2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
4ACBA 3HZRA 4UAJA 3E1YE 2BM1A 1OB2A 1MB2A 4YMIA 4PBRA 1ZM3A 3L93A 1WKBA 3AGQA 1VQOB 4S1OA 5TR9A 1Q11A 3IOCA 2D74A 1J9ZA 3OZWA 1T6ZA 4K1XA 3QSYA 1R6TA 1WQ4A 4RUKA 1R6XA 1YIAA 1VQNB 2IP1A 2CV2A 1KP3A 4GU5A 2BVNA 4TMTA 2PZ8A 4WNYA 3OJWA 1MJHA 1EFVB 1XNGA 4J0QA 2NZ2A 3GLVA 2DY1A 1I2DA 3TS1A 1JB9A 4ND6A 4P2BA 1M1ZA 4Q93A 1EWYA 4XSVA 3U6BA 1WZ2A 1N2OA 3IH5A 5IHXA 3ZJTA 1O96B 1N3LA 3GMIA 1WY5A 4PGOA 1QNFA 1H3FA 5EKDA 3I1FA 4KPUA 4RCYA 2PMDA 2QUHA 3UY4A 1BS2A 1TFUA 4XFJA 4ZCLA 4G5GA 2AHOA 4MUFA 4PY2A 3FIUA 3ISJA 3AVXA 1QU2A 3CCSB 3IODA 4M4SA 1IQUA 1W34A 2D5BA 3GUZA 4YAOA 3DPIA 1OWLA 3P0IA 3OJXA 4I6JA 2FX3A 3HFJA 1FNDA 3OTWA 3IOEA 1QGYA 2DPLA 1JEEA 3W2HA 1E62A 5JBQA 4FZJA 2BYTA 2CUZA 3CLRC 3HMQA 1ZH0A 3NV7A 1IJFA 4MUNA 4EG5A 2AZXA 1NSYA 1KH2A 5TGTA 1BQEA 1EFPA 3PRHA 2BN4A 3FETA 2EIXA 2DERA 1YI2B 1GTRA 1PFYA 4AC9A 3G5AA 1D1NA 3FI0A 2YWFA 1IB0A 1JA0A 1R5NA 2G36A 2J09A 4YAUA 1ZH6A 1ZM9A 2A1TR 1TTTA 3CLUC 2A1UA 2ZP1A 2X0KA 3X1MA 1XNHA 4AS1A 4KR6A 1H1TA 1CT9A 1K92A 1M83A 4HE6A 3FJOA 1G8FA 1GLNA 3G6KA 3N05A 1NURA 1O0CA 4ZT7A 1DNPA 2DXIA 1NZJA 2X3FA 1A8HA 1NP7A 1QGAA 2CYBA 1MAWA 1VQKB 1JIKA 1O97D 2JA2A 3SEZA 2IJGX 1EXMA 3N2YA 1MBZA 1VBKA 1DARA 3OW2B 3AIIA 5KHAA 3CVXA 4M53A 1J21A 1SKQA 3W2GA 4EG6A 2DR2A 5DEOA 4YBRA 3TQOA 4U8HA 2VNHA 3AVVA 2CRVA 3UMVA 3WXMA 1O95D 1WOYA 3J81k 4U7JA 3KT8A 4QREA 1QFJA 2YWHA 1VQ6B 1KORA 2XNCA 4B4DA 1QJCA 3KFLA 3FOCA 3VRHA 1ZUNB 3CCLB 1D2RA 3KT0A 1G7RA 2PXHA 3H9BA 5THXA 1YUNA 1JHDA 3AFHA 4NX2A 3CCJB 1TYDE 1QG0A 1CQXA 4YP7A 5TV2A 1AMOA 3ZBUA 3UOWA 1O5TA 1FDRA 1ZJWA 4MUKA 4HK4A 5LFAA 1BX0A 4H3SA 1JILA 2V0GA 1HA3A 3CPWB 2QUIA 1VQ7B 1NYLA 3QFTA 1Q19A 2XNJA 3P0JA 3CB4A 1NI5A 1X6VA 1KR2A 1H3EA 4JXXA 3NBKA 4MYUA 5KCMA 4RCZA 1J1ZA 3COWA 4B43A 1O97C 3TNJA 4MUJA 1EP2B 4MW9A 1SM4A 4PC1A 3PNYA 4EG8A 4P6VF 4RD6A 3CA8A 4ZT6A 5FO0A 3PXUA 2PIAA 3QE2A 4R2MA 3CW2A 4ARCA 1NUQA 1IFXA 5TEWA 3COZA 1K97A 4MW2A 4LC0A 1O96A 4TN1A 3SYTA 4DJAA 1EE1A 2VNJA 1YHQB 1OWOA 1QRSA 4WSOA 5AHWA 1X8XA 3JQQA 3CLSD 3ZXSA 1OWMA 4YHBA 2DCUA 3IVCA 1GPMA 4YAWA 1WQ3A 1YIJB 2CSXA 1AIPA 1K4MA 3RBAA 2QA4B 3OP1A 3OZUA 1M8FA 2DUMA 1DDGA 3ZIUA 2XRYA 1GO2A 3LE8A 4ZT5A 1F7VA 1GAWA 4DE5A 4OJMX 3AG5A 4YP6A 1N77A 4LBVA 4ZCRA 3ELBA 1G8HA 1J70A 1G8GA 3MUEA 4XFDA 1KC8D 4CQNA 2D54A 2E89A 4RD3A 1VBMA 4ZCPA 1JZQA 1QRUA 3MLAA 4MW6A 1GTSA 2QUKA 1SURA 1KK3A 1M8GA 4RD0A 2BV3A 4M2LA 4RD4A 1VL2A 2HDNB 3CLSC 4MUEA 2BGJA 3LO8A 3CVYA 4H9GA 3AVYA 2QTZA 1IQ0A 1EFVA 2A4MA 2VTBB 5J58A 2D13A 2DLCX 2VNKA 1TYCA 3I05A 4MW7A 2BPOA 2PFSA 4OUDA 1U2RA 4I6GA 5DB4A 2BF4A 3CVWA 2C5SA 4ND7A 1EP1B 3RK1A 3ILVA 5DK4A 2X1LA 1N2IA 1NDHA 2V0CA 2QDXA 4UZFA 2OK7A 1YUMA 3VNVA 1WJGA 2H2AA 3A4IA 2B7LA 3ZZUA 1EFUA 1G7SA 2HCJB 3VMFA 2QTMA 2Z09A 3I55B 3VU8A 1NUSA 4NBSA 4DDMA 2CNDA 4P3YA 3G71B 4HPWA 4JZYA 4MVXA 1VBNA 2CFOA 1KQOA 3G59A 3WBKA 4J76A 5GV7A 4QBTA 4LBYA 2BTEA 3WBJA 1O6BA 4TMXA 3ND7A 3OZVA 4F3RA 4DDKA 4PC2A 3IUEA 5TEVA 4AQ7A 3MXTA 2WQ6A 3PENA 3H97A 1KP2A 3CD6B 4KR7A 3A05A 3U1VA 2XRZA 1WXGA 4KR9A 1QVGB 1QUEA 2PLFA 3IVXA 2RC5A 1S72B 5HG0A 3QFSA 2NPFA 1WXIA 4NZPA 1KH3A 3U2QA 1QVFB 4EGAA 2CYAA 4EG3A 4KKVA 4YALA 1W87A 1QTQA 2YWBA 1JECA 1T6YA 2BGIA 1YI8A 3QFRA 3IDFA 1XJQA 1Y42X 3KT6A 4N3GA 1J09A 2QN6A 2J4DA 5KSWB 1JA1A 5IJXA 3MMXA 4DLPA 2RC6A 2A88A 2EL7A 2B7CA 2OQ2A 3SP1A 2C78A 2B5OA 1IH8A 1WXFA 1K4KA 1NUUA 5HXBA 2PG3A 5EMNA 3D6VA 1FNCA 4ZCMA 4UZEA 3TZEA 3LCJA 4EF6A 2QUJA 4AF7A 3CLTC 2R6HA 1OB5A 3RJZA 1G7CA 1ELOA 2VNIA 1VQPB 1JJ2B 3WYAA 3IOBA 1T9GS 3TZLA 4LBWA 3Q10A 1YJNB 1N8RD 1N2EA 3P52A 1F7UA 1E63A 3U6KA 1MOPA 4RPIA 1N2BA 5BNZA 5KWVA 3CC4B 3W5HA 4ZCTA 3E20A 1T9GR 3CVVA 3CR8A 1LW7A 5J5AA 4QHYA 2GQFA 1QRTA 1VQMB 4TMWA 3FWKA 3K32A 4I6EA 4G1BA 1I7PA 1QGZA 1K9MD 3V76A 3ZC3A 1N2JA 3P0HA 1W35A 4ARIA 1FRQA 1HYBA 2J08A 3NBAA 2HMAA 2AG6A 1OGIA 1GVHA 1IQRA 1VQ8B 3CMEB 1QFYA 1EFCA 1B6TA 3HGMA 4J75A 4NDAA 4PBSA 3SJZA 1G59A 2VYQA 2CV1A 3PNBA 1YIDA 4L2IA 1CNFA 2NSYA 4C43A 1COZA 2WB2A 3CXCB 1N75A 4WQMA 3WNBA 4R71A 1K73D 2Z08A 4MWBA 1KK0A 1KKUA 1O94C 3A04A 1O95C 2VTBA 1I6KA 3L92A 1GN8A 3N8HA 1KRHA 4FN5A 2PZBA 4ZCIA 1EFPB 3DLAA 5H59A 3IVGA 5TS2A 4Y7CA 4R0NA 1M8JA 1RQGA 4QFMA 3LVBA 1MB9A 1OBHA 2JANA 2QTNA 1P7PA 1A8PA 3B82A 1WDTA 1H85A 1KTVA 3P27A 2YY5A 3WNCA 1U0BB 3FHJA 5J59A 1M8KA 1Q77A 1T6XA 3MLBA 1DDIA 1R5BA 1S4MA 2J07A 2QJFA 4TMZA 1QUFA 3ZGZA 4B3XA 1XB2A 3W5UA 5AN9A 1M1KD 1LI5A 4CDNA 1J1UA 1QU3A 2ZITA 4MWCA 4HE5A 1O94D 3ZJUA 3CCQB 1J20A 3MMPA 1JNYA 1QH0A 4L2IB 1D2EA 1EUYA 1M90D 3BL5A 3QE4A 4MVYA 5H5JA 3CLRD 3ZXIA 4ZT4A 4HJRA 3C8ZA 2YWCA 4ZV4A 3H99A 4NAUA 1N1DA 3W2EA 4BPRA 4CT0A 3CLTD 1U7XA 2ZUFA 3SZ3A 3ES9A 1WXHA 1XE1A 5K0SA 4DNXA 3PNVA 1JEDA 4B47A 1VQLB 4JFAA 3A2KA 2QTLA 5K0TA 1CNEA 4MWDA 3SEQA 4MUIA 1KQSB 1Q7YD 1Q81D 1K8AD 2Z3VA 4TS1A 1FNMA 2E1RA 4Y9UA 3G4SB 1OWPA 1N78A 4QRDA 3S3TA 2GPJA 3ZZ0A 3CMAB 4U9UA 4CDMA 3COVA 1N0VC 3P26A 4ACAA 3HL4A 3G6EB 1V47A 2OTJB 4NCNA 4PC6A 1TYBE 3CCMB 2H29A 3W2FA 3F3MA 