2DERA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
364
structure length
348
Chain Sequence
b'AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
total genus 90
structure length 348
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2derA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2derA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2derA01
3QE4A 1BX1A 4NATA 4ZCMA 3CMEB 2H2AA 4HPWA 3ZJVA 3HFJA 1N2JA 4GU5A 1M83A 3CLTC 2IJGX 1YI8A 2QUHA 3ND5A 1EFUA 3SJZA 3CC7B 4AQ7A 2PZAA 1W2BB 3OZVA 2DLCX 3MLAA 2PZBA 2J7KA 1Q15A 3IODA 3MLBA 5TS2A 3CRZA 1N3LA 4Y9UA 3VO1A 3OJXA 1QFYA 1E62A 1B2RA 1K92A 2HGZA 2YWBA 4MUIA 3ZZ0A 4ZT6A 2QJOA 4HE5A 4K1XA 4DE5A 1F9AA 1N78A 2OTLB 2YWGA 1VQ8B 2JAXA 3SZ3A 3DV2A 1TFUA 3NBKA 1H3EA 2BGIA 1PFVA 3UY4A 1JB9A 1SURA 1QU2A 4P6VF 4MW9A 4DJAA 1QFJA 4YP6A 1JNYA 2VXOA 2QUKA 1NUUA 1D1NA 2NPFA 3CCSB 3CW2A 1YI2B 3TZEA 4PC2A 2B7LA 2ZUEA 1OWNA 1S0UA 1G8HA 5H16A 1J9ZA 1OWLA 4G1BA 1ZUNB 2YWEA 3HL4A 3P52A 5KCMA 1ZM2A 4AS1A 3W5HA 2B7BA 1VQNB 2X1LA 4OUDB 4B47A 5KHAA 3S3TA 3CCLB 1QUFA 3E20A 1M1KD 1NJID 1ZM3A 1O96B 3WNCA 2QJFA 5JBNA 1XJQA 3K9WA 3LO8A 5TV2A 1IH8A 1M8JA 1J1UA 1HA3A 1ZUNA 1YJNB 2DERA 3AIIA 2WQ7A 1M90D 2VNJA 2XNCA 1EUYA 1GZUA 4OUDA 1WQ3A 4F4HA 1FNBA 1NUPA 1S4MA 1TYDE 3QTTA 2GPJA 1KK1A 1JEEA 1O96A 3AVXA 3B82A 1QRTA 2YXNA 3CPWB 2A4MA 3FNRA 1YITB 4TMXA 1M8PA 3P0IA 3AFHA 1A8HA 3C8ZA 3CMAB 4EG3A 2RD2A 3CC4B 3CCQB 4U9UA 2HCJB 3FDXA 5TEVA 3E27A 3ZBTA 2A1UB 3ZJUA 1N2OA 4ND7A 3W2HA 3WYAA 1WZ2A 3IMCA 4I6GA 5H5JA 3IH5A 5HUHA 2GOYA 3AKZA 1Q81D 3CLSC 3IVGA 1U3DA 4PBRA 4B48A 2DXIA 4AF7A 5K0SA 3IOCA 2XEXA 1JZQA 1EXDA 4AC9A 3A2KA 1DDIA 3QE2A 1EP2B 2A1UA 3AGQA 1JEDA 3Q10A 1BS2A 3CVXA 1D2RA 5FNZA 2CYBA 3I56B 1O6BA 2QA4B 1YIAA 2C78A 1T6XA 4PC6A 4B44A 3FOCA 2YWFA 4MW4A 1KK2A 2ZITA 4MUEA 2OV4A 4Y7CA 2EIXA 1BX0A 4RD6A 1R5BA 1J1ZA 2PXHA 4EG6A 2VTBB 1N75A 4U63A 2QEXB 1Y42X 3KT0A 1KH3A 3W2IA 1U2RA 1HYBA 4ZCSA 3ISJA 1CT9A 3UC5A 3DO8A 4KR7A 1YJWB 1M8FA 3CA8A 4R0NA 2RC5A 2JA2A 2DCUA 1VBKA 2QUIA 2VTBA 4J75A 4MUKA 1KRHA 5DASA 1JIIA 1VLHA 3IOEA 2V0GA 2OQ2A 2PMDA 4IW3B 4N3GA 4MYUA 1JIJA 3ELBA 3MMXA 2CV1A 4C0SA 3LCJA 3JQPA 3UOWA 3G6EB 3ZZUA 1DARA 3QFSA 3OTWA 1T9GR 4UZFA 3SYTA 3TNJA 4LBWA 1SM4A 1U0BB 4MWBA 1K9MD 4EF6A 1PFUA 3ZIUA 2BVNA 1JJ2B 3ZXSA 5TY0A 2CUZA 1JA1A 1QX4A 4H9GA 2CFOA 1KH2A 1KKUA 1VQMB 4YAOA 3U1VA 3D6UA 4R2MA 1Q7YD 4ND6A 2J07A 3Q12A 4EG4A 3HGMA 3WBJA 2HMAA 1QGAA 2QTLA 3CC2B 4I6JA 1KQOA 4ACBA 1J70A 1JIKA 1IFXA 5IJXA 4MWCA 3VRHA 4ZT7A 1JZSA 1NZJA 1YJ9B 2DR2A 1O5TA 1FYDA 4EG5A 4QBTA 1JHDA 3CLUD 3QTBA 1QRSA 1JILA 2A7XA 2NZ2A 1H42A 3IVXA 3IVCA 1GAQA 3ILVA 4G5FA 3COVA 4WNYA 1IVSA 2X1MA 4HK4A 4TMZA 3CCMB 2A1TR 2R5WA 4MAFA 4YBRA 1QTQA 4TN1A 1M8KA 2O5RA 1NUQA 3PXUA 3ZGZA 2JANA 5FO1A 1A8PA 1ILEA 1OBCA 3BL5A 1FNMA 2QUJA 3CB4A 4F7DA 1VQPB 3RFFA 4LBZA 4NZPA 4UZEA 1QFZA 1M1ZA 2XNJA 3U2QA 3ZBUA 1EFTA 