB 1IM3A 4YDKH 2MHAB 4S10A 4Z7VB 1JJUA 4GS7B 1C5BL 1I7ZB 1UM5H 4TVPH 4Z76A 4JM2C 4C56B 3EHBD 1OLLA 5TE4L 3MRBB 1ZAGA 2IAMC 4Z7VA 3EFFB 3MOBL 3DYMA 3CK0L 3BWAB 1PKOA 5CZVL 3GBLA 5JXAL 3WFCL 3IETB 5FCSH 3OQ3B 1UWGL 3D18B 3BPCB 4Z0XB 5CUSH 4JKKA 4XCEB 5IHUH 1MWAH 2BNRA 2JCCF 5HGHB 1HEZB 4QXGH 1VGKB 1ZT4B 2UUDH 1Q0YH 5KZCB 1K2DA 1XGTA 5CS7A 3FT4A 3MRRB 3WO4C 4X4ZA 1F4YH 2DDQH 4UNUA 4U6XA 5DZOA 3PDGA 1H5BA 4X98A 5F6HJ 4K7PX 3QEHB 1SJHA 1RIHH 4JY5H 2ZUVA 5D1XB 2X4TB 4LQFH 4ELME 2BSSA 3KHOA 2HFFB 3FO0L 3UAJD 3PHQA 5FYJE 2C26A 3QI9D 1OAZH 3RZCC 3BEWB 5F96L 3TO4A 2W9DH 4O2FB 4CRPA 2X4NA 1BMGA 1OWRM 3BWAA 3DECA 1NCNA 3RHWF 3UYRH 4KJWC 5D7LD 4LSSH 2DWDA 3QUYD 4QHLB 5BRZD 2IBZX 3GKZA 2JJWA 3HS0A 2BVYA 4I2XB 4ZSOA 5CGMA 4OI7A 3KPSE 2Q3AA 3ARSA 1U8KB 5DJ6B 2VDRL 4LBEA 2FNBA 2LQRA 4L4TB 5D9SB 3BUTA 2DQGL 1MRCL 3WNNA 3FQUB 4HC1L 1Z9SA 5C0GA 4MCYB 1Q8MA 4XPHH 3KPSB 4Y16C 1EO8H 5KSUA 4I4WA 1LK3L 2CMRH 1ZSDA 5E2VL 2E6JA 1UADC 3U30C 4U1GC 4DN3L 5DMGD 5SWSB 1LDPL 5C0RH 1J1XL 4I3SL 5D5MA 5HDBF 5DF0A 5IBUG 3WFBH 5EUOB 3CDGB 5B4MD 3PL6D 4LVOB 3D2UB 5A43C 3WJLC 4O51B 3S35H 2OBGA 5ICXA 1XH3B 2FL5B 5K9QG 4PYGA 8FABB 3T09A 3P73B 1JI1A 4WGVB 5DGQA 5DT1L 5MENB 1II4E 1KSRA 5DRZA 4JY6B 1FORL 5I71B 4PP2B 5HBBA 1XIWD 1I8MB 1OLZA 2EC9U 1ZHBB 5IM7A 4PTTB 1I9JL 5I30H 2V7NB 3ARVA 4UQ3A 3D85D 4JQIL 4XHQA 5E6IA 1JGUH 2X7LB 2RFXA 4G42B 1MCBA 3I6LD 1IC7L 1N5YL 3QDGE 1WBZA 3VXTB 1N5AB 1QSFB 4J3WA 4TTDD 2R1XB 4HKBB 1UJTA 2NY6D 2IQAA 1MUJA 3ZMRA 1RFDL 1KELL 4YDLC 43C9A 2R1YA 1NUFA 4PJ5B 4NC1E 3MTRA 5ICYA 1INQA 3IDIB 4XC3L 4WFFE 4HIIA 3SO3B 3ZTJH 3CCHA 5DC0A 4K8RH 1UJ3A 