4MYTA 2X3UA 4Y9RA 1JZSA 2QJTA 4DQLA 3CC2B 3AG6A 3ZJVA 1GR1A 1FRNA 3AVTA 1IVSA 1M8PA 2PZAA 3IMGA 1WXEA 1H3NA 1LI7A 1EJ2A 1BX1A 1S0UA 2QTRA 3D6UA 1GAQA 2BM0A 3AVUA 1EFTA 1YULA 5FO1A 4EG7A 2RD2A 2A84A 2QMUA 1G7TA 1YJ9B 4AF6A 2A86A 1N0UA 4FWTA 1I6LA 1QFZA 1YITB 1TVCA 3CCEB 3AVWA 1U3CA 3ZBTA 3FH0A 1FYDA 4OUDB 3JQPA 2OTLB 3DV2A 4MVCA 1I6MA 5FA6A 3KT3A 2IELA 4MQ6A 1IJEA 2J5BA 3CCUB 4G6ZA 1Q82D 1ZM2A 1B23P 4DDHA 1ILEA 3FNRA 3IUBA 1QQTA 1TYAE 1KK1A 3COYA 2BSAA 3QTBA 1PG2A 4MVWA 1TLLA 1JGTA 3UC5A 3JQRA 4EG1A 3WY9A 1NUPA 1FNBA 4R2LA 4JYZA 4MWEA 3MCAA 4M0LA 1EUQA 3UK2A 2HZ7A 4E1AA 5DASA 1PG0A 1GJRA 4N3NA 1DG1G 1F20A 4IW3B 2A7XA 3VO2A 1KK2A 2QJOA 3E27A 3H05A 3SDBA 5F23A 4C0SA 4EH1A 3DO8A 3CRZA 1IHOA 4MUHA 2WQ7A 4MW5A 4JXZA 1KH1A 2A1UB 1ZM4A 2WSIA 2YXNA 4BWVA 1OBCA 1VLHA 2I1LA 3ZUGA 1JMVA 4RJLA 5TY0A 4MUGA 1ZUNA 3CLUD 3RFFA 1EXDA 2O5RA 2RE8A 1Q86D 3IMCA 3Q12A 4HJXA 4G5FA 2JAXA 3VNUA 3AGPA 4F4HA 1R5OA 4B48A 5HUJA 1UMKA 2DEUA 3ZZTA 3K9WA 1QX4A 1PFWA 3M5WA 4PBTA 2AKEA 4ZT2A 2ZUEA 4MW1A 3CCVB 1W2BB 5H7XA 1O0BA 2GM3A 3ND6A 3SZGA 2HGZA 2X1MA 3W5VA 1N2GA 1GZUA 3IMEA 3W2IA 3AL0C 1U3DA 1PFUA 3B8HA 3FDXA 4YP5A 4YAFA 4ZGNB 4X0EA 5HUHA 2TS1A 1F4LA 1KQNA 1FFYA 1KJZA 1JIJA 1H42A 2E21A 3LOQA 1KQPA 2VXOA 4NAHA 3Q4GA 4G5YA 4KPUB 5DSZA 1NUTA 1OWNA 3INNA 3HV0A 5LM3A 1PFVA 2A1TS 1KD1D 2YWEA 4RD2A 2CV0A 1ULHA 2J7KA 3CC7B 2B7BA 1VQ5B 2QEXB 2EJCA 2DETA 3FY4A 4ZCSA 3JXEA 2YWGA 3RHSA 4MAFA 4FK8A 1EP3B 1F60A 2EFGA 3B78A 1JIIA 1OD6A 3ND5A 1BJKA 2C77A 1UFVA 3FPKA 3I56B 1B2RA 3QFCA 1XNJA 3H9CA 4K0RA 4MW4A 4U63A 3TQIA 5LLTA 4NATA 4F7DA 1GAXA 2E0IA 5H16A 3AKZA 4RD1A 4MULA 3QTTA 4TMVA 5JBNA 3FG9A 4B44A 4DQKA 2VZLA 1MRZA 1KAQA 3VGJA 3RK0A 5FNZA 3VO1A 4MLPA 2E18A 4GRIA 2BMWA 5GV8A 4M1KA 1VQ4B 1OGJA 2PIDA 3MHPA 4ZT3A 4PC7A 3WNDA 2R5WA 4MW0A 2OV4A 4ZGQB 1N2HA 1D8TA 4K03A 1U7DA 4EG4A 2XEXA 1V8FA 4A91A 2CT8A 4PC3A 1TEZA 3X1JA 2CYCA 1F9AA 4EFKA 1IRXA 2GOYA 4Q16A 3CVUA 1YJWB 3CCRB 1Q15A 1R6UA 1MAUA 2GKSA 1E64A 4LBZA 1VQ9B 4Q7JB 4ZCQA 1NJID 1MC1A 2OK8A 1TQ8A 3X1KA 2O8VA 1TUIA 1KAMA 3N9IA 4G1VA
chains in the Genus database with same CATH superfamily
4QQGA 4ACBA 1KYIA 1H0RA 2E1PA 2V7EA 4PZYA 5IAGA 2BM1A 1WVIA 4O4IF 6PFKA 1YACA 1ZNWA 3EMKA 1T0JB 1APBA 4L9AA 3KSDO 3AGQA 1ICEA 4FFBB 2LKDA 4M7DB 2FMIA 2BGGA 1BYMA 2Q5IA 4OMQA 5GGYA 1WPGA 3T7RA 1SHUX 3N2GB 4K26A 4N40A 4EB0A 1N0HA 5EWLB 3DTNA 1VQNB 1MX5A 2Q45A 3PWTA 4K7JA 2BVNA 4UU7A 4ZV9A 4BD3A 5ALWA 4X24A 3RBVA 5KNBH 3B5EA 1MO4A 1E2KA 1PFQA 4ICIA 3KQTA 4FVTA 3TL2A 4OATA 1I1HA 1JB9A 3RV4A 3ZE2B 5BYKA 2K57A 2GWHA 1EWYA 4WZLA 3U6BA 3E84A 3A0UA 3FLGA 3RLFA 2FPFA 2R6R1 2J05A 1N3LA 5I48A 3HBNA 3IAS1 1RPZA 4LGVA 2P9FA 4OX9B 2QUHA 1S1MA 3EYAA 3K94A 3L4SO 4HYQA 4CEIB 2C9YA 5DLDA 2PH5A 5K05A 1GD1O 3QP9A 1QU2A 3ABOB 3KLMX 3UF0A 4HYTA 4XN0A 2XRMA 1PBTA 2RGUA 1VQ7Q 2BAGA 3QFFA 4A27A 4C8QB 2B4AA 5FU7B 1DQSA 3EGCA 3L0DA 4US2R 3OJXA 2VPIA 2QRZA 2FZKB 1N8RC 1C7EA 1LV8A 2D59A 4AFQC 3A3PA 3Q0EA 4I36A 4J16C 4XLTA 3ZHVA 5HUQA 3GA0A 5TB5A 4Z54A 1SUSA 2BYTA 4PHFA 3CCMQ 2PX6A 2PZFA 2PDAA 3BXGA 5CNMA 1ADYA 4BECA 2G6TA 4B7CA 2XT0A 1Z17A 4F7UF 1ZUKA 3KEWA 3AEQB 4FJ1A 4IEIA 1RPTA 1R9NA 4EG5A 5FPKA 4PQYA 2X41A 1EFPA 2ZEJA 3D6FA 4FJ0A 2IW3A 2VQ3A 1N57A 1VHQA 3LNCA 1MG0A 3BD8A 3G89A 3BSSA 4A3SA 2G36A 1IB0A 1SSFA 2J09A 5DH9A 1ILWA 3ASSA 2A1TR 1ZM9A 2LZ0A 1SIWA 2FZ5A 3RANA 4N6NA 2XZLA 1SY7A 2P3OA 4JJ8A 5I51A 1Q1GA 2DUNA 2GBLA 2AJTA 2C7GA 5BWOA 2QSZA 4GUAA 5KYWA 2K6GA 3B13B 3F7NA 1YR1A 5IYZF 4BQEA 2ZIZA 3ESRA 4V03A 2VZ8A 3CYFA 2JA2A 4TT3A 1V5IA 5EZYF 4FOOA 5HOQA 1IZZA 4YYEA 1Z35A 4P3KA 1MC8A 4CM8B 5JD4A 5JC8A 1U0JA 5AVXA 1NLPC 2QA4T 1EGHA 1OC2A 1RCFA 1UPXA 2ETVA 2LD4A 2MYTA 4Q9IA 4E5PA 1Z16A 4WOPA 3EHRA 1ETHA 1FY2A 4PXSA 4KN5A 3CC4T 2VNHA 3OEHA 2NSDA 4PAGA 4XIYA 4RDHA 5AXBA 5H68A 2LDXA 1AN9A 2AN3A 3H9QA 5DNWA 2QVYX 5GAMg 5D2CA 1WHGA 2FN9A 1GCQC 1NNUA 4M7DA 2ZIVB 3CO0S 3CX4A 4JGGA 5KMGB 3NHBA 4X7RA 2YDLA 1DIRA 1WEKA 1QH9A 2O1EA 2VH1A 3KT0A 3OX2A 4MRAA 2JVJA 3AP2A 4OHOA 1ZIPA 5L3ZA 3JYNA 2IEAA 3EQ6A 3U13A 1ADBA 3KS9A 3LRTA 1V4BA 3EZ6A 2JLQA 2FXVA 1L7AA 2BFBB 3ONWA 1QG0A 3TLXA 3BYZA 1PJSA 4YP7A 1P0CA 4IF4A 4A2PA 1RT9A 3ESXA 2EPDA 2ODAA 4F71A 1Y34E 2FA9A 3G8BA 3MOIA 3PTLA 1W0JD 4TL7A 5AJXA 1SKYB 1SMKA 3Q98A 1RBZA 3Q0TA 4DAEA 4WZEA 4HWPA 1XFDA 3HY6A 4F8JA 1VPWA 3G6EA 1XJWA 3ID6C 3JQAA 3JCMc 2OG2A 4ON9A 4BP3A 4ARUA 3CJQA 1GTJ1 1M6WA 4NQRA 4MYUA 2Y90A 1WUTA 5B2ZA 1TF5A 2ORWA 2OV2A 4H7FA 1OLUB 4GYYA 1RXVA 3T12A 4E5SA 5T3UA 2FYKA 2ALJA 2ZR9A 2JZ2A 1SM4A 4IDAA 1UL1X 4LOLA 4A1FA 1U0LA 4P6VF 4EG8A 3CE9A 4LHEA 1K9MR 1C5KA 3BZBA 2YXDA 4D0RA 5JDIA 2BKAA 2AZSA 5CKFA 4QSHA 1K97A 3N8KA 3ZTYA 4O1IA 2ERCA 2GD6A 4GRAA 3SYTA 421PA 4EVSA 3W7AA 2XD4A 3FOFC 4JV5B 1QANA 2NZWA 4WSOA 2HHCA 1KNXA 4M78E 3BIJA 4LKOA 3G2JA 5AHWA 4Q4CA 4KGVA 4KQFA 1RAGA 3HJFA 4JLIA 3ETDA 4DBFA 4AN0A 2DPMA 1RRGA 2RHMA 4XTWA 1AIPA 2X2OA 3KYDB 3QXGA 5FUXA 4XJVA 4J9HA 5D6YA 3OZUA 3V8QA 3FHTA 5LA6B 3FPLA 3REQA 3DZDA 4H08A 4HNAB 2OO5A 2O06A 3OHMA 5DBGA 1JJIA 1LSOA 