2OTJB 3SEZA 3SP1A 3VU8A 3DPIA 2XRZA 1O97D 4J0QA 1VQOB 1J21A 1O94D 1Q19A 1WKBA 1YUNA 4XFDA 3SEQA 1IB0A 1KTVA 2FX3A 4B4DA 3GLVA 1LI5A 1MRZA 3AVTA 4ZCRA 2QJTA 4MW7A 2QMUA 3W5UA 1IRXA 4DDKA 1OBHA 3ND7A 3LOQA 1VQKB 2BTEA 1G7RA 1S72B 4H3SA 4WQMA 1O95D 1QVGB 5TR9A 5THXA 3PNBA 1AIPA 2A86A 1GAXA 1TYAE 3K32A 4JXXA 4BWVA 4PBTA 1MAUA 1KJZA 4RD0A 1WJGA 4MW2A 1F7UA 4PY2A 2J5BA 4HE6A 2A88A 4NAHA 2DEUA 2B7CA 4NCNA 5BNZA 3G4SB 3PENA 1DDGA 1FRQA 2DY1A 3IMGA 4KR9A 4AF6A 5F23A 2WSIA 1XB2A 1CQXA 4G5YA 4KPUB 1N8RD 1MJHA 3OP1A 5HXBA 4TMWA 2G36A 4MVYA 1VQ9B 1YHQB 4XSVA 4DNXA 1D8TA 2BV3A 3LE8A 4ZT2A 3IOBA 3CLRD 3G6KA 1K4KA 4ZGNB 2BPOA 4YHBA 5AHWA 2QN6A 2BF4A 4RPIA 3WNBA 1W87A 1OWOA 2VNHA 4N3NA 3AG5A 1VQ5B 2D13A 3HZRA 4M0LA 1PFYA 3MXTA 5LM3A 1W35A 2YWHA 1DNPA 2Z08A 1IQ0A 2D5BA 4JXZA 4NX2A 4KPUA 4ZT5A 1QGZA 1EWYA 4EH1A 3CLUC 3G71B 2HDNB 4QREA 3CCEB 5IHXA 1ZH6A 1U7XA 3FY4A 1X6VA 4J76A 4K0RA 3RK0A 5J59A 5DB4A 1WY5A 2C77A 4Q7JB 3RK1A 2E18A 2QTZA 1R5NA 1MB9A 2IP1A 3CD6B 1H3FA 1WOYA 3PNYA 2YY5A 3CVYA 2RE8A 1VBMA 3PNVA 3I1FA 5JBQA 3SDBA 3VGJA 1KQPA 4MW5A 4FK8A 1F4LA 1GN8A 1OD6A 1YULA 3TZLA 1TYBE 2HZ7A 4YP5A 4MYTA 1GPMA 1E63A 1GLNA 2A84A 1N0UA 4MULA 1O0CA 2BMWA 4U7JA 1K73D 1O0BA 4Y9RA 4S1OA 3CVUA 5K0TA 1VBNA 2IELA 2EFGA 1JECA 1JGTA 4UAJA 1KD1D 1O97C 3NV7A 5DSZA 4YMIA 1EUQA 1K97A 2EL7A 1O94C 3FH0A 3CVVA 4PGOA 3I55B 5HG0A 1OGIA 4M1KA 2GM3A 1T6ZA 3QFTA 2QTRA 3INNA 1IJEA 4NDAA 4TS1A 4PC3A 2CV0A 1G8FA 1VQ4B 2PG3A 4ZT3A 1I2DA 3W2EA 5TGTA 1N2IA 3I05A 4DDMA 3FPKA 1FFYA 4YAWA 3A4IA 1QRUA 1N2GA 1NSYA 3ZJTA 5KSWB 1O95C 1KAQA 3VO2A 4ZCIA 4LBVA 3TS1A 1F7VA 1N1DA 1TYCA 1OWPA 2BSAA 1BJKA 1EFPB 1H3NA 1IJFA 4RCZA 4GRIA 2D74A 1WQ4A 2NSYA 4ARCA 3ZC3A 4XFJA 1TUIA 3N05A 1F60A 3H9BA 4EG1A 1V47A 2J09A 4MVWA 1GVHA 4MW0A 3CVWA 1FDRA 4FWTA 2TS1A 4MVCA 1QNFA 1Q86D 1WXEA 1G7SA 2OK7A 4M4SA 3B78A 4C43A 2AZXA 3VNUA 1M8GA 3P0JA 1QJCA 3WXMA 1EFPA 4EFKA 5DEOA 4PC1A 4QHYA 3JQRA 1XNHA 3X1JA 2YWCA 3F3MA 3CLRC 1I6KA 4MUJA 1K4MA 3AL0C 2CRVA 3NBAA 5EKDA 1DG1G 1N2EA 1ZH0A 2DPLA 2E1RA 3P26A 1VQLB 1QH0A 1JA0A 1D2EA 1CNEA 2X3FA 1TVCA 4MUNA 3AVYA 1YUMA 1VQ7B 3H97A 2PIDA 1FNDA 1VL2A 1ULHA 1R6UA 4JZYA 2ZUFA 4ZCQA 2WQ6A 3E1YE 1NDHA 4QRDA 4M53A 1P7PA 3J81k 2OK8A 2RC6A 4RUKA 4A91A 1QUEA 2AHOA 5EMNA 4P3YA 2VYQA 1KC8D 3SZGA 3TQIA 1K8AD 3W2FA 3OZWA 4B43A 1QGYA 1IHOA 1WDTA 2QTNA 3QFCA 1MB2A 3WNDA 1GTRA 3M5WA 3A05A 1WXGA 3HMQA 4MWEA 1KP3A 1H1TA 4RD3A 5J5AA 3MUEA 4P2BA 3RHSA 3UK2A 3WY9A 4DQLA 1NUTA 4MVXA 4K03A 3OJWA 2PZ8A 1G7TA 2VNKA 3G59A 1F20A 4CDMA 3FI0A 2BM1A 4LC0A 3N2YA 4MQ6A 2CT8A 4KR6A 1G7CA 3FETA 2CNDA 1NI5A 3W2GA 2H29A 2BYTA 5TEWA 3W5VA 2CYAA 2QDXA 3GMIA 3KT8A 5J58A 4R71A 3ND6A 4G1VA 2E21A 1UFVA 4Q93A 1MAWA 1X8XA 1SKQA 3AVWA 1PG2A 3RJZA 3P0HA 2O8VA 1T6YA 5GV8A 1N0VC 5FA6A 1BQEA 3MCAA 3FJOA 2C5SA 1N2BA 1WXFA 1J20A 3AVVA 3VNVA 3DLAA 4MLPA 5LLTA 1GR1A 4PC7A 1GTSA 1OB5A 1GAWA 4M2LA 1I7PA 