4OLEA 4X4YA 2EH7H 5DJAB 4IS6A 2W38A 3HAEG 1JK8A 4QXTA 2VDPL 3F58L 3NMEA 3QUZA 4I3RH 3RPIB 2WUCL 1IKFL 4K7FB 2DI9A 2IQ9H 3GJFH 5HD8D 2XY1A 4GRWB 5KS9F 2BVOA 2VITB 4RBPK 4M03A 4XVTH 2XI9A 4Z5RB 1H5BC 4OCSH 3VCLB 3HZMA 1AFVH 2F19L 4PJDE 4ZXBA 4YGAB 4BFEA 4UBDD 2X89A 4GRWE 4KUZH 2EKSB 1OARH 2DM7A 2NY3C 4J3XA 5IGXL 1NCTA 4Y4KB 4YC2B 3OAYK 1IEBB 3T3MF 4KZDH 1MOEA 1IAIL 3ZE1F 1C7TA 3RGVC 4I18B 1DBBL 3TT3H 2E7MA 2QQNH 3KDMA 3SKUD 5C0FB 4JDTL 3Q0HA 3BN9D 1U58A 4E0RB 5KSVA 3RVVC 1HH9B 1A0QL 4YBQC 4MA7H 5D7LB 2ZUQC 4GAJL 3R0MA 1FE8H 4MLIA 5LWYH 5DFTA 3BISA 4JPVL 3U46B 1DVFA 4KAQL 1PD6A 1CLCA 2KL6A 3VFMB 1HSAA 4M5ZH 3QXTA 1WCBA 2Y06H 5E5UB 1T03H 5EWIH 4MMXC 1DANT 5FYJH 1T5XB 1ZWIB 5J1AB 1AJ7L 3PDOA 1J05B 4G80B 4HUWA 4R4FL 4ZAKB 1G7PA 2YK1H 4Y5YB 3BIBX 1DUZB 4F7MB 1FH5H 4TN9A 4XRCA 2FCBA 2ZUYA 1KPRB 5L88L 1S7UB 4AZ8A 4JDTH 3JWOC 2X4UB 3LN5B 4NHCH 3DXAB 2GYSA 1U42A 2OXHA 3OL2A 4OAWA 4WJ5B 4OF7A 3RL1B 3L3OB 2AJVL 4C56D 1G1YA 3CFKA 1CXLA 4LRNL 5EBWB 4FQ2H 1CT8B 5EIIA 1CWVA 1P6FA 1J9CT 5J56B 1H3XA 4X6DF 3UP1A 1BX2B 3I9GH 1Q9WA 2PKDA 5J11C 4FXKA 4G8IB 1YEDB 4ZXBD 1T0PB 4J8RB 1K8IA 1AKJB 4WUUE 5E4EB 1URLA 5DJXA 1OGAA 3G5VA 5C09B 3VXOA 1RUKL 4XZUA 5GS0D 4Y4HD 1MVFA 2DI7A 2XQBH 1N6VA 1FIEA 5DJZB 5DUMH 1D6EB 4NO0B 1AO7E 3GKWL 3O6FB 5F9JB 1WICA 5DO2D 3UBXB 3C60B 1C1EL 2QADC 3A6CL 1TETL 5DS8A 3QUKB 1EJOH 5EPMA 3UAJC 4XBPB 4JG1L 4LLWA 1SMOA 1OHQA 1RUQL 2R1YB 4IIQA 1WAAA 4XB8A 1ODAA 4XMLL 1A7NL 3RIAF 3SKJH 4XC3H 5EC1A 3MODL 1B9ZA 1DQML 3DXAD 1FPTH 1XF5B 1ZSDB 2RCSH 4NN5B 4OUUB 5ACLA 2JCCA 1X5LA 2E3VA 4XPAL 2VISB 3MREB 4D0CB 5TGBA 4QHKI 4P9ML 3WIFB 1DBJL 