3D81A 1KO4A 4A5SA 4J0CA 4KVAA 1YNOA 2APJA 4J6XA 4B6SA 5B5SA 2GGSA 1M2VA 1ZGGA 3B52X 4MMXB 2LUOA 4YV0A 1G8GA 1Q1NA 1PL7A 2PLAA 1XCGB 4XFDA 3X2EA 4IHAA 4KBMB 4MR9B 1TMGE 4OYLA 4S04A 2C3PA 1C4KA 1TX4B 5FNVA 5MGNA 3MJXA 3PVCA 3LD9A 3LX6A 3T7DA 1QRUA 3HNRA 3D26A 1XDWA 1K7CA 1ZOLA 3TEJA 3RYFA 1PJ2A 4P81A 1EBBA 1ISHA 1TD9A 3PUVA 1SUPA 1WFWA 821PA 1NC1A 1VIAA 2A4MA 1K89A 1QGOA 2Z95A 1JFLA 1MRSA 4PLFA 1KZHA 3UGTA 4INAA 1RIFA 2XVMA 2HJSA 3I0MA 2XTNA 3CSSA 3MFYA 4C5EA 2DH5A 1C1AA 2V8JA 3VRZA 4HWRA 4Q9KA 2M6SA 2QX8A 1LQ2A 2NQ8A 4JYAB 4B6QA 5KYYB 1J00A 3T1TA 2QEXA 1M1YA 4TYNA 1T3HA 2E5LB 1EFNA 1GXIE 2H0AA 4B6FA 3GH3A 3RW9A 5E9AA 3I4FA 3QE9Y 1L2TA 4HNRA 1SWWA 1EP1B 3G2IA 5TX7A 5LQRA 3WK7A 4GM1A 4B3MB 5ALGA 4HDRB 1XAIA 2A37A 1AQYA 2D0NA 3G8CA 4M55A 2WSFE 4Q48A 1GZVA 1SBYA 1R9JA 4KRTA 1HKHA 4PHCA 1FMKA 1P31A 1YUMA 1YK0A 2OP0A 5I6DA 3FPBA 5IZCC 4OO3A 1EFUA 2QGZA 4IHKA 4LMRA 3A3BA 5HKKD 4NBSA 1W96A 4HCCA 3G71B 1K3FA 3GO4A 2IXGA 1H2BA 1X42A 3K1YA 3WBKA 1BCOA 4J76A 3TIGA 3VJLA 2ID4A 2WSSD 3SNHA 4Y9SA 2IEZA 3RRYA 2MJLA 1ULTA 2PRZA 5J40A 3WS7A 2EBPA 1ID8A 2G3YA 1MC4A 2GJSA 3G68A 4TZ0A 1AH2A 1IZ7A 2PM8A 2PBLA 3SZLA 4B3IA 5BRAA 4EOGA 3LQQA 3JATA 5C81A 1MIHA 4AD8A 1X9HA 2GM5A 3N5BB 2XDBA 5BSFA 2DVMA 3PKIA 2XVZA 5L40A 5C2JB 3L2OB 3DE5X 1SZJG 4X6LA 3QFSA 1ZRSA 2OI3A 1UKZA 2C99A 1Q0ZA 3I58A 4D8XA 7ABPA 3D2BA 4YALA 1UIMA 2WTMA 3W8NA 2YWBA 4PGHA 3VR1A 2VXYA 2ZU6A 3META 3VX4A 4N3GA 1PGQA 1Z7WA 1G21E 4DA0A 2J4DA 4C6SA 4EPWA 1SXJA 1XIVA 3KPUA 4M0DA 4Q1EA 2O9VA 4DSZA 1P9RA 4PCLA 3HK2A 3SQXA 1SEVA 1LVKA 1EBFA 1KY4A 2OX7A 3DMTC 4PS0A 4XN3A 2QN3A 4YRMA 1D4AA 5IN5A 3NAMA 1WUYA 5K1ZA 5E4YA 5JHGB 1Q0RA 1KE1A 3WHLA 1X8LA 2GXSA 2R1TB 4XR9A 2Q41A 2BZSA 1QX3A 1UDLA 2NNLD 5HF5A 3STWA 3Q8XB 3JB9J 4REMA 5HQTA 1UBSB 1W59A 3JTEA 3LYLA 4OF1A 1X74A 2JCYA 4L6AA 5EJ9A 1VQ1A 2MHCA 3R75A 5AI8A 3VJPA 2Q6TA 3L9XA 4HSEA 2RJFA 4EYOA 1VRCA 2PUJA 4FBMA 2ZR7A 4QDZA 1L5KA 1JPNA 4S0XA 5GONB 5KZMB 2AX3A 3CC4B 2GNCA 3QWFA 3NJ4A 4DGSA 4I6EA 5CW2A 1M2OA 2BBWA 2VA8A 2ZT5A 4W5HA 3L2WA 1N6AA 5KVQA 3SHQA 4FDAA 3TZ6A 3FPSA 3WXMB 3L7YA 4NOKA 1VQ8B 4FTWA 1IVYA 3JWEA 1BN7A 3AEKA 3PVSA 2H4FA 4I99A 4XDYA 8LDHA 4YDSA 1P5FA 1ZMOA 1JQJC 2ZPTX 2OILA 4MHOA 1JG3A 4A4HA 3C0CA 3EXHA 3QX7A 5DHSA 1AT1A 2C7RA 3NASA 3LYIA 1SVMA 2XIQA 1O95C 3DBLA 4H0FA 2M9MA 3PEYA 4ALIA 5FHRA 4KI0A 1XXLA 2PGDA 4OMFB 2IBMA 1A88A 4D97A 4B79A 2ZE7A 2WWYA 4LDYA 3C7DB 4HDNA 3ZWNA 1Y8AA 4NBRA 1R0BA 1T2EA 1VA5A 1ZD9A 2DF8A 3UGKA 1WSBA 4BI4A 1WDTA 4LOKA 4EHIA 4GE3A 5DP2A 3DGEC 3T1QA 1EPUA 1SVOA 2FDXA 2PT5A 1HO3A 5HS6A 4HNTA 2NIPA 2D2EA 5DNCA 3FZEA 2AW3A 1M1KD 3E35A 3DSRA 2IXFA 1H2EA 2FRXA 3CMAQ 3IX7A 4ZQHA 1I8FA 1JIUA 2Z2IA 5DV9A 3RRBA 1O94D 1B0PA 4C8QE 2YUNA 2H4WA 4GMDA 3SPXA 4NCAA 1M90D 5DM60 1I3CA 4C4SA 3EY9A 1ZPDA 3NGMA 5LQCA 4EJ6A 1P19A 1WBBA 2WE8A 4F5ZA 3FRHA 3C39A 3GSIA 3RH0A 4CI9A 4YC7A 1ISJA 1O87A 3BHIA 2OO7A 3R8FA 3AONB 2YJGA 4QXAA 4Q0MA 2A3LA 3ES9A 1WXHA 1P9NA 3K9HA 4MV8A 2WKSA 1XAHA 1JSLA 2F3SA 4JFAA 1CV2A 1Y7PA 3FMGA 1QVWA 2EWMA 2Y2VA 3DD1A 5K3OA 1M7GA 1R4MA 4C0HA 1Q81D 2D1FA 2NTNA 3I12A 3B53X 4R2KA 5EFOA 1E2FA 3MJCA 4NCIA 2Q9BA 3THKA 5KKAA 2HYIC 4RAQA 3JCMQ 2OXFA 3COVA 4MGYR 3DUFA 3DWIA 1H2FA 4UBKA 4WESB 1FFDA 4YHHB 3IEPA 1FSFA 4M0KA 4AULA 2NQTA 4KULA 2Y8EA 4PC6A 4ZALA 1GRCA 5EAIA 3EGUA 1YZQA 4NYIQ 4BQQA 2OXCA 3ZBDA 3PEVA 1FDSA 4R68A 2VJOA 3MTJA 1URPA 3FYTA 4HLDA 1QGDA 1VCOA 4PYNA 1UKVY 3A5ZB 4YJ2A 1ANKA 1BLIA 3C2QA 5GMKh 5FPHA 5BNFA 2ZRKA 3EZXA 1U31A 2UVPB 1G3IA 2JIPA 3AVUA 1EDZA 2A94A 2Y1DA 1N6IA 3CPXA 1M2FA 1E3LA 4INJA 4X1KB 2A84A 4N47A 3U62A 2POCA 1WDXA 4IAOA 1QFZA 3VC1A 5LQUA 4UTXA 2N0SA 1VGVA 3NO4A 5F5NA 2EYXA 2OTLB 1Y7IA 1MMFB 4MEJA 4M7DE 4QPJC 3W34A 5GAOr 4V2SA 4YUZA 1Q82D 1PI3A 3AI3A 1SIBE 1T29A 4B6OA 1NYRA 3NTIA 2QTBA 4HTFB 4OHXA 4D8KA 1KK1A 1RWPA 1SHZA 4BDTA 4NYJR 3VS2A 1W1FA 4MTCA 3HA3A 1DIAA 4F06A 1A0NB 1QF9A 3AJEA 1THGA 5F5LA 4H7JA 5F12A 1DV2A 4R2LA 3WLEA 3EG3A 2YZMA 4DMRA 1Z3IX 1T9BA 2FB7A 1W6XA 1QHEA 4JN6B 5FAKA 2AC2A 3HL0A 4QD3A 3HBMA 3SC4A 3BFPA 4IXNA 1DRVA 4HN9A 1PQ4A 3BL6A 3PHGA 1WX6A 2DHEA 3CX3A 4HH0A 5EC8A 1MMAA 1KH1A 3U7EB 2YXNA 1N07A 1KBOA 4NBLA 2P7IA 1R66A 4ASUA 4Z4VA 2E9SA 1QMCA 1REQB 2O5RA 1L4NA 1RJ9A 1W5BA 2VO1A 3GEBA 5E7MA 5DLQE 1OXBB 1LS1A 1NP3A 5ES3A 5JI3E 4KOAA 1JFTA 4H6VA 2PWYA 1UPAA 2HI0A 2YS6A 2RMOA 4PIVA 3GGSA 3DA8A 3O2QB 3G9UA 3KXPA 2WU3A 1VQ9A 2CUKA 3IIMA 3I9OA 5LMZA 2X1MA 4Q34A 5BP7A 1J3TA 1ECBA 4IP0A 4QXOA 2IHUA 1HE5A 2WF7A 3AHUA 1TDJA 4H3VA 4N5NA 3FPGA 4S1VA 3OVMA 3UV7A 4B4UA 1SQ5A 2YHTA 2ZBVA 1U7WA 3QKSB 1QKXA 2NZUG 3V2UA 4G01B 5GANj 3AR2A 1KQNA 5A9SA 1XTSA 3W06A 4DA4A 3IESA 3P2EA 4JT2A 4QODA 2AI2A 3RJ5A 3ADOA 2VXOA 4BKQA 4YUXA 1M33A 2AVNA 3Q4GA 3S8EA 3OA0A 1RHKA 3WAKA 5HK0A 1LV7A 2CREA 2ZCVA 1KQFA 1T3ZA 5FWXA 1BYIA 2EW1A 4RKYA 4RZ2A 4G41A 5CM8B 4BLWA 4OFWA 3VH1A 2IYTA 2O8EA 4FM4B 1Y0YA 3TW8A 3KQQA 4FSDA 3HM9A 3EPHA 4MKFA 2K7AA 3UQYS 2Y0DA 3GD7A 3UK1A 5KREA 5DNYB 4NBWA 3SE0A 3V7YA 4MAFA 2OZEA 1CZKA 1BDMA 3H84A 3PQ4A 