1NURA 4BPRA 1QG0A 4ACAA 1AMOA 3KT3A 4L2IB 4CQNA 1TEZA 5H7XA 3Q4GA 1COZA 4MW1A 3KFLA 3KT6A 1KH1A 4X0EA 2CV2A 3N8HA 2GKSA 1KORA 4JYZA 3COZA 1EFVB 4EGAA 1FNCA 3LVBA 4YAUA 3AG6A 4Q16A 3ES9A 4NBSA 5LFAA 1PFWA 1QQTA 4L2IA 2CSXA 3H99A 1R5OA 1TQ8A 5FO0A 4RD2A 1N77A 4RD1A 1OWMA 1XNJA 2DUMA 3IUEA 4F3RA 5H59A 3JQQA 3CCJB 4WSOA 5HUJA 1H85A 2R6HA 3VMFA 1EP1B 4ZV4A 3UMVA 3U6BA 1EFVA 1R6TA 4NAUA 1N2HA 3CCUB 1J09A 3IMEA 4PBSA 1UMKA 3N9IA 3CXCB 2Z3VA 2Z09A 1IQRA 1PG0A 1WXHA 4YP7A 2AKEA 3HV0A 3G5AA 4JFAA 1E64A 4MWDA 4U8HA 3CLTD 1MOPA 1YIDA 3FHJA 1EJ2A 1U7DA 3MMPA 3QSYA 5AN9A 1TTTA 1VQ6B 5KWVA 3AVUA 1CNFA 3COYA 4I6EA 3IUBA 4R2LA 1QU3A 4YALA 1OB2A 5DK4A 3RBAA 2PIAA 1ZM4A 3OZUA 1YIJB 1QVFB 1I6MA 3P27A 1I6LA 3H05A 4ZCPA 1IQUA 1U3CA 1MBZA 1T9GS 3L93A 2J4DA 4RD4A 1EE1A 1TLLA 4OJMX 1G8GA 1XNGA 2X3UA 1B6TA 3TQOA 1NP7A 3X1KA 2BN4A 3CCVB 1XE1A 1WXIA 2AG6A 2ZP1A 4RJLA 3FIUA 1ZJWA 4G5GA 4B3XA 4CT0A 1KQSB 2V0CA 1EFCA 1GJRA 2VNIA 3QFRA 1Q82D 4ZCTA 4MUFA 3CCRB 1EXMA 1FRNA 1KK3A 4ZCLA 1RQGA 3COWA 4MUGA 1LW7A 3H9CA 3FG9A 1JMVA 1LI7A 2BM0A 3D6VA 2GQFA 4YAFA 2D54A 2PFSA 4HJXA 1NYLA 4FN5A 4TMVA 3L92A 3ZUGA 1R6XA 2CYCA 1ZM9A 1KAMA 1V8FA 3FWKA 4ZT4A 3A04A 2DETA 4ZGQB 4DQKA 3ZZTA 4E1AA 2PLFA 2WB2A 2A1TS 1KK0A 4LBYA 3PRHA 4DDHA 1NUSA 1GO2A 3OW2B 2BGJA 4RCYA 2E0IA 2E89A 1KQNA 4EG7A 2VZLA 2I1LA 4QFMA 3WBKA 2EJCA 2J08A 3JXEA 2B5OA 4FZJA 4DLPA 1Q11A 3IDFA 4KKVA 2X0KA 3ZXIA 4G6ZA 4ARIA 2QTMA 4MW6A 3V76A 1G59A 3CR8A 4HJRA 1ELOA 3MHPA 1W34A 1MC1A 1Q77A 3GUZA 3X1MA 1EP3B 3U6KA 1B23P 3B8HA 2XRYA 4MUHA 4CDNA 1OGJA 4TMTA 1KP2A 3AGPA 1KR2A 4EG8A 5GV7A 3CLSD
chains in the Genus database with same CATH superfamily
3QI7A 2FPKA 3EXHB 1CZKA 4IUCS 1GCQC 4ZT6A 3X0DA 3HE3A 2UAGA 3T1OA 4UM9D 3LTEA 2ONKA 2EZ4A 2AE2A 3V00A 5IDWA 1WP6A 2FDCA 4P32A 2NSJA 2ZSAA 2VKTA 3GELA 1LDBA 3R3JA 2VC8A 1M75A 1HDGO 1YI2A 4WJLA 1AK2A 2ZRQA 2ZRIA 2E85A 2JJQA 4C0JA 3H5LA 4D44A 4D6YA 4KXQA 4D8WA 2H3EB 1RVDA 1CY1A 2OOKA 4KHZA 2C9MA 621PA 1ITZA 2FOIA 2MOKA 3FDIA 2CCGA 1Z9BA 1V6CA 4BD3A 3AMVA 3BE8A 4H16A 3UFBA 4BMXA 2E55A 3ICCA 3PJGA 1Y7HA 3NONA 2JCBA 3CIOA 1TB4A 2VEOA 2E4YA 2CYBA 1LCKA 4LNHA 1M2NA 1UOOA 3R6JA 1E6LA 2DUNA 7GPBA 5B7GA 1G41A 4FYJA 4TLLB 2PT7A 3HJUA 2BI8A 1QS0A 5JPCA 2PX5A 3PHLA 3S2SA 3SIWA 4ELZC 1G3YA 2JZCA 4C8QG 4NFLA 3TNJA 2IXTA 4LBWA 3UG7A 4MWBA 2X53S 3T5AA 1QX4A 1L1EA 3PWSA 4DMHA 1IN7A 3DZIA 1W5AA 4HNAA 5HIIA 4K6HA 2EYUA 4E15A 3DQZA 1D3AA 2W2XA 4WLUA 1DQSA 4A4GA 2WJPA 2ZK7A 3FMPB 2LQKA 5A7GA 1MMFB 4DCVA 3MWDB 3V34A 1QIEA 4WLEA 3K70C 3IV6A 1SFRA 3FLEA 3X43A 1ZIPA 1MU0A 1E7OA 1TRKA 3S81A 1TRHA 2P6PA 2YN4A 2MAMA 4Z02A 4J6EA 1WZNA 2CLDX 3IALA 2GB4A 1ZH4A 3I04M 3AEXA 4F7UG 4EYQA 5CQYA 2VJMB 5A0LA 2NZUG 1NN1A 4KIGA 3EIFA 5GAN2 5KWEA 1V25A 3CD6B 1WPCA 1GXSB 1L5WA 4LZWA 4EZEA 4UOEA 2XJ9A 5F1PA 3JQAB 3E7WA 4LDWA 4ICIA 5D7UA 3VHLB 2J06A 2VXCA 3ZL7C 2IXBA 5FTNA 3VKVA 4NFYA 4M9QA 