4LHJB 2Q76A 4PR5B 4J4PC 4Z7UA 2D31B 1H0DA 1UKSA 1KLGB 2GITA 3IAGC 3PWUA 4XNYH 1WITA 5E2UL 5GRVL 1C5DA 2V17H 4X6BB 4P4RA 1IVLA 4TSCL 4LPVA 2GCYA 3L5JA 2XA8H 5IBTH 1M7IB 5TGBB 3WIFA 3MRGB 4YNYA 2HJLA 3MGTB 3MGOB 3QIWC 1CD1B 5C9JA 2CLVA 2XXCB 5GXBB 3SGEI 1FC2D 5IOPA 4KKLC 1C1EH 5E94B 4GAFB 1IC1A 2MPAL 3QA3A 1YNKH 3PDOB 5JA8B 1DN2A 1T1XB 1VFAA 4Y2DD 3BE1L 4UTBH 3CDGA 2EE9A 1PG7H 4LCCC 5J6GA 4QRPD 3V7AG 3MOQA 1XIWB 4KKAD 3C8HA 4JJHA 2ID5A 4G8GA 3Q2CA 2FEDC 2JIXB 3PNWA 4NQCD 2CXKA 4MCZA 1HQRB 1FYTA 2A1WH 2YEZA 1WBXA 2ZUTA 1FNFA 5IGXH 1JTPA 1DQQA 3B43A 1EEUA 1U92B 1U8KA 5DJ6A 1FFOA 2YRPA 1CFSB 5C0FA 1IGCL 3ARGA 4LLVA 4OCWH 5EOTA 5IQ9B 1S9VA 3QXAB 1OAXL 1SBBA 1SHMA 2LTQB 2R29L 1SY6L 4XCYA 4F2MA 5LGJA 3QRGL 3F7VA 2VLKE 3IU4L 2BY1A 5J1TC 4L9LA 4NJ9L 2YSSA 1HILB 4U1IB 3NACL 2X1OA 4PJIB 4P2OC 4HGKC 1ZK9A 2VLLA 4JO2H 4U1SA 4Z9KB 4WY7H 3RKDD 4BUHA 5DI8B 2HAZA 2BNQE 1QFUH 1I9IL 2IANB 5GS3A 5D1XC 4BSWB 1ADQA 3BZDA 4JAMB 1P2CA 1JWUA 1BOYA 4V2CB 5IG7B 2Y06L 2DLTA 4J3UA 1UM6L 4NHUA 2AJSH 1GGBL 1O0VA 5F71A 4PJBF 5SWZE 1F3JA 4Q6IB 3NPSC 1OCWH 3PHSA 5D2NC 3IJSA 3VH8A 3CSGA 2GK0A 4FHBD 1E28A 1WBYA 2BNUB 4K8RL 5IB3B 2EYTA 2IFFH 4HV8A 5AZEH 1MJUH 4HK3N 3WEXA 1YC8A 3FB6A 1EEYB 5FKPA 4BUGA 3CK0H 1N2RB 2NNAB 4GRMA 4LARH 2B0SH 1T1YA 5EIIB 1IM3B 4Q9CA 5BZWA 4QOKA 2P8LA 2R23B 2VQ1B 4OD2A 1S7WA 1F11A 1BFTA 5E56A 5IQ7L 3CFCH 1EJOL 2QSTA 3O0RL 4ONFH 3RDTA 1QSED 2FJHA 4YZFF 4B50A 1U9KA 2EECA 2Y7QB 4PRIE 5ISZE 4PREA 1EPFA 4MJIA 1OY3B 2VXQL 4GMSH 5J8OA 3ESVF 4Z7UE 3ZKMD 2YUXA 2CDGA 5EZJA 1EEZB 1GOHA 3WFBL 1KN2L 3QP3A 2DQFB 4RIRB 4S1QH 4AEHH 3OZ9L 1YY9C 4NWUH 4LVHB 