1T26A 1OD6A 2RHOA 3DDUA 2O0KA 4NY1A 3QVJA 4MW4A 4WVLA 3SMQA 3T9FA 2A9JA 4MPRA 4BFTA 4D9KA 1ZL2A 4UTOA 7REQA 1LLCA 4IWXA 4IFIA 3THRA 1I2CA 3W9UA 3FLBA 1TYEB 2H1OA 4KQKA 3R2JA 1A1SA 1HMPA 1IN1A 1MRZA 4JVSB 2XT9A 3MINB 5JAPA 3WWZA 3NUGA 4U00A 4PZAA 4RMJA 4U2FA 3SM3A 1UK7A 2E18A 2PH1A 3WQQA 1WZEA 5A3JA 1BI0A 2QW0X 4NNJA 1RM3A 1YB6A 1SB9A 1AG9A 1AHJB 2XQGA 4XASA 5IJWA 5FU7C 2Q9UA 5IP5A 4QTYA 4MW0A 1VQMQ 3B2NA 1MQAA 2JKVA 4EG4A 4K5QA 2XEXA 2VPPA 3MS2A 2PR7A 1DJQA 3X1JA 2HJWA 3TTVA 1I2AA 3N74A 4FFSA 3ZDQA 1OASA 4EUNA 5I9SA 3TSCA 4IUUA 1DU4A 1R6UA 5A9RA 4E11A 1KJYA 1P45A 2NTJA 3R5FA 3FB9A 4WZZA 5LD2B 2CL6X 4FIZA 4RQTA 1K7YA 3T4EA 2C2GA 2G70A 3ZG6A 1V9CA 1YFNA 1V11B 2A35A 5DHUA 4HX5A 4DV0B 2DWCA 1CLUA 5BR4A 3HZRA 4QU8A 3IE2A 5CQXA 4NPAA 4GUDA 4HEA6 3LI2A 2COEA 2Q2VA 2G25A 3OCXA 2YWRA 4CF6A 3AEUB 2BMEA 4HD8A 3DE1X 1CEQA 3SX2A 4W9NA 5FL7A 1AS0A 4FHZA 1Y37A 2JJMA 3MTEA 2QASA 1O94A 3REOA 1E3DA 1U28C 1V39A 5G41A 3L18A 4F16A 2JHGA 1OA0A 3GI1A 5KC9A 4E6EA 3GLVA 5ALEA 3WLHA 2QEXT 3V00A 4F4DA 4BX2A 4Y9DA 1SRMA 4UBIA 1QFMA 1G21B 1P2UA 1OYWA 4XZ3A 4FDLA 2V6FA 5D3MA 3L07A 5REQA 4DM4A 2NV2B 1XRRA 4BX0A 1J23A 1XCJA 3IH5A 4AL4A 1VG0B 4ECAA 2B94A 1OLXB 2F1RA 3QPWA 4G07A 4J0IA 5T64A 3VS5A 1D1BA 1RI9A 1TCVA 2VS1A 1UGSB 2QE7D 2ZAEA 1TKAA 1XGKA 2QIOA 3KV3O 1J0CA 3NGLA 4XFJA 1LJ8A 4BCBA 1FVOA 4CYMA 4TSKA 3I6ZA 4A8HA 3THXB 3L79A 2A2ZA 3DAFA 4AZ0A 4I0WB 4UVDA 3TEFA 2P2ZA 2R6GA 1SUIA 1HL3A 1KDTA 3OA2A 3RIRA 1A9XA 3F5QA 1L5HB 3I2GA 4Q7MB 2UUPA 1DO0A 1U9ZA 3Q0IA 4GI1A 4WTOA 3SYKA 4KYUA 2XYQA 2HWXA 2WF5A 2CUZA 4C7BA 2EQBA 1M2HA 1UE9A 2PRJA 4MLDA 3WQSB 2ZIAA 4M9QA 2GAOA 3GEGA 1P6XA 4TQUS 4B3FX 2O3RA 3GRYA 3ICCA 2GNAA 3PGJA 4C30A 3NIBA 2CVZA 3SC3A 2CDRA 2DERA 2VASA 2X6YA 3Q2OA 4J90A 4RCVA 2I3GA 4GDMA 2AN1A 4HCBA 3K4QA 4U2CA 1Y81A 4AK9A 1CULC 4AY6A 1ZJYA 2R62A 3NRJA 1BMQA 4UUPA 3QXXA 1R4ZA 1CY4A 4U7PB 3HCRA 1K73U 1C0PA 2QD2A 4RAOA 1GLNA 3LA8A 2ROQA 2E41A 3IIJA 4IDBA 1E2EA 3GJYA 2QE7A 2IP4A 3G7SA 1QGAA 3JS5A 2FW0A 3M0RA 5AJTA 1EQUA 1GGNA 4EABA 3VDRA 2B2NA 4LWOA 5CBPA 4RJKA 5AW7A 4IH1A 4MZPA 3KEGA 1BCMA 1D0YA 5BUSA 1ZY2A 4X85A 5AKHA 4CVNA 5LJ3e 1EUDB 4GYWA 2HTEA 3CISA 1T8SA 1VGQA 2OZLA 4I4TB 1PT7A 1YXMA 4M78B 1VQ8A 1O95A 3WXMA 3CTAA 2HIMA 4ZD6A 1E66A 3R5KA 3KWMA 5JCJD 2O5EA 2VDRB 4QRHA 3DOIA 3GG2A 3IVRA 3O26A 4ZOLA 4NBUA 5HQ3B 3A70A 2VLIA 3K1ZA 1OEBA 1AT1B 4IWYA 4QXRA 3UHJA 1SA0B 3CC2Q 3T35A 3J7TA 3F3YA 1NBMD 1NY5A 3ESYA 3KXIA 4HAZA 3ZLUA 1SKBA 1KFEB 2PWPA 1SC3A 2CF6A 4XGRA 3I5RA 2FUCA 1HYHA 4ALNA 2CL0X 3UCEA 3KQHA 4M7AG 4QVJA 3QXCA 2P9TA 3SHTA 1R8OB 1FDRA 1NQAO 4KKSA 4LJ7A 4LOHA 2CUDA 3U4DA 3THWB 3N6VA 3USZA 2NU9A 2XV1A 1HA3A 3FYCA 3TSWA 2MSDB 2V7TA 3DXFA 5DWQA 3QELB 5AJZA 5LQAA 3M59A 4RDKA 2CF5A 3DZ8A 1UGVA 2IZ6A 3TLGA 3FHLA 4RTRA 3F1LA 1CJVC 3ZI4A 1EX7A 1UMDB 1H3EA 2WSLA 1WXBA 5ALTA 3ULRB 1SOMA 1TZJA 3COWA 3IELA 1NKVA 4QOIA 2QQSA 4XGIA 1JDUA 4C06A 3RAEC 4M99A 5CDYA 3ND8A 3PQFA 4MPPA 4X7CA 4GM4A 1UDXA 1RLOA 3ANNA 1T9ZA 1DJNA 3DC2A 2UZ1B 1CE8B 4NBKA 4D9EA 2Y4YA 1XPUA 1V25A 4DLUA 4P0TA 4QXMA 1YFZA 3H7IA 5AKEA 2I78A 3A8MB 1XMVA 1GLVA 2AG1A 4B9XA 1QGED 1HLDA 3S3OA 1NFQA 4Z9BA 4YR7A 2EF0A 1IJKA 1RCTE 2E6UX 2DBKA 4LGYA 1C3LA 3SEMA 1DEAA 4M8LA 3BRWA 3OZXA 3AIKA 3T7KA 3V8LA 2PGAA 5JO0A 4ZGJB 3X28B 4JUAA 2QA4B 1L1FA 3GRFA 3LX4A 1IOZA 1DO8A 3EPPA 4RTUA 4KNWA 4D3YA 2C83A 1Z39A 4PZ9A 5A2GA 4DE5A 2A59A 1B42A 3OLXA 1NWCA 4KDRA 1CDZA 5IZ4A 2EEPA 2WJ4A 4P3IA 1Y80A 5LD2C 1R50A 1QCFA 3CPWS 2ICAA 2HK9A 3CY6A 2OM2A 4C5BA 1ADFA 1P17A 2A0YA 5KUTA 2GEUA 4E5MA 3QI2A 4JJDA 1IY0A 4BE9A 2Q5OA 4F6LA 5JJCA 1E6CA 1JZQA 4WCVA 4KN6A 3I1IA 1U2PA 1SXGA 1KK3A 1M8GA 3LUFA 3V97A 1SVUA 4CEHB 3CLSC 3H9UA 4C3UA 5LA6F 3K05A 3QA3E 1VQ9Q 1T10A 3NHLA 4N0MA 5F4BA 4M7DG 2QTZA 2HWWA 4CMHA 2IXEA 4MR7B 5K0GA 1CZOA 4IHJA 3EW7A 5IG2A 2F3PA 4AUMA 2K2VA 2ZRDA 1P7ZA 3DEKA 3ORYA 2C4NA 2I1QA 2GFHA 3OYAA 4MW7A 3IAHA 4HVUA 3C6MA 5EJ2A 2HHLA 1TVMA 4HFMA 4TXJA 3DHEA 4GZ5A 4XDZA 5C0OE 4XLFA 3D9QX 1T2NA 3SEFA 1U9IA 4X07A 3LA6A 3BK7A 5U4XA 4EJSB 3I72A 3T7SA 5EHZA 4JPBW 4XOUA 3FR7A 3G1TA 2IHZA 2X1LA 1CJUC 3NHWA 2EL9A 2RI3A 2H2FA 4N0EA 2BR4A 1DRJA 1NIJA 3H5WA 2OUIA 1E3EA 4G63A 4XLHA 2C9OA 3P0RA 3O8RA 2PUGA 1E1NA 1G7SA 1ACJA 2Z09A 3C1AA 2W58A 5FEUA 4CKEA 5C8VA 1ZK0A 4QJ3A 3MGAA 2ZPBB 2E49A 2C7QA 3TB4A 5BN4B 1SBHA 3WRVA 3KJGA 3L82B 2HQRA 4BGVA 4EB3A 4CIBA 2KSSA 1X7DA 4LJ8A 3LC7O 3DP7A 2AV6A 2GCIA 3L7KA 1IUOA 5EQTA 5F73A 3R9KA 3I32A 4IQ0A 3C95A 1LPAB 1J8FA 1JG6A 1JFSA 4B6JA 1UXKA 4Q7LA 5IM5A 3LUPA 4HH3C 3FUCA 5F7OA 5ICGA 2A36A 3A2NA 4Z6KA 1PR4A 3T3IA 4L8VA 4Q7KA 4RHYA 3B6MA 4NICA 1XDBA 1Z6TA 1KH3A 4PZCA 1T36A 2ZAGA 3OO1A 5C31A 3LKVA 1JECA 1P1BA 2LT4A 1T6YA 4W8GA 1GCIA 2IY7A 4AX8A 1YOVA 2KSQA 1WDWB 3CINA 3C74A 4GVXA 3DFUA 4IIOA 4OL9A 4IF6A 3WIBA 4B3DA 4DMGA 4F9EA 5C8ZA 2I6UA 3JQ7B 2NYUA 5CVTA 3OAAA 1WU7A 3D8UA 3RB8A 2V7UA 4YV2A 1YTUA 1GQ2A 2R0QC 1ABQA 4Z51A 1LB1B 2P90A 3A1CA 3BMOA 4RTXA 2ZYHA 3SCZA 4OLHA 1DCKA 2RH9B 2IDJA 4GRDA 4ZRDA 1GQOA 4EF6A 4Z1OA 3MWYW 2ZDQA 1K1EA 