4MV6A 1VQ4A 1E3SA 3IX7A 3VO9A 2EARA 1JT9A 1V3TA 2XTJA 4J9BA 2I6XA 3OQJA 2GAJA 1QKWA 1EFPA 4AG6A 1XNHA 3VH1A 1TUDA 2N46A 1S3FA 1ZXBA 3TPFA 3C3CA 4TWBA 1SCJA 3H97A 2QTXA 5C34B 3MBKA 3HB4X 3M53A 5T6BA 2JCGA 2BMVA 5J35A 4PJLA 1P5FA 1MB2A 2R65A 5DHSA 4JHXA 1C3XA 3GP8A 3PL1A 3B6EA 3R9XA 3FTFA 1XZJA 2HBZA 4LISA 1RE1A 1PNRA 4E4RA 1MAAA 5KTOA 1FDIA 3ASYA 4OJQA 2QIPA 3K96A 3R5KA 4UHJA 4N3AA 1RWWA 1CERA 3E3NA 4NL4H 2CVQA 2BC9A 1MXFA 3OBIA 5CX4A 1C0MA 4Q34A 2E3HA 2HQSA 3Q87B 2Y4NA 3FNHA 4MKRA 2CP2A 1RKQA 5IZ4A 3FYTA 2J31A 2F9MA 4C8QA 3KLMX 5KMGB 1V0FA 3P20A 1U5BA 2VPXA 3JVVA 3AKDA 1UPAA 1CF9A 2QE7A 2FP4A 3X1KA 1TOAA 2YMQA 4BQIA 4RW0A 1N0WA 1Z75A 2IDZA 3QYAA 3QE3A 5BV0A 3AR9A 4DDHA 2VDNB 4C08A 5EHGA 4JYPA 1UXKA 4BX3A 3UCEA 3TFWA 4CIYA 3FGNA 1UEIA 2CSQA 4WOJA 3A1EA 3E0XA 5D3ZA 1F17A 1XLTA 4E2YA 1N2JA 1B42A 1E3EA 1ZCFA 4GY5A 5JC8A 3YASA 4ROTA 1MABB 3A9UA 1K4YA 4A6PA 1C1HA 5TRDA 1O0SA 3CX7A 4Z99A 4J9FA 3ESCA 4F7UA 1GXIE 1CJUC 2W2QA 1E98A 2OFXA 3BQNB 2EYXA 1ZO8A 2IPLA 4N12A 2B7BA 2X1LA 4HZUB 4RTKA 5DO9A 1JDZA 4F4UA 3ID6C 5C35A 3SJPA 1DAHA 1WQ3A 3ETNA 1XQYA 4XVRA 2ISSD 4IZHA 2BM8A 3R24A 2FPOA 1JTVA 2M51A 1EWKA 4AT1B 3CZ5A 4B8WA 1KO4A 3EDCA 3TIXB 1G2PA 4WY2A 3GF4A 1I3NA 3FPEA 3BH7A 1VXOA 1G291 4NOLA 4WNIA 2ZCFB 3D0KA 3W78A 1HNNA 1C5KA 4QWMA 3C97A 4EG6A 1A7UA 2GLTA 3WWZA 1UEXC 3O31A 4RU1A 3CEJA 2Q2QA 1K5HA 2V0GA 4DV4B 5D00A 4Y92A 1UXHA 3FZEA 4TYQA 1GUFA 3GEEA 2OC9A 4X6XA 1NJFA 3EW9A 5CYFA 3I3SR 3D2LA 3IIJA 3AUUA 1HRKA 4Q1AA 3FTDA 2ON6A 4ILEA 2AL7A 3KL4A 3IVCA 5JDCA 3CCMB 5JYCA 5KDLA 3ISTA 4UAGA 2MMPA 4Q4AB 1EEXB 4C07A 3MTIA 1XMSA 2GRAA 1K8RA 1C4XA 1WM1A 4V2SA 3TAHA 3UJBA 1B76A 1YI2Q 1N7JA 4DLTA 3IPXA 3TM5A 3DEAA 2GA8A 4OM8A 2EKQA 1PKXA 5CVJA 4N49A 3R3VA 2JJ9A 4BUCA 4H1TA 2K3YA 3MB5A 2P77A 5TR9A 3VHXA 4Y0AA 1TYAE 1L4BA 3RKWA 1SWWA 4NCNA 2EL9A 2DO3A 5AXBA 5HCUA 1VGVA 4WOPA 5CURA 4MIYA 1J8QA 4IWXA 3QYPA 2BF4A 1N6AA 3QA3E 4NYJR 1B93A 2EXXA 5LYJF 3K3PA 4AVYA 5LQUA 2D0PB 1QTNA 2NNWB 5JBQA 4MW5A 2XKJE 3L1VA 1E1LA 4S04A 4H2DA 2JOYA 5EQTA 3QQPA 1JVSA 3U81A 1KQFA 3I55B 3VR3D 3LXRA 4TVBA 4FYYA 4CKCA 2XB9A 3QKTA 4F4FA 3DBRB 2QQRA 5G0TA 3BRSA 1F60A 1V47A 4G4IA 3GB9A 2P78A 1QJCA 2C2WA 5FTWA 4MQEB 1HYQA 1D2GA 2VP6A 1YJ9Q 3KZ1E 1QKIA 3LYIA 4G0UA 5I6DA 5DBGA 1MQSA 1FNDA 2GCPA 3OW7A 5EMNA 1T91A 1GAEO 3JQ7B 4UJ3A 4QT0A 2SHKA 4YDHB 4C0BA 2JRLA 2C99A 3TTVA 1F20A 3ADBA 1RI4A 4D4IA 9ABPA 3TKYA 1BG6A 3AHFA 4P53A 4A03A 4Z0PA 3ICPA 3E9NA 1RDFA 4ED9A 1OWMA 2GGRA 2ZR9A 3RYTC 5E8JA 4FXOA 3ZVLA 1XO1A 3N9IA 5HILA 2FZ4A 4MS3B 3G5AA 3REFA 5B55A 2WABA 3K0EA 3C48A 1GT91 5LUBA 4O02B 1U80A 5GAMe 4MKXA 3RIHA 3R40A 3HYRA 2GZ3A 5KNBH 2HFKA 5JLAA 2GSWA 1Z5VA 2QT0A 1VQ4Q 3FOEC 3IURA 4PFOA 1E6CA 2V0CA 4CIAA 1N32B 4AFUC 3KZOA 2EEZA 2QK4A 3RBVA 3SBXA 1KIMA 5AHKA 4BFCA 1KQSA 1R5JA 1Y9DA 1CR6A 4M8IA 2QN1A 4CTKA 4OQEA 1OQKA 821PA 3BQ9A 1U0SY 7AT1B 5SYNA 4LNPA 3ELYA 4LNAA 