1R5IB 2F5AH 2Y7QA 3MV7A 1RJLB 5DZNA 3S35L 4RMRA 2K9UA 4BQBA 3IFNH 3KYNB 3FFDB 3PP4L 1OTTC 5DUPL 3O3DA 1R6VA 1S7WB 2VQ1A 4OD2B 1GC1C 2XQYK 4FFWC 5F1KC 3LOWA 4PS4L 4HS6A 3K8MA 4DGVH 3WNOA 1JNJA 5GISH 5LGHL 5KAQF 2JJTC 2AEPH 4L8DA 4KRLB 1ZVYA 1JMXA 1T3FA 1XZ0A 4M6OL 1OP3K 4OLYH 1A6WH 3WCYA 3TM6A 2FATH 3QJFA 5JMRA 1EZVX 1MF2H 4OZGA 3TA3B 1NPUA 4PRIA 4N9GA 3MCKB 5GHWL 5F9AC 4Q6IA 1AJ7H 2JCCE 2NTFB 1JYNA 1JGVH 4ZSOB 5IVOA 5HGAB 4MA3A 3RVXD 2OK0L 1FNAA 3CCHB 2MQ0A 3NFNB 2FRGP 5GPRA 3MYJB 4W4NA 1LEGA 3CUPB 5CSBA 5GGSA 4WO4A 2EDBA 4S1SH 4UQ2A 4ALAL 3EOAB 4IRSA 2FWOA 5E5RB 1IKNC 2L0DA 5E9DA 3K1DA 4FQ1L 2YPKB 1K3ZA 3ES6B 3P9LA 1M71B 3THML 3AU1B 4QY8B 1Z5LB 2DWEB 2HRPL 5TDOA 4YHIA 2YOCA 1DEDA 3BD5A 1N8ZA 3RFZC 1UACH 3CGTA 3L7EB 4D2NA 2BDNH 5I1IH 1R5VA 3DMMD 3N9GH 4KK8D 4E9LA 4L9DA 5DJCB 5I2IA 4OGXL 5L2KA 1FFOB 1UJ3C 3M8OL 3MRMA 5I8CA 4EDWH 1Z9MA 2P8MA 3B5HA 1EO8L 4J3TA 2R4RL 4U1MB 3ARYA 2YA0A 4OGAD 2VAAA 4CADB 2PCPA 5E99L 2ADGB 2VLRA 3UROR 1Z9OA 1N5AA 4K3GA 4J3SA 3EJJX 3LQZA 5C7XL 3OAUH 4E41A 3EAKA 5JHLH 1NEZG 1MREH 4QRRA 5KVGL 2R0LL 3H3PL 5DVKA 1F5WA 2M2DA 5GS1A 1UG9A 3FT3A 2CJUL 2YZ8A 2K7PA 2XN9D 1CVRA 3RA7H 2OQJA 4YBHA 2UWEB 3N85L 1L7IL 2V5RA 1QEWA 1OF2B 4JY6A 1IEHA 3I6LE 4EVNB 3Q3GA 3NCEB 3FOLA 1CIDA 3QNYA 1UVQA 3P4MB 2PTVA 2VUYA 3MRCB 3MJ8A 4L5FL 1QSVA 4XP6H 1CCZA 3GSWA 2LV4A 2DD8H 3RVTC 4NNPH 3TZVB 4Z7QF 4O51A 1KC5L 1VFOA 3SJVB 1KV3A 3RTQD 4KI1A 3QCUH 4XXCC 5FO9A 5ADPH 5A16A 1NMAH 3TZVC 3N06B 4YDVA 3WJLA 1DQLH 4LSPH 1KTRL 4LAQL 1JPTH 3VGEA 3VRLE 3QG6A 1T89A 1VERA 5KANI 5JW3L 3QFJB 3MRFB 2A74A 1EV2E 2MPAH 2N7AA 5D6CB 2X4OA 5DK3A 1CGTA