3RJZA 2O2CA 2X3XD 2GTIA 4AJ4A 5FPQA 4LW8A 2VSNA 3CE6A 5E8RA 3LBIA 1VQ4T 2WF6A 4O4JA 1B4DA 4JUIA 3IOBA 1FXXA 2CH4A 3BORA 1GZHB 4NFHA 2ECOA 2AFHA 2OCBA 2DYIA 4GBQA 4K05A 3RYTC 1JKFA 2VVTA 3ZI0A 1Z88A 4JJFA 4DCCA 4D44A 2PZ1A 2WVHA 3SB2A 3B9PA 2IUSA 3KHTA 3GVHA 3K32A 4HRVA 1N08A 5DHAA 3UW1A 1VQOT 1N2JA 1TJYA 4X1YA 3MT9A 1JEQA 1HUQA 4QBHA 1JF8A 3UOGA 3IERA 1KL7A 4BXOA 4BVHA 5D7NA 2QU7A 4OBWA 3KSRA 4J9BA 1BCRB 1KKMA 1YIJT 2W6CX 4QHSA 3T7EA 5EY5B 2J3DA 2OAUA 4Q5IA 1JMYA 2RHDA 1WV0A 4ND2A 3ZBQA 4KKUA 1ORRA 3E9DA 2ZSHA 4RANA 1EK5A 1K9VF 2P4HX 3QYJA 1NBWB 3VR5D 1KRHA 2FWBA 1DO2A 3KVYA 3K5HA 1FU4A 3RVJA 2AI1A 4E6PA 4G36A 2B5VA 2REOA 4BEJA 2O9SA 1PLLA 3S99A 4GVLA 4QFMA 2LQNA 1VQPA 1Q91A 1HBJA 3JCMb 3FKJA 3JU3A 4F7UG 2DVEA 2PGXA 4NCKA 4XX0A 3V7NA 2GZ2A 1DRWA 1N8KA 2C8JA 3GEHA 3OLCX 4MJ7A 3A8GB 1JDTA 2X1HA 3FPFA 1FPMA 4AVZA 1C6VX 5J59A 4A73A 2J7PD 4UBNA 3FBTA 4Q37A 2JGMA 5AK3A 3OOEA 4L4ZA 5DT2A 5SZHB 1NF8A 5BMVA 2E3IA 1KERA 4HBZA 4BNMA 4AG6A 1FLNA 2EKOA 4C0FA 1U8AA 1USWA 2V1UA 1QU3A 1K5PA 4FYIA 4KXWA 1SOVA 3R7SA 3WKAA 3CP8A 1UFOA 3GZJA 1E6UA 2K2WA 4L9RA 4LQDA 2PNJA 3J7AF 4ELZC 2FRDA 3ORRA 4GECA 4J2OA 4KJZA 4U4AA 1R10A 4ZO6A 1JEYB 5FRDA 3AKZA 1TL7C 5HZKA 2VHQA 1Q16A 2FPWA 3P45A 4NECA 2ZSFA 3WMXA 1PV1A 3N6RA 4GX0A 2IS6A 4TSRA 2ZDGA 1E59A 1DPGA 1SUAA 1V7PC 4Z02A 1RHQA 1UHCA 3CLTD 5K3SA 4V0NA 4A6EA 4OVAA 2DRMA 1J6UA 3NOQA 2Q50A 5K0SA 1EEHA 1QWOA 1ZWLA 2NAFA 5FRMA 4TYMA 2WU8A 4MWDA 3CRMA 2HKNA 4XMYA 4HY3A 2VB6A 1EM6A 1YBFA 4K6HA 1K8QA 4QATA 3RTCA 2VKQA 4IYRA 4L76A 3E2UA 4C4XA 4CCYB 5KQLA 1KHHA 5ALPA 5I9IA 1MJ5A 3H16A 2AN4A 2CWWA 3FCYA 4YRKA 4YXFA 1R0CB 2NSJA 1V47A 1E7QA 5FAXA 1B6SA 1P5ZB 2FY8A 2OG1A 1F12A 1X1RA 1Z8DA 2DM6A 2CLHB 1FX0B 1K5DA 2DBYA 3OY2A 1N4AA 2OBXA 3V1MA 5F98A 4Y9RA 4AY5A 2W6PA 4IIJF 1EB9A 4IMIB 2FDRA 2GTHA 2MYPA 1HGXA 4KWHA 5CB4F 4OMOA 4BBJA 1YKSA 3B89A 3HRIA 3ZV3A 5DISB 2B99A 1QHYA 3OYIA 1QE0A 2RD2A 3ET4A 3BWDD 5TNXA 2H2DA 4OBXA 2XEDA 4EB6B 5C8YF 1KAHA 4NG5A 5IJ9B 1AKEA 4RMIA 2K79A 3ZBTA 4QVGA 2PUEA 2I7XA 1LSSA 3DV2A 2BEVB 2HTFA 4RK0A 4EUHA 3I9QA 5ED0A 3S2IA 3VR5A 3KQLA 1KHTA 4IUBS 1V5WA 4RSMA 5FI3A 3WTBA 2ZRBA 4X92A 5E6UB 3M5CA 3V4ZA 2BSAA 5GOZA 1TLLA 2A5DA 1IBLB 1OZHA 5A4IS 3AQIA 4M77D 1G8YA 2QTVB 4RVUA 5IYNA 1QYCA 2NU6A 3EA4A 3WY9A 1RKVA 1ESEA 4UZSA 3A8LB 4Z9AA 3OEWA 5IJAA 2E7ZA 2IS4A 2AMVA 2ZYVX 2XDQB 1IK6A 4WNAB 4XD7D 2V7WA 1PG0A 2JARA 2C06A 1P4RA 2AHJB 1I36A 1L0BA 3O4IA 4Z88A 1KK2A 2QMYA 2HA6A 2YW2A 3VOBA 4EFDA 5BN5A 3C6QA 1JIQA 3KQYA 3B7GA 2O7NA 1T91A 1HYOA 4BN5A 4HDOB 1KQ1A 2R86A 1K9AA 2A1UB 4ZVSA 3A9SA 4JQOA 1JPJA 4W9MC 4DRXA 3MUFA 2GF0A 4HG2A 3Q7RA 1HD3A 1XZNA 3PYLA 3K73O 2HRDA 1UEJA 3INZA 1YDWA 3L4EA 4RLFA 4JXKA 3WQZA 5AYFA 2VOEA 3O5AA 2B5WA 1ZUYA 2KRSA 1FTNA 1U8CB 4XXHA 3CBPA 3KKEA 2HUPA 2MSCB 2RAVA 1CP2A 4C4AA 1ORWA 1PFWA 2VT2A 1NMXA 1LH0A 1RLPC 3I3OA 4MW1A 1U04A 3CMCO 5CFZA 3ASRA 5KNDH 4F7UA 5KVSA 4NCJA 2F48A 3ND6A 4PNOA 2Q6LA 1XTKA 1UXIA 3LQ4A 1PSDA 3WMFA 1WJRA 4EHLA 2MWOA 5AOCA 3B8HA 1J42A 1VQ4A 4UNNA 1AKVA 5GMKl 3LDHA 1EA5A 5KDDA 1DKMA 1NJ5A 4YRFA 5IBRA 1K0FA 1RE0A 2GAJA 5EKUA 1PS9A 3X1YA 3E4CA 5BV0A 5KTSA 4KPUB 5K45A 1D1CA 4LRWA 4BFYA 4AKGA 3PS9A 3N75A 5JO9A 4QVCA 4OPVA 2AFIA 5JSZA 4EW6A 1T5LA 1V2HE 4LF7B 1E3ZA 2QLNA 3ZWWA 2ZJFA 5LJ3d 2QE6A 1F60A 2X9GA 3IFSA 3LXXA 1HZEA 4R8VA 4RPJA 2IUYA 4OU5A 3T5DA 5IF9A 1Z5VA 1IN5A 3KLNA 2QQEA 2WSEE 1MPXA 3O90A 3Q9LA 4HBGA 4IPTA 2PNFA 2BZGA 2PYZA 3QLUC 5H16A 2I3ZA 4FU0A 1Z4KA 5DM2A 4E32A 4OKNA 1IAQA 2HC9A 1ZN9A 4U3JA 3LGXA 3ZLJA 5FTNA 4ZVLA 3ZE9A 2Z8YM 4XYGA 3PA2A 3J80E 3SG0A 3GLGA 4PCVA 3RT7A 1JE0A 2VRCA 1GYQA 1W8DA 4LZLA 1PRLC 2HY7A 4DMKA 2A5YB 1XI2A 2DTHA 2V0NA 1ZRNA 1U7DA 2NYAA 1ZUWA 1Y6FA 1IULA 1Q12A 5CGQB 3U5TA 1A2OA 5TGDA 1UM9B 4Q16A 4BUGA 1U0SY 1I4WA 4NEQA 4OMCA 4EKIA 4JLBA 1MAHA 3F4LA 4C1NA 4F3CA 5TF0A 1FSGA 2H7CA 2AT1A 1IM2A 1ZI9A 4UUMA 5ALZA 2WWVD 1IWPB 1X8JA 1ZESA 1U8XX 2EJVA 3CVJA 4JHLA 4UUQA 3H0EA 1KEKA 4P93A 4UAGA 2F4NA 3EVAA 1N8TA 2GCOB 1QHSA 2CFTA 1NRXA 3RLIA 3RG2A 1VE5A 3RUDA 1OILA 2QEXQ 3M7IA 3UFBA 1RMQA 1S8AA 4QWWA 5DYIA 4EEZA 5J2TA 2DPYA 3OY7A 4E2ZA 1OY1A 1R6TA 1U5SA 1WQ4A 4TLBA 2KI5A 2B82A 3O8CA 3EXIB 4I4LA 5I22A 4PKCC 1N5LA 4TMTA 1QZUA 2TYSB 2W6JD 3IAM6 4X8OA 3BY1A 4KMMA 4COOA 1Y82A 721PA 1SUBA 3DEYX 2M6KA 1NASA 2WQZA 3Q1KA 5CCXA 1HDIA 2NUAA 4XGKA 1VQLQ 3DDHA 1YNSA 2WBLC 1SVIA 2JFWA 4KSBA 4RMGA 5CLHA 4YFYA 5FORA 4YPOA 3DE0X 4F91B 3TJZA 1H1LA 1QO7A 1KY2A 3WLOA 2WAXA 4BEVA 1DX6A 1NDUA 4FOSA 4I3GA 1ETUA 2QRVB 1GDDA 1IXKA 1GAJA 1O8BA 2J85A 5CK4A 4EVIA 2FZGA 3OZCA 4EL5A 2FU5C 5A7FA 1BS2A 1ISPA 1GPLA 2Y1WA 3D3WB 3INTA 3BWYA 4BE2A 4L5CA 2P1ZA 1PWTA 3ZCXA 1SKMA 3ICEA 1WAMA 1I18A 4XYLA 4UNSA 5HRUA 5EIBC 1B26A 2ZVPX 4HLNA 4UUNA 5JR3A 4E3ZA 4YP9A 3DPIA 4UQPA 2BZ8A 2HU2A 1OULA 4BJ3A 3D6AA 2RK6A 3OE7D 2F1IA 3R5JA 2I6FA 1L5WA 5ICCA 2G4CA 3B36A 3N8DA 3QVGB 2JH3A 4OKSA 3ZGOA 1SUEA 5BUZA 3GGOA 1ZL0A 2OB2A 3K1AA 4HTAA 3UNXA 2Q5JA 1DDOA 3EK2A 4DCGA 5CBKA 3UXHA 4YJGB 1DSSG 1G3MA 1GADO 4FB4A 1WQ1R 3NANA 4QT0A 