4M8LA 1QOQB 4IMJB 5ICCA 5EWJA 4I55A 4WKCA 2ZVPX 1BX1A 2JGDB 2AZTA 1RP1A 4RTWA 3CY6A 4PYIA 4Z2AA 4L08A 3SGLA 1LF5A 2OHXA 2Q99A 5BSFA 1VQ9T 5D6OA 5I8ZA 3D54D 3K0KA 4KKSA 3H4MA 4EFLA 4EMHA 3ZW7A 1G5IA 5DRTA 3CZPA 3ZLBA 4PHHA 2IXFA 4Z4FA 2II6A 2V74B 2VBVA 5JXGA 3T06B 3CP2A 5SZIA 3CIFA 4KAJA 3AF6A 1OZ0A 4Y6LA 4MUXA 4YA6A 2XA9A 3TI9A 3RUEA 4CUJA 4B48A 3ZXYA 3WLMA 4WXEA 2LUOA 4CU2A 1K06A 1G9TA 3O2SB 1PZXA 4C4RA 5BW4A 2QMQA 2VWGA 1LSUA 2CH4W 4NIMA 1DAKA 3H3FA 1ZSYA 3EUAA 4PONA 1FDTA 1Z0ZA 4NE7A 1M5Q1 3K9NA 1IJBA 3OQ6A 1K6EA 4LD9K 2C20A 5LOVB 4BUZA 2WJYA 1WTHD 3AQIA 4G5HA 3I32A 4DLUA 3QF4B 4M1TA 5DLQE 4K9PA 4ANFA 2JG3A 5TPZD 3SWWA 2HQOA 4PXYA 3M8KA 3RTGA 4WNYA 4IQ4A 3K2IA 4J9CA 4IQFA 5EL0A 3TNDA 1A2KC 1JBQA 2R3SA 2QUJA 2ILVA 1QFZA 1N36B 2OTJB 3A2NA 4X61A 2F2WA 4KE8A 4TLDA 1W1WA 4YV2A 1WLYA 1OSNA 1OBHA 4E32A 4HMOA 1XCLA 3O38A 2X4JA 4N5HX 1XFAA 4TL7A 1NVEA 2BI4A 4EECA 2DY1A 4QYTA 3L0CA 3L0SA 4FMCB 4BKMA 3O6VA 4RVHA 1D8TA 1SHJA 3BRWA 1P1KA 2XDQB 4N3NA 2BGMA 1RPNA 2QA5A 5I4CA 3FSRA 4JDUA 1KO5A 1DJQA 2QTVA 1FFHA 5DB4A 5FOTA 2HLDA 4X63A 2WG2A 4DSZA 1HH4A 2HO4A 1GLVA 3UB3A 5AVWA 1LH0A 4LYDA 2GM3A 5JAZA 1ECBA 2HA3A 3K5IA 2EBHX 1CVIA 2YC2C 1KJJA 1CRLA 3NFCA 4PJOB 3I2IA 3WRXA 1KO1A 1UDCA 2JTMA 1GVHA 2X6YA 5FTKA 2JEOA 2HEIA 1I2AA 1T0JA 2XH8A 2HSWA 3EIQA 4QC2A 4OSPA 2A3RA 5U4XA 2JHCA 4MUNA 1FYVA 1TZBA 5LCXA 2KT8A 4XQCA 2CJYA 2IYEA 2NLUA 2RC6A 2AG8A 2WTNA 3ZLUA 4MR9A 2PWPA 5I7VA 5KYYB 3A05A 5TS3A 1QTIA 4GGMX 3S6JA 4XE5A 4KE6A 4E08A 4AULA 1BWQA 4UCFA 1NI5A 4OLFA 3WGLA 2CWDA 3HJNA 3EJ6A 1BCRB 4BFWA 2NPOA 3B1KA 2HRDA 2NV0A 4LHXA 3H18A 4JYBA 3RRFA 2P9GA 5MN5A 4CM6A 1ZQ1A 1G3UA 5KU1A 1QH1B 2YUOA 2O2ZA 5LA6A 3I5XA 4WWHA 1TQ8A 2YNMC 1YR8A 5AW7A 3VMFA 2XBLA 3BX1A 3COJA 3IT1A 2FWRA 1SCUA 3RBAA 2QX7A 3FZGA 1NP6A 2XADA 4RHEA 1D5CA 4GX1A 1FSGA 4WY5A 2D5AA 1FFAA 3F6EX 4XTVA 1RLTA 4QHTA 1B6TA 1CFJA 1X7WB 1WXIA 2VIIA 4L5BA 4WNCA 2GAIA 3CUVA 3IBFA 3BL6A 4OJYA 4WZLA 3EA5A 4YAFA 1WXQA 4CM9A 2GM5A 1T1IA 2OA0A 2BEVB 2YQ5A 4TS4A 3E2UA 4KXVA 3UGQA 4ZDKA 5AKEA 2KE9A 3P2KA 3H5AA 1OMOA 5KNDH 1RXUA 5JSKA 3E5NA 3UMYA 3MHPA 2PSHA 2PZFA 2R68A 4AX4A 3BJEA 3ROPA 3RHFA 4I1UA 1SUIA 4LK2A 2X23A 3TPCA 3O8RA 2PSEA 3HA5A 3GJ8A 5KSYA 3C41J 10MHA 3EH1A 2VJNA 5EWLA 3RMQA 3WYDA 4J0DA 3A10A 3JQBC 1C7RA 2ZWOA 4HFRA 4Y6SA 3B5EA 4LE0A 4A15A 5L7TA 1SSHA 2HRBA 3PC3A 3THWA 1ZM2A 5F3DA 1M7GA 1QB7A 4IQ8A 3CLKA 3LBAA 3HXKA 1RHKA 3ZDCA 5DP1A 5EQDA 2VNJA 3X20B 4OLHA 2EKPA 2QG9A 2QN3A 2A8YA 1MO6A 4UTRA 2M6RA 1YHYA 2AEFA 1BPLA 3ANMA 2QJRA 3ACCA 2L3SA 6ADHA 3SKVA 2XEXA 2J3EA 2J9YB 2WIBA 1E6UA 2YX1A 1EDBA 4I66A 1HORA 5BSYA 2VN8A 3EPRA 1KJ8A 1UZAA 3ZLVA 1J1ZA 2WFAA 4ZDWA 3WLQA 3C2QA 3C6KA 3TB4A 3S28A 3ZE6A 1N5MA 4HLCA 1S5PA 1O54A 3OMGA 2O2DA 1GM5A 2VHVA 1G16A 4WH0A 2OCDA 4LVNA 3UMMA 4F5EA 2FPIA 4I14A 1K68A 2WNHA 3B6KA 4JGGA 1E77A 4QUHA 5B2ZA 2FW0A 3OJOA 1T26A 5TQ2B 2CGHA 5T7BA 2PJZA 