5EJEA 3DMPA 3W5JA 2VI5A 1RWWA 1S5PA 4MV7A 1SCBA 3ZQ4A 4J6YA 1PWZA 2Q5LA 4KKXB 4UU8A 3S70A 1YI2B 3OB9A 4BZQA 1GTRA 4EHDA 1GWNA 3A14A 2RQTA 4QGSA 3JQAD 1NYGA 1NMEA 1TSFA 1R4AA 4BY6B 3EFHA 3E3OA 3AV3A 3HHEA 3V5NA 3ZY6A 3VS0A 1FQWA 2P4UA 3BSWA 5K4GA 1SUDA 3FPHA 2QMZA 3UMYA 3AB3A 1WCIB 2I8AA 2WWRA 3KRTA 2X0IA 4ZHQA 4ZI7B 5A5FA 3D59A 2GEJA 3CLKA 2X76A 3N05A 4KDFA 2NGRA 1NURA 4Q4HB 4RS4A 1LLQA 1UKBA 3GMDA 1M6EX 2FZ4A 2X3FA 4RK5A 2QW1A 1NP7A 3F47A 3BXOA 2IJGX 1A9XB 2WIFA 3CPWA 3MK31 2VJMB 2G1PA 4XQEA 3WWPA 2KPOA 3DE6X 4IGFA 2FEMA 1WB4A 4R8LA 3CVXA 3KYCB 2FE1A 3LW8A 3R24A 4DKXA 4E0BA 2DC1A 1D4FA 2PS0A 2NTEA 2HZYA 1ZK3A 2BFFB 2JCXA 4PG5A 4E1BA 4TMYA 2PXXA 3RNOA 1CYEA 3T0FA 2CK3D 3PPXA 4TM7A 3SAJA 5M5BA 2YLCA 1XCMA 3BVPA 4D98A 1CJTC 1P91A 2AKAB 2XF2A 3ZWCA 3TAUA 1WVMA 1KYZA 2HK7A 2V7BA 4GOMD 2BZ1A 3IUMA 3G02A 2EGGA 3VTFA 3NORA 4DCUA 1TYDE 4ECEA 2J0EA 4DBLC 3B6EA 2O05A 1TF2A 2ZRJA 1M90U 2HUNA 2QYSA 4G97A 3DE3X 2RGWA 1M6VA 1RZVA 2XE4A 2CHFA 3FGNA 4IVQA 4X3OA 3ZYZA 3I6QA 5A4MS 5ELXA 3EH1A 4JT9A 1QF6A 4XX0B 1NVVR 4K2HA 5AVTA 1MEJA 4BMNA 2OTJA 5L3QA 2DWUA 4DIMA 4QQRA 2IS2A 1MVLA 2F1LA 1F8FA 2LKCA 3R0IA 3GIBA 3DEIA 4BVJA 2OHVA 1Q57A 3HBAA 4KN9S 3NJRA 4F12A 2IUEA 4G4GA 4I14A 1O97C 4OLAA 1WDKA 3GBSA 4PLLA 5NLLA 4XGNA 3DTVB 4LCEA 2Z30A 5LJLA 2IHKA 4LDZA 4BV8A 2UYQA 3EX7C 4H16A 4DQ2A 6AT1A 3HRTA 2WUFA 3GOXA 2ID8A 4F9TA 4RTPA 3LT4A 5EQFA 2QTWB 4QULA 4R3UC 3S28A 1I4K1 5SYMA 3D5TA 4YRIA 1W73A 2I76A 2ZR0A 3GL9A 4P3PA 4RW0A 3UANA 1B7GO 3E8SA 3X44A 4A36A 4HX9A 4P4SA 3SICE 1BI1A 4LPKA 1N6HA 3K0KA 3GP8A 1BHO1 1TK3A 2FX2A 3Q5GA 1NQVA 3ZE0B 3OIUA 1VA7A 1UDBA 3IMKA 2D5CA 1ZD4A 3GZNA 1BH2A 3W9YA 3DE4X 2VEOA 5ES4B 1DGQA 1CJKC 4OB6A 1CETA 4OJMX 3QWXX 1GZSA 2WJGA 1OFUX 3NETA 4NJEB 4ILKA 5CP8A 3TMAA 4EO9A 1FYEA 5AK4A 5EWMA 2LXNA 3DKKA 4ZCRA 5JEDA 2LBPA 1GQFA 4JI7B 3ZS9A 3LF2A 1TQ4A 4N0DA 2AE2A 1WA7A 4CQNA 3LDFA 1F2UB 5CVIA 1ZMTA 3ASZA 3N87A 3M3HA 4I46A 4F2PA 4F4CA 2RQWA 3OW2A 3OM1A 4KDCA 3UATA 2ZZMA 1RBYA 1G41A 3TJRA 2HMTA 1KZ7B 5IKEA 1UWCA 2XCUA 2BD0A 2GK4A 3RVKA 2XUKA 3AVYA 4GLFA 1EK2A 2AW5A 5CO7A 1R5JA 1S1CA 5AHRA 3LBHA 5LQNA 1TZMA 4L0MA 4N48A 3I2KA 3C3DA 4B74A 1KDRA 4UVEA 3LUKA 2NYRA 3R8CA 3NMUF 4I4NA 1VHWA 1QH8B 1YRYE 3TXXA 4HRXA 1TWBA 3HDVA 4RULA 2PFSA 1OFTA 3EIEA 3HXOA 2IUTA 3PE6A 2VH2A 4HQOA 4JP3A 4KXVA 4X45A 2RJDA 5FV7A 5IEJA 1XNRB 1K8AC 2JGFA 1PK8A 1I5EA 4OTZA 2F59A 1EX4A 1YMQA 4ND7A 5FOVA 5K3CA 2ZCJA 3RAGA 1N27A 2A9VA 1IMJA 3PEEA 5LBUA 2D0IA 2FN7A 4FN4A 4YQZA 1NAHA 4RM0A 1P7CA 1Z2CA 4TUYF 3FI9A 2EQUA 1TM2A 3A4IA 4R1SA 3L2ZA 1ND5A 3KETA 3V4PB 1FXUA 1E4EA 2WAAA 1TU0A 1B8OA 1VYTA 3NC4A 3RVLA 4F93B 1HFWA 4WY2A 1ZCBA 2IPAB 3W9SA 3TFWA 3VC7A 4D8UA 2D1RA 3AUYA 2P9BA 3G59A 4FDUA 1QCDA 3LKZA 2BFDA 5AKIA 4HX2A 4JCOA 2PRYA 4HVWA 3GVPA 3HUUA 4WCFA 3RF6A 3MTIA 1NRIA 1JBMA 2D8JA 1YH3A 2GKGA 5P8WA 1C9MA 2Z9CA 4LHWA 4KR7A 1XFAA 1XF1A 2ACVA 2BFEA 2VHVA 3UWPA 1ZWKA 1RAEB 2YASA 4XSGA 2V6BA 5AKGA 3ZVKA 3KSUA 1NZFA 2H52A 2XRZA 1CEEA 1QH8A 4Q18A 3MUNA 4PLTA 4CMAA 3BWVA 5ARDA 3CUSA 3LBYA 3TNYA 3C5HA 1CF4A 4WZTA 2YRVA 3LU1A 3RFUA 3KHSA 1C30B 4EFMA 2R9VA 2XKJE 2AOXA 5IAKA 2QTTA 1BVYF 1JAXA 1UTIA 4J0JA 1VQKA 3TU4K 1ULAA 3AF1A 3KT6A 2PXAA 3LQFA 1TU0B 4CMCA 3L0ZA 3UV6A 1KI4A 3DMRA 3ZEAA 1YF3A 1G4UR 2HQEA 3AZPA 3ZQUA 4KE8A 2G3RA 3N0TA 5BSWA 2UVDA 2ZTSA 3D6VA 2H1FA 1IG0A 2PG3A 4AMVA 4D92A 1A27A 2WIKA 3U7IA 3SD4A 1L8QA 4HXGA 2WYUA 4Z4CA 3RM3A 1Z4MA 3V8MA 4HLQB 4MQUA 1Z08A 2OA0A 4L5YA 1QP2A 2CBGA 5JMTA 1TU3A 1SCKA 4AUNA 1RXIA 5AI5A 3TZLA 4Z4GA 1X6GA 4LBWA 3SGLA 3O3CA 5FFFA 3K6RA 2GK7A 2VBUA 4JU9A 4Y7DA 5BUQA 1F7UA 1MLDA 4RPIA 3NAQA 3PLAE 1UFRA 2O7VA 3W5HA 3LIIA 5TRTA 1COWA 3A4LA 4YH1A 5B1EA 1UD4A 1A4UA 1MENA 5HIIA 1QVFP 4FYWB 1Q0QA 1UWLA 1WSDA 2C2MA 2J5RA 4OMLA 1N7IA 2QAJA 4W1PA 4RLZA 5CA0F 3NEYA 3WP0A 3GAMA 2HMAA 3RMSA 4Y92A 1W52X 4CKBB 3F0TA 1XROA 1B6TA 5CFOA 4A16A 3SJZA 4NEHB 2VYQA 1UGPB 1D1PA 1XZIA 4DG9A 3NT4A 4BP8A 2VGNA 4WQMA 3WNBA 4RZQA 4Z2AA 5IM4A 4L7VA 4OI4A 2EYUA 4RA6A 8OHMA 5IHPA 4XWWA 1UC4B 2XGGA 3L41A 3GROA 4QJ5A 3BB3A 5K2OA 1DIOB 1XWFA 2VRBA 1RAAB 3JVIA 4LY6A 3R7DA 3BQNB 3BZWA 5LWHA 1I30A 4UAUA 1YZHA 4QDXA 1UZMA 3C7KA 3QU7A 4IFTA 1ZUUA 4DJJA 2BGUA 4W5RA 3D8BA 4KR3A 3QEAZ 1A8PA 1GUYA 2TMKA 3BJRA 1I7NA 3ZXXA 2EBHX 2QMEA 1YWPA 5BSRA 3NM6B 1FP4B 4J0GA 3IUJA 4JLUA 2IYNA 5DM7R 4G5QA 2PJRA 5DEIA 1QUFA 4ZAWA 1FS6A 3H3XA 2G4LA 4MO2A 1NNEA 3USES 2WMOB 4MRSA 4FGKA 3L01A 1D6NA 5LQMA 4ZXPA 2W6JA 5DLEA 1T25A 2V3WA 1UPTA 3LDAA 2GXAA 3UXMA 2XUGA 2H4YA 2OVBA 3TAHA 1OOEA 2O6LA 2O5VA 1JNYA 5E7QA 4EZBA 4IXMA 4PNPA 3ZCUA 4GXQA 5LP6F 3AJRA 1YJWT 3BL5A 3KJNA 1NYQA 3HNPA 1U1GA 4FFVA 4I50A 4MVYA 1XZKA 5H5JA 4I4TA 4MRPA 3R9XA 2BFCA 3ZXIA 4TXNA 5KS2A 4Y0VA 3L6BA 4GP7A 2C0QA 4XVQA 3EHQA 1OGYA 5K20A 3P9ZA 1U7XA 3O47A 1B1AA 2R7NA 5AVKA 1ZNZA 3UCXA 3U80A 1O58A 1G5TA 4Q4HA 4WLOA 1NXXA 1Y3HA 5IDYA 2W9XA 4MPDA 4IGAA 3T06B 2FEWB 3QEJA 1A5BB 2GPWA 2OGTA 3K0EA 5HTKA 1R88A 4Q39A 4TYYA 4XWGA 4W1RA 2GS9A 1KVRA 3INYA 2ATCA 2FYTA 1ZCJA 2YIMA 3T61A 3OPOA 4X7FA 1CFZA 4LJ6A 4OQFA 5A8AA 3E9FA 3OSSC 5FB3A 5EXDA 4C0DB 1NBOA 4WDQA 5FU6C 5MN4A 3E1SA 1PJBA 4U6NA 4S05A 1QLHA 4TGLA 1AZSC 4RPBA 2OP1A 4PS1A 4DA6A 1Y5NA 4YJGA 3JASB 2QJTA 3V1NA 4DQLA 3CC2B 4PPNA 3SBEA 4GLLA 1JAHA 1IVSA 1PL0A 1CRZA 3VS1A 1TCAA 1XZAA 5F4OA 2ENWA 4QGHA 3RVDA 3WGVA 2R1TA 2GFAA 4TWZA 2C98A 3R4VA 2H54A 4N8EA 4RVDA 4KQJA 3ZEIA 1HT2E 1YP5A 1YI0A 2PGJA 2JFHA 1U3CA 1Y71A 3F6PA 4QUAA 4XGQA 5HF6A 4ZGBA 1M1XB 3NOVA 4H4CA 1SBQA 5F7ZA 1D07A 4D2IA 3ADCA 2O3UA 2A30A 5TS3A 4AVYA 2VSYA 2HL3A 3W3AA 3I6IA 5G2OA 3GDWA 4BP9A 3PBKA 1FTQA 1VQ4Q 4Y6PA 4OH7A 3W8FA 4B76A 5HXAA 2QMOA 4UULA 4RTMA 4YJFA 3E8XA 2P79A 1UQRA 3QBTA 1CSKA 1MUZA 1HE8B 1Y6JA 2PVCA 5A0LA 2HRCA 4B2IA 3RREA 2WWGA 3TBFA 1B07A 4QUIA 3CCQQ 2C2ZA 1XEFA 2X4DA 2ECPA 4MWEA 4BVBA 3KAJA 2F69A 1U3FA 5F9MA 4E1AA 4E15A 1KGDA 3GT3A 3BH6A 4LRQA 4TMKA 3FWZA 1W29A 1W2WB 2QDYB 2ORIA 4BVAA 1L5VA 1NF9A 2P41A 3CRZA 1GV0A 3QVGA 1YHQT 1BO6A 1ULUA 2WQ7A 4G0WA 5KJFA 3O8NA 1ZJZA 2PEZA 3QIAA 5FEMA 1JU5C 2JTEA 3EUEA 4H7DA 1YZLA 5DPMA 4AG5A 2B9EA 2VK2A 2XWBF 3GDOA 3ONDA 3OTGA 1ZITA 4KFUA 5AESA 5AVZA 10MHA 4PAAA 1BU5A 3IQLA 1UJ4A 2CXHA 3O74A 4LTDA 4EKEA 1OH6A 4F4HA 4II1A 4D42A 1PV4A 1G8KA 3M0QA 2PMFA 4U8GA 2AKEA 1QO0D 1G66A 1X14A 3I01A 1DINA 3LPMA 5IUKC 5A89A 1STOA 1OREA 1Q7RA 2CJXA 1YZVA 2GM3A 2ZYIA 3D7NA 3F78A 3SC6A 3WO0A 3DAOA 5HEKA 3SFVA 4NENA 5H81A 4D7AA 1G5PA 1Z0SA 3CMMA 3KR1A 2R8RA 3N07A 2NVBA 3VUFA 5BN1A 1T5BA 3GLGB 4G0ZA 3OPYA 2QF7A 1E0AA 1RLUA 1UAAA 2C8VA 1KEZA 1QIKA 1ESNA 1H42A 5EJIA 2E21A 4G5XA 2O4CA 3VZPA 4EMTA 1NW3A 3B3FA 4NAHA 3EODA 5DM70 2H5IA 1VKZA 2G9UA 2LZJA 1PFVA 4P80A 1QVRA 3AIOA 2EZUA 4A82A 3DBVO 1V8DA 2MOKA 4QJIA 3MP1A 4IYJA 4HH4A 3GHHA 1BQ3A 2Y99A 5KCZA 2KROA 4QDKA 2GAIA 4K81B 5DRYA 5FA8A 4CIYA 1HYGA 4X60A 3RHSA 2YHUA 3G2KA 1V11A 4I55B 4KSCA 1Z22A 4IDGA 4DSAA 1EI9A 3P8ZA 3DTYA 2DUUA 4DLSA 5FFNA 3BF8A 3QYGB 1GUDA 5AM5A 4HDRA 4HT9A 2WWWA 4M86A 1X8KA 3T3NA 3ZFJA 3G6ET 3DMTA 5GAOm 1CJSA 1K73R 2JATA 2IIPA 3L7AA 3THSA 3RC8A 1GEGA 4BNIA 5D87A 2ZBDA 1ZCAA 4RIGA 2WAMA 5EHGA 4RSRA 3PVQA 4C0BA 1Q95G 1VQ4B 2QPAA 2FPGA 2VPXA 4L0DA 2FJUA 4JBHA 3KJHA 5J3BA 1N5OX 3TIXB 2X5XA 3VYTB 1N2HA 3A1TA 2GSWA 3M0EA 3VOAA 1M4ZA 1X15A 4HXEB 3LX7A 5EXSA 1C41A 1S7CA 2IZ1A 1RYDA 2GOYA 1P7WA 3NHSA 2CP7A 3GGJA 3SOZA 3BFMA 4LVNA 5FRNA 1MV0B 4C7MA 3CPFA 2IIQA 3G49A 3DT6A 2H1CA 4X7MA 4IDOA 1VQ9B 2ZLBA 3PC4A 1XQVA 4RPKA 1OV4A 4LE0A 1D04A 5A9TA 4FD2A 5JRDS 1NU8A 1QMGA 1P1JA 3BSFA 1E2UA 4OP1A 2NU8B 3K30A 2SBTA 4B9AA 2ONJA 4LNUB 1B8PA 1T9CA 1ZSYA 2WUDA 3BIOA 3AR4A 4JKYA 4P4UA 4PZEA 4B17A 4I2VA 4ZGDB 2F3QA 4XWAA 2XJ9A 4DBRA 3KVNA 3GLIB 4O5VA 1AHNA 5GJWB 2CVQA 4K1XA 3R6GA 1BS1A 2WE7A 4RY2A 2ZUTA 3RC2A 2OMKA 4NYIR 5T6BA 3LQEA 3FFTA 2A0FA 5H9WA 3KKMA 4IR7A 4L28A 1C4XA 4X3PA 4C6RA 1EFVB 3OIVA 1RM4A 3GXOA 2OFPA 3WI7A 1J0BA 5ABPA 2ZYTX 1DTSA 4F4JA 4Q93A 1BYUA 5A6SA 1N32B 4XSVA 5JSFA 3T3PB 1VHJA 2Z3WA 2JAHA 1L8AA 2E55A 2CZ6B 4HKTA 1U5BA 4PGOA 4ZVMA 5J2UF 5EKDA 3I1FA 2EOAA 2JAQA 4RCYA 1E7RA 3O0DA 3MS7A 2J3JA 3SR4A 3PWKA 4E5VA 4BFSA 2BIFA 1A2QA 1ONBA 1LY1A 2NO7A 2NTYC 2VLBA 3ASVA 5GOTA 4EMHA 1UAGA 3K5WA 1JQ3A 1RSZA 2D5BA 2QHXA 3CIFA 3KO8A 4N18A 4GI5A 4R2HA 5FD8A 3REGA 3RU3A 3IHTA 2POQX 1IHUA 2JFGA 4W82A 5ALYA 3G88A 3RODA 3U7HB 2E4YA 4DYHA 2H2IA 1XQYA 1YQEA 2WVJA 1J07A 1PN3A 3TK1A 4DL9A 2RH5A 4E7OA 3NIWA 1Z0JA 2B8AA 3FF1A 5HR5A 1M0EA 2WSYB 1A2BA 3RWBA 2MMPA 3NHFA 3OCWA 3KELA 1TIKA 3AWIA 4DLXA 4LXIA 4PX2A 1D9ZA 4J0HA 3DAYA 2J6CA 1AGYA 2Y0BA 1KC8C 4LF9B 3HO1A 3P20A 4NOYA 4AC9A 3BXHA 3IILA 3LXRA 1CY0A 1XDSA 2B3TA 3SFMA 3IT2A 1DQYA 1N1EA 1ARZA 2BDUA 2G06A 3HYSA 3EARA 3LNTA 3OX4A 4CC7A 1RHUA 4P7GA 3OZTA 1BDJA 1JYSA 2H63A 4GXNA 3R44A 4OAQA 3UGQA 3V2HA 2Z2JA 4HE6A 3FJOA 4MCAA 2R8EA 3CCSA 2ZXHA 1NDQA 5SYNA 1HEIA 2IXAA 4IINA 4XTVA 4WFJA 1YV9A 1LTKA 2P2GA 3BX1A 1F3OA 1MAWA 1YQWA 2YJTD 3GFRA 3OCJA 3Q7QA 2O57A 4KLCA 4YP0A 5E4JA 2WKRA 4QT7A 1BWRA 2PKRA 2HBZA 1MBZA 4RX1A 4AKIA 4Q4DA 3L0BA 4LDJA 2M6RA 2C3YA 2ZTMA 4H59A 2JOYA 4RG8A 1AOJA 1V48A 4MOWA 4TLMB 2X4WA 5CB4A 2ZDHA 1WOYA 1XHLA 3KT8A 3PQ7A 3L1JA 4GLBA 4ETIA 4FKBA 4Z4ZA 4JROA 3DYBA 5DM4A 1BIAA 1MC5A 3PXXA 5FP0A 2XTAA 3GXBA 3RIXA 3UW3A 1XV5A 3A9VA 3NDIA 5TF4A 1E79D 1PVVA 3W8RA 3GVIA 2CP0A 2QTAA 2JUFA 2IV7A 4KV7A 2DU8A 4LFBB 1TKCA 1SC4A 4A0SA 3Q6RA 3IPXA 2CHVA 4MQBA 3IP3A 3QY9A 2RONA 3WHIA 2LDMA 4G7XA 1JLLB 3HV2A 4EQ6A 3UOWA 1HDCA 4YTLA 4XSHA 4MUKA 2ZM5A 1CUEA 1UJBA 4HK4A 1N06A 4OY3A 1FMWA 2O20A 3RC7A 4R0KA 1JKIA 3LBNA 4AS2A 1UJ6A 3NX4A 4HB4A 3DTVD 1U2QA 4HAIA 3H2SA 4RHEA 1RUWA 1YBAA 2CYZB 3NBZC 1XQ1A 3CG0A 1K86A 1YRQA 4J0DA 1BHQ1 1WSRA 3IDOA 3ZQJA 1X6VA 2QZ4A 2R57A 4JXXA 2WF9A 5EE0A 2MCNA 4H6PA 5GTDA 2E10A 3HU1A 4CMIB 3I35A 1MA3A 1K6JA 2GVNA 3U7QA 3FZQA 2ZTHA 5FT9A 1A8QA 1IOVA 1LLFA 2C84A 1QZXA 2JGIA 3DQQA 1Y9JA 3ICWA 5CXUA 4RD6A 1GQQA 1VI6A 2X4YA 3F4BA 1WCIA 4LYGA 3QE2A 4QLAA 2N1MA 1ORTA 2RH2A 3V34A 4OVKA 2QI2A 4LUCA 4WJZA 5KBYA 1NW4A 3W0LB 4IOLA 3KU1A 1NJ6A 4U6QA 5GAN8 1LQUA 4OB2B 1E9DA 2G08A 2HX1A 1R8XA 