4RK7A 3RRYA 2H63A 5A7FA 2O1SA 3WG9A 4PPGA 2ODTX 5JOQA 3A6FA 2GPBA 1NRIA 2C4VA 3O3OB 1ISHA 4NARA 1DV1A 4JUIA 1PSDA 1CDDA 4A1FA 2FR1A 1C7QA 3P9IA 2IYXA 3VPCA 1YJ8A 3GDHA 1T4BA 5LJ3h 2YXDA 2HJWA 2IOFK 4AO6A 2KK4A 4M86A 1YBVA 2BONA 3UPUA 1M6YA 2C8VA 3L0DA 4ZYTA 2O2CA 2WF8A 2ZFUA 5CA1B 4MNTA 1UBRS 3ANTA 2IIBA 1YJQA 3CISA 1VPEA 1JE0A 2AWOA 2BHTA 4LXCA 1WW2A 1DU4A 4B3BA 1LDYA 3D6HA 1TXGA 1VQ9A 4MQ4A 1FMWA 3BFMA 2CLSA 4TS3A 4DHWA 4CFZA 2NVUB 1DIRA 3UGJA 5DGCA 3WXBA 4TOIA 4CKBB 2CL0X 2LBPA 4UOQA 1KD1D 5DYNA 5ITVA 5JZSA 3LQ2A 3LRPA 4X84A 2UVQA 1C4KA 1L5HB 2W6CX 3WHKA 3CNQS 1BCSA 4LMRA 1NV8A 3UH0A 1E4YA 1J0AA 1ULZA 2OGSA 2YZGA 3KBBA 3BRCA 2E2WA 4YT4A 3M6LA 1CJKC 2CS7A 5EFOA 5GONA 1IHDA 1I5OA 2WZQA 1VQNT 3OBYA 1TM1E 5U1PA 3BFPA 4X1IB 4UAUA 3OCUA 2O4XB 3FMVA 4RHXA 1IHOA 3QYGB 4QGAA 2ZVDA 1ZIDA 2GAOA 1PTKA 3OSSC 2KGTA 5M3BA 4H0FA 1ODLA 3VZRA 4ER0A 3I2JA 3TKLA 3LHSA 4REQB 2XYPA 3RS7A 3CTPA 3ZGOA 4L3VA 1GL5A 2QDYB 3MSXA 4Q4LA 1F9EA 4JI5B 2YWRA 5CIWA 1RFLA 1YJWT 3GVIA 3F3KA 3IMEA 5LQRA 1MGOA 1G8AA 5DTMA 5LZ8A 4KDEA 4FHGA 4NENB 6ABPA 3TZQA 4AQDA 3DLMA 4ZCPA 1OW3B 4EVRA 2XOKD 4L9WA 5JNLA 1CJCA 2YZNA 2X0RA 3FIUA 4RY8A 2VBTA 1SXJC 2EFHB 2FSHA 1KI6A 3VKIA 1P29A 2DFLA 3KOOA 4KO3S 5HS6A 1UD5A 1H6DA 4B3DA 2BFCA 1KQNA 3KPYA 5EGSA 4G5XA 3PF9A 1MVLA 3CR8A 4BFLA 1TLFA 3OIUA 5CITA 4S3MA 3TR5A 3QOWA 5AXAA 1ATIA 4IHQA 4I8IA 1FFXB 2COZA 4FGLA 2K2QB 2OBFA 2XG8D 1KFEB 4DE5A 2RI3A 2Y1CA 1X75C 3Q9NA 3SF8A 4YP6A 1CUDA 5HF6A 4A3SA 4RVSA 4M1YA 1ICEA 4XLEA 2NAFA 4HEHA 2ZM6B 1GZSA 4ITVA 3PRJA 5F3WB 3RAJA 4QQGA 2P2DA 4RDLA 1PEYA 4EMKC 3TRKA 5KQGA 3O8CA 1ZCZA 2GCNA 1NUPA 4HCKA 3PVQA 3SC3A 1YR6A 4U9UA 5EUQB 2CXRA 4DOWA 3J7AF 2ZSKA 3VYWA 1ILWA 4OOEA 4FE4A 2R87A 1H0HA 1JVBA 2H08A 1WNLA 5ALRA 2XSZD 4JH0A 2HT6A 2HLNA 4ZVRA 4RLQA 1U2RA 1HYBA 4JITA 5A4IS 4M75D 3V1YA 1K28D 6PFKA 1M90C 1RYHA 1Q0ZA 3C7DB 3ZXSA 3ECAA 1EVLA 1Z9ZA 1E6WA 4OBBA 3VS6A 3NE5B 2Y05A 2GN1A 4L78A 4BQFA 3NTQA 4JRKA 3AR6A 4EM6A 2GCIA 4TN1A 4BS9A 1K73R 2QD5A 3NGXA 5LJ5h 2P84A 1PNTA 4XGNA 5AW1A 1U5AA 3SEJA 4IZOA 5CAEA 4ZQEA 4H1HA 2AOTA 2NVWA 1ZWLA 2LKCA 2X8JB 2QMUA 5AVYA 1RI2A 1CQZA 2QMZA 2BDEA 1PR6A 2CL6X 1OUMA 4YBZA 5LWQA 1ABFA 2NM0A 3CPFA 1I4OA 4QSMA 1I3KA 2WWTA 4YK7A 1AHPA 5FPKA 1E2HA 1AXGA 1XZNA 4B4KA 2YWHA 3QUAA 2NYVA 1T2UA 4I08A 5BMVA 4YJGA 3HCAA 2RN8A 3IGFA 1NEGA 1JLLB 3GDOA 2WB4A 1BXRA 1O9GA 3HTXA 2VJKA 5ITZA 4KWTA 2M5SA 4E7IA 2CKKA 4O2BB 1G60A 4EHJA 1GBRA 1EX4A 4LPKA 3OKAA 3CE9A 4TKVB 1W88B 3INNA 3KEFA 4NULA 1I07A 3G1JA 4NWIA 4DGSA 2PRKA 2DVMA 1LK5A 1SD1A 2DL3A 2I4OA 1ZHFA 3LG2A 1NBEB 1V1CA 1E32A 2GBLC 3V4VB 2FRDC 2GCGA 4AN1A 3A1TA 2I78A 1N6PA 1ICIA 5K5EA 1XTUA 3LLUA 4M0MA 4ZODA 2LP5A 1BIBA 1C29B 2JIBA 3QI2A 1NBOA 2R8YA 4FBGA 1USWA 1OIXA 2D8AA 2PYDA 1PU2A 3OOEA 3NTIA 1ZESA 2H0RA 3H7AA 1BK2A 2GAAA 3EGCA 4LGVA 4INOA 1L7PA 1HE2A 1MT0A 2REOA 4M7AC 1WMBA 1R0YA 1E2FA 3FJOA 4CKEA 5FRNA 