1O3YA 1E2MA 2VF7A 1NT4A 1TO2E 4IKOA 1AB5A 5JIBA 3KQKA 4IVPA 1HWYA 3O75A 1DRUA 1VPEA 4WXPA 5KYGA 1TMKA 5CAEA 2A58A 5AP9A 1T3SA 3E1GA 4H77A 2BRUC 1IBSA 4H3KB 1X38A 2CT3A 4JLSA 1XA0A 5LBTA 3WDLA 1DDGA 4F38A 4LZNA 5C7LO 3I5MA 3JB9I 4NS1A 2EBWA 4D6PA 4DIEA 3GCDA 3FCSB 5C8YB 2YUOA 1M0WA 3LLRA 3I52A 1NFFA 3I04M 3T53B 3K8OE 4PYOA 3ISVA 3L0YA 3PEWA 4RKWA 2PUHA 4IKFA 4ONEA 1DAFA 3JSAA 1SXPA 3I62A 3TL6A 1U94A 5CYPA 3OMXA 2FNAA 2QQFA 2PGNA 2WD7B 2Z8YA 3AEKB 4JS0A 4PRZA 1KMHA 1K6MA 4URYR 2WIAA 5JSQA 2FZGB 4MCJA 1FJXA 1VL2A 2OGSA 1NL3A 3KQUA 4Z4EA 1RE1A 1DEXA 2O3QA 4MUEA 1YZYA 1JDZA 4X3CA 3F7MA 1E5TA 3KDAA 3PXDA 4LN1A 1JBQA 5IKPA 1AF4A 1EFVA 2ASVA 3WGTA 1LS6A 5DMHA 3O8VA 2VTBB 1GPBA 2HL5C 2D13A 2PUTA 3GBPA 4DCTA 5GONA 3O7MA 3LK6A 2D5IA 4KX3A 1GGVA 3RKWA 3SYLA 4IJKA 2KS6A 3BSYA 3E5NA 4M77C 3IEMA 1YJAA 2H1WA 4CHGA 1X19A 3L7DA 3C8MA 4PTYA 4IUDS 1SF9A 1ORVA 1GNPA 2PGOA 4FW9A 3ILVA 3ZE6A 2HV9A 3FCXA 4RBNA 2W6OA 3UYLA 3Q40A 4DUPA 2MI6A 3QLTA 3V1YA 2JI7A 1WHLA 3AI7A 2X40A 2H2AA 2BEWA 1FUIA 4MYHA 4ZEMA 3VMFA 1E4VA 4MR8B 5KKNB 3JRNA 3QLVA 4E31A 5CBPB 3M9XA 4LQLA 1UJ5A 2B98A 3WKCA 3WLSA 1VBNA 3IAEA 2G88A 3MJFA 4OM8A 2M6LA 5BMOA 4A54A 3P5BA 3HDQA 1BE1A 5EQDA 2Y68A 4N3CA 3A8JA 5CR2A 1HM5A 4HAUA 3K72B 1ATIA 3TEMA 4QTZA 1J0DA 2LX7A 1QKIA 1ATZA 1EJ6A 1Z47A 3V7SA 2MSWA 3IUEA 4FKMA 3TQFA 2IUFA 1TJNA 4JT8A 4RF5A 4GX5A 4Q7EA 4YCBA 3LY8A 3QLVC 2JS2A 1Y63A 1KI8A 2FPKA 4J3JA 1GZ3A 3H1PA 3U1VA 2AOVA 4AKHA 4HIZA 4FFDA 1TM1E 4AZSA 4DMHA 5GAOq 3I55T 3CESA 4FX5A 3O8QA 4IV8A 4MITA 4BFUA 3T3OA 2F55A 5HQJA 3HY3A 1NBMA 3A6DA 1ZSZB 2LGJA 4LN2A 4J6WA 1CUGA 1VL0A 2BW0A 3H1FA 3WWDA 4B4KA 4EG3A 4QU9A 2X4JA 4U3JB 3CMAT 1IMOA 1WLSA 1AV6A 2Z83A 2IOQA 5BY2A 3K9GA 4CL3A 1Y42X 3Q7TA 3DLCA 5GJVC 2P9ZA 1V41E 1ZSZA 3QJ6A 3O91A 3B1JA 2IVZA 1OFVA 3HWRA 1X80B 4MIEA 5JDIC 1FUEA 1PUIA 1AV7A 4DANA 2DBMA 1ARKA 3VPXA 2BIVA 1UXOA 2DR0A 4C0WA 1QRTA 1K4KA 3BWBA 4YJHA 2PUDA 3FNQA 4ZCMA 4IIEA 1E7YA 1WR8A 2V55B 4G2NA 2CZ1B 1WDLA 2NO1A 3P8BB 2QGNA 3I0NA 2Z1NA 3LGAA 1A1VA 2JA1A 5GJWC 3GNLA 1E4YA 1WSAA 4C3ZA 3TR0A 1KEEB 4OGWA 3RWOA 5KNCH 4DUGA 3U09A 3CBMA 1ZUIA 1RIIA 1UPFA 1FYXA 3RBZA 4N49A 1SBCA 5A3QA 1NRKA 3VPCA 2CF4A 4HYYA 1E6HA 2X58A 2O0HA 2Y1LA 7MDHA 3VAAA 5HF8A 1E0SA 4ZIRB 1N34B 4ARIA 2OHGA 3JB9F 1QDEA 3P0HA 1ZRHA 2Z1DA 4CC3A 1H0SA 2AFIE 2IY8A 3A3GA 4G0PA 4GNKA 2QYTA 3OE4A 3RRZA 2FOIA 2IPMA 1V71A 2IYSA 3TUIC 5I7RA 3EPLA 1KQGA 2CV1A 3CZPA 2LQ8A 1HE1C 3KBBA 4MYDA 1D7OA 3WL8A 3KBOA 5CT4A 3V9AA 3CXCB 1KSWA 2X2PA 2FP3A 2A5LA 1Q0HA 5EJGA 5U1PA 3ROPA 3ASPA 3G7ZA 1CIJA 1PTJA 2C88A 3I2JA 3C5EA 2VTBA 2YLBA 2IITA 1RAHA 4JP5A 2JGEA 4DRXB 1BS9A 2P35A 4C03A 4HF7A 5TS2A 4A2WA 3QYPA 1M2KA 5KJCA 3I56A 1LKZA 5JD3A 3WLJA 3QX9A 5E1BA 2O8CA 2JTMA 2H5LA 2XWPA 3IUPA 4G2TA 3EXHC 2Q28A 3FFWA 4NYMQ 3EGWA 2AYXA 1AUPA 3VPHA 2ZIXB 2KW5A 4ZPXA 3STXA 4D9BA 2GARA 1TCBA 4YREA 1ZJ5A 4CF7A 3FLEA 1N2CB 3ZGZA 4CM9A 4M77E 4OHFA 3TB6A 4P7BA 2BH9A 2CBXA 5FADA 3LYUA 2J4FA 2YRCA 4ESRA 2RGRA 2AEJA 3MT0A 5E6UA 1VF7A 4F5YA 1VL1A 4PK4A 1V8PA 4CI0C 1I4EB 1TOAA 3BJEA 3MMPA 2VWFA 4IEFB 5DGXA 1OI1A 2FF7A 3D8SA 3HRUA 1LBSA 3OP4A 2RB6A 5LIRA 4O8CA 4Q3NA 3EVCA 3OFND 2M1XA 3DZGA 2P5TB 3JQ9A 3TEEA 1XDDA 2KVOA 2WKWA 2ZZEA 3FNEA 3VZBA 3SQDA 3VO8A 1A76A 2WIJA 1ENYA 3SN6A 5FUQA 3TQSA 1C0EA 3CU5A 1JB1A 4QGBA 2HRZA 2V96A 3SYNA 4B33A 4Y30A 2ZK7A 3FWYA 4F04B 2QUAA 3RC3A 3S8YA 1JEDA 1JH9A 1HTBA 2YUQA 4CCAA 2QUBA 2YV4A 4G8CA 1OBVA 2OHHA 3MSXA 2R1UA 1GGJA 3P0FA 3PXAA 5L8VA 2ODWA 1EGVB 2HKIA 4PJJA 1FX0A 4MZXA 5CYOA 1EZZB 3KLBA 1TZKA 1MTZA 3GAAA 3JQ8B 1SXJC 4U9UA 1XCBA 4A63B 1PGJA 3NTRA 4TM8A 5DHRA 4RJTA 2IYEA 2XJ4A 4QLOA 2IHVA 2IEGA 4RM3A 2Q7OE 4DR4B 3LLUA 1G64A 1L7NA 3LW7A 4Q03A 4HV4A 1I01A 2R4TA 3R5TA 1G3TA 3W2FA 4Q3OA 5KU7A 2BCJQ 1X69A 1Z7GA 3IR6A 4FI3C 1UK8A 4GSKA 4QNNA 5EP1A 5J2UB 4KGZB 2L89A 4PABA 1V8BA 2O2GA 3I9V6 2G4VA 2P9QA 3SZUA 4OQXA 2L17A 5D7UA 2RIRA 3N7TA 2BFCB 5EIAA 4OAPA 5T4FA 3U3RA 2BM0A 3UIEA 4Z4HA 5FO1A 2GQIA 1E5XA 4WJKB 3W1EA 3AHHA 2FTKE 4XOIA 3G9ZA 2L69A 3W6PA 3THXA 4N5HX 3KLOA 3AVWA 3U4HA 2DGDA 5CHEA 3WFZA 2C07A 2JHPA 3CRRA 1T2VA 1U4OA 1ZGHA 2IK8A 2AUNA 4YJKA 5FOWA 2J5BA 2XDAA 3NBXX 1OLXA 1FLVA 1M0SA 3UJ7A 3WMEA 1JT9A 3CCVT 4Q9DA 3S2GA 4RLHA 1QR6A 3OS2A 3JQRA 3N5KA 3V46A 2EZ9A 1XC7A 2XQVA 4YRSA 4ZQFA 4BNNA 5D84A 2RHJA 3JYPA 4LXUA 1VKNA 4HDCA 2ETXA 4MLZA 3E27A 1KPIA 2QJOA 3C41J 3IR5A 1BG6A 2GNOA 3HXKA 5CFQA 3L6OO 1S9DA 2V4UA 4CKZA 4CU2A 1BC5A 4C2UA 3JAWA 2R1VA 1Z2EA 3FCOA 3NGXA 4KPFC 1Z6PA 3N6XA 4EP1A 1CQJA 1GOTA 1IXYA 2JJYA 4CETA 3WFJA 4L4XA 3ESBA 3I92A 3FOWA 1L9KA 4HWTA 3TBHA 2DIQA 4L8GA 4DGQA 1A7KA 3JZMA 3Q12A 3EA5A 3ABZA 1BOOA 3T34A 2BMAA 3KUDA 3NWEA 1L1EA 4DXAA 4BNZA 4GWGA 5IUNC 2DEUA 4FYVA 1UOEA 3M5WA 3PUYA 4PXYA 3PIOA 4BXOB 3CCVB 4BI8B 4CLRA 4LWZA 3AX6A 4DY6A 3TNLA 1NMQA 3WQRA 1KO1A 3JD2A 2JPDA 4MCIA 4P98A 1KOLA 2X5KO 2CLOB 2Q27A 3GEPA 4RFLA 3PC2A 4M0UA 4RH0A 5F35A 4QO8A 3N5CA 4BFVA 5A06A 2EQMA 1CUYA 2BUCA 2IYRA 1H6DA 1LC0A 4ESEA 2OHOA 4KEAA 1ZM7A 3BMQB 1NVWQ 1HE4A 3PMTA