2AFVA 2Y1EA 5FT9A 3RIXA 3Q4GA 1VQ9Q 1K0UA 4CUKA 3V8MA 3AG6A 1APBA 3X1WA 2WF7A 4R3WA 3TOSA 2JS2A 1MTZA 4OXNA 4B6OA 2GCEA 2IK8A 3FNEA 3PZRA 4ZXFA 3W3AD 3LWDA 3VZQA 3I2FA 5IAEA 1NVXQ 3NHLA 2NZYA 3RTBA 4KN8A 1NQAO 1RPTA 2Y1XA 2KB0A 1ZRMA 1ZH2A 3KWJA 2UYCA 3L04A 4KQFA 3CCRB 4FKZA 4MUGA 3D4NA 3G2QA 4YLGA 1OX8A 4RY2A 5LOVF 4LDAA 4ZVNA 4NKRA 4AROA 4DIBA 3HUEA 3A4MA 3GH1A 3E9CA 2FSGA 5EE1A 4FZJA 5FBWB 3PQ3A 3V3KA 5EIBD 1QP4A 2G06A 4YQFA 4XOPA 3QH4A 4B9EA 4QNMA 3GWZA 2KMTA 2LX9A 3HFNA 3E7PA 2D8JA 2JI4A 3UK7A 1EFRA 1Q7BA 4QPJC 1W96A 5K3CA 1PQWA 1KAOA 1K2VN 5E6UB 2IVWA 4E5VA 3A11A 3K1JA 4NJEB 1X9GA 1RS0A 2KE5A 4Z1MA 3WNCA 1HE8B 4FMCF 3G8AA 3FKSD 1A0NB 4M87A 4YJ3B 1FMCA 4IIGA 2HK7A 2JL1A 3Q8WA 1VQNA 1AKYA 2EDAA 3DB4A 5E0KB 2IQIA 4J16A 3O8DA 1THTA 1R9GA 5CHYA 1Z4MA 3LY9A 3L8EA 3IVGA 1TZKA 4S1TA 4I5EA 1JEGA 2PJUA 3K70B 2W37A 5B58T 5DJ5A 2WE8A 2GDZA 1BX0A 1VMIA 2GPNA 4J03A 3AY3A 1IATA 5FF9A 1NXSA 3CZAA 4I7EA 4UTOA 3A8OB 3TECE 3G17A 1BDHA 3PP8A 1YJWA 4BV2A 4NBNA 1HDXA 5TRTA 4E5SA 3AJ8A 1B00A 3E8XA 4DLZA 2IIPA 3WBJA 3CESA 3UW1A 4JJ8A 5LUAA 3IXMA 1BQ3A 1FQWA 1E2UA 1VF7A 2FZLA 2FOXA 3RC2A 5KJCA 1Q6ZA 2F2XA 3KFXA 1WCYA 5KYUA 4QEKA 1NBME 2JPDA 3AHDA 3KKEA 3KSUA 5AVXA 1JG2A 5C3UA 3SK0A 3SEQA 4YAEA 2J0QA 3I28A 2WM2A 1V95A 2DBKA 2WT9A 4U2GA 4B87A 4AKSA 3QPVA 4RD0A 5F1OA 4EUKA 1RWKA 4HWTA 5JEDA 1UWLA 3FA2A 4UQPA 5LP6C 4Q3NA 2BUAA 4WTOA 1NX6A 3I37X 4NX2A 1G3TA 3CLUC 4ZRMA 2PL9A 2HEGA 3CEYA 5BORA 1NATA 3GWGA 1AUXA 1XDZA 4W5NA 1IWPB 5DNEA 1YZYA 4LTNA 3QUBA 3H9EO 5CMLA 2SKCA 3N2IA 4ZTBA 2ZGWA 1MR3F 3VR2D 1RPAA 4NDZA 4IFIA 3FYDA 4PFJA 1TW3A 4S2UA 5ARDA 1XU9A 4LGYA 3I1IA 3PXEA 1P7YA 5EHIA 3ZHOA 2C88A 4UQOA 3RVQA 1I18A 1V96A 3EEBA 1VQLB 2G9NA 4LWQA 3KYBA 1XAGA 3OURA 4KGXA 4C5IA 1JE1A 5J4LA 2M2IA 1UC4B 2R6JA 3EUEA 4N03A 3ZWWA 1A9ZA 4EVQA 3B85A 3MGCA 3QUTA 3OWOA 5CW2A 2QN8A 2QQAA 3PHCA 4P3PA 3NDRA 3REAB 1VLMA 1YD7A 2ZYVX 1K27A 4YRDA 1GTSA 3FJYA 4NV0A 4EJSC 2KBFA 1BE8A 2Z8YM 5C8DA 3F49S 3CBPA 2AYZA 4KB5A 4HAVA 2VXBA 1AS0A 3EG9A 4GVLA 4J0HA 1E5VA 4QDTA 4QM7A 3R9WA 2QNIA 2PBLA 3TIFA 2VHCA 1MMDA 1U99A 2ROQA 3QSYA 2SCUB 4LJLA 4UBIA 4B6EA 1Z5GA 2JLAA 1QWEA 3C6QA 4WPGA 1USUA 4US1R 2SNIE 4NNOA 5F9FA 3NRBA 1ACJA 3PTAA 3K35A 4D99A 4LCJA 3D8BA 1G21B 4BKQA 2BKVA 5CVIA 3AKYA 1NQXA 1B3BA 3NVDA 1PWTA 1ORRA 2W6OA 4B76A 3AILA 2NOAA 2D7DA 3UWNA 4WN9B 3R6KA 1ZD3A 2Y1WA 2J9ZB 4XCQA 4EJ0A 5ES4B 4DV7B 3M56A 2V4ZA 2G5PA 1Q77A 4RC9A 1NASA 2F8LA 3G8BA 1KVTA 2IJGX 2WYVA 3JD0A 4P0TA 2JD0A 1Q0RA 4RHTA 4ES6A 1OPLA 2J4FA 2NUAB 1EK5A 3KXIA 1R9MA 3FOZA 2H4JA 3HBJA 4R2HA 1NKVA 6REQA 1M33A 2XVZA 3CCSB 2FFQA 3RSZA 4BNDB 4C3ZA 2LZ6B 4R83A 1SC6A 2IOYA 1H5QA 1EWVA 4MI1A 2R66A 2HUPA 4NQZA 1QRRA 1BD4A 2DLNA 5HW0A 1MIOA 1EA5A 2JJ1D 4NS1A 5JW6A 2Q9AA 5B36A 4IKEA 3Q5EA 5B58C 4OQQA 4GEGA 3LUCA 5B4UA 3WA7A 3PFBA 1IXRC 3P0EA 1JEOA 3QXGA 4HDSB 3K9QO 3SX2A 3NHFA 3B9QA 5CCBA 3RVPA 3BH0A 1VCHA 1NNSA 3FOCA 1OX9A 2X5XA 3HJBA 1QK3A 4D6WA 4DOMA 1W4SA 5JMPA 1NULA 2WKQA 3BIXA 3ZFJA 1IB8A 3V1KA 4JSYA 1X1RA 4HKEA 5ALOA 3ZZUA 4XWTA 4OBXA 2WZDA 3L1HA 5KX5A 4RE6A 3FC3A 1NSTA 4BJ1A 2CNNA 5DM0A 1HV8A 2CWWA 2IX9A 2X1MA 2DRKA 5DLOA 4LDYA 2CXOA 1XPUA 2CNWD 1LWOA 5AVSA 1UQRA 4OI4A 2VJOA 5LVAA 2X4XA 2WVHA 3ABSB 1LDEA 1IB0A 3EIOA 2FX3A 1VQNQ 4B4DA 1YI1A 1ECLA 3TEEA 2CE2X 1FQKA 1G8MA 1DBWA 3QU9A 4XWYA 4K26A 2HXSA 4LMAA 1UM9B 2QUZA 4ZIRA 3IQZA 1TQ2A 3JYHA 3V8JA 1ST2A 4G8CA 1LLUA 2VNHA 1TF5A 2EF0A 2P62A 3S99A 1EWYA 3CPHA 1EK6A 3I3OA 3NXKA 2WP0A 3PMIA 1M3BA 1XELA 3T1HB 1GPMA 3UTCA 3I62A 4R1SA 4Y9RA 1WI7A 4BLUA 2V4MA 2FPGA 1O7JA 1YJWQ 3UANA 2AIRA 1Y8RB 1ZJZA 2QSZA 3JYNA 4RTJA 1S2IA 2ZIUB 4CM8A 2HJSA 5HM8A 4FGWA 3IC5A 4XRGA 4B7UA 5IK2D 5TGZA 5GGXA 4IXWA 1TA0A 4MGKR 4OH1A 4DIDA 4H1VA 1FW6A 2ZL5A 3E7XA 4YI5A 2OK7A 4M4SA 1QLYA 1JFFA 3L42A 4WGFA 4LIPD 5K2OA 4LYAA 2CRVA 3RGWS 1HDYA 2C9OA 1JG6A 3MJSA 2IP2A 1XN4A 1KFJB 1XMIA 5AYFA 3OYAA 3KEQA 5IEBA 3O0TA 2OK8A 3R76A 4J4TA 3OMCA 4C29A 2OHFA 3OEHD 4WV3A 4OAOA 1QZTA 2XZTA 1OYYA 4ITRC 1GPH1 1XA4A 3MJCA 4B73A 5HR5A 1XL0A 3OM8A 3W2GA 3DM9B 2QS9A 5FWYA 2E21A 2ZR0A 3RF6A 2VLBA 3CPSA 4I3GA 5AKZA 5GMKl 1F2UB 1BU8A 5KVQA 2WD7B 1AKUA 5LJLA 1KMHA 2G1PA 2WKWA 4B6JA 3A6ZA 3BC9A 1M2FA 4Y6GB 2WPDA 5EUCA 4C0LA 2FN7A 1WOPA 3A3OA 4JS5A 2VTVA 5I48A 1FP1D 1JBMA 1ZWKA 2IP4A 2P9ZA 4KXWA 2W7TA 2UZ1B 3BDLA 3ETCA 2N3ZA 4Q1DA 1ECGA 2DQZA 5K05A 4N5MA 1VDZA 2B20A 4TSFD 1JU5C 4CMBA 1RABB 2IYSA 1MW9X 1NE8A 1OV6A 2GN6A 2ZSHA 2MMCA 3TCKA 1QCFA 3Q39A 3AUTA 2QNBA 4PSAA 3RU9A 4JI0B 2VBSA 4C6TA 2AB0A 4QFMA 4N7RA 3NIGB 3IAFA 4Q5WA 5BWMA 3DKVA 2RBGA 2TMYA 3OEWA 4G26A 4GXQA 3EZYA 1UD6A 1HX7A 3QELB 3ZHUA 4CLOA 1RRMA 2HQBA 3MT0A 4MUHA 4H08A 4J49A 5KC9A 3QE4A 5GAN8 5D01A 4QVDA 2NPIA 1EH5A 1ULAA 1JB1A 3GLIB 3PWZA 3WLFA 1BE1A 3M0SA 4ESRA 2VOEA 1PEKE 5ELMA 4GLLA 1G18A 4HAYA 4NECA 1W2HA 3ITKA 4R9NA 5CU7A 4KQJA 1MMAA 4BU1A 2CP6A 4EGJA 4MR8B 4X97A 2UZ3A 4D9MA 1J6UA 2O2EA 3H2HA 1PUJA 2WK1A 4LY0A 2H4XA 2CZGA 1REQB 3FE2A 3U0BA 3VFDA 5AKIA 4FYWA 2I4MA 3WAKA 2WUWE 5AJUA 3PNSA 2DLDA 2H2WA 2QB5A 4XH9B 5F1KA 5H5JA 4IBOA 3NWOA 4IMPA 3N39C 1GUBA 3Q98A 4O2BF 4A4KA 1XLTC 3UKDA 2ZRJA 2Q9UA 2Q5LA 1DKLA 1N6IA 2LTOA 4KVZA 4NMXB 3I35A 2JI8A 3UAZA 4UW9A 4J1SA 3DONA 1KA9H 2RIRA 1JKFA 5KPDA 5T64A 1CWUA 2J6IA 8ADHA 2VP3A 1T9GR 2H4YA 2W71A 3PIDA 2VYCA 3T7EA 3SYKA 2R62A 4L22A 1VSQA 3P2MA 3ETHA 5BSHA 4U3JA 3FVWA 4QJIA 2YFHA 3VKFA 3AF1A 4KQXA 1NZJA 4O2RA 2VAVA 4JYMA 5EGNA 1KDTA 1X14A 3UJ3X 3HHTB 4UKDA 5A5EA 3U4DA 4F96A 1XVIA 1CUSA 3AFOA 2LQNA 1DAIA 3L5KA 1U0NA 3E53A 2Q1TA 5EJIA 1QQBA 4BQPA 1BAPA 1R0SA 2BFFB 1A7KA 4DG9A 3H1BA 5D51S 1YQQA 3OEEA 5EE5B 3V8NA 2X9HA 4D81A 2QAZA 1XZBA 3BHJA 1WNFA 4IDBA 4K8OA 3QZ5B 1G4UR 2W6JD 4DQVA 5KKNB 1VP3A 2VZ0A 1WY5A 2J6OA 4YEJA 1GPDG 5B7PA 3SDBA 3T7KA 4YXWD 4GOJA 4Q9KA 1QKKA 5JDCC 3LECA 4RCBA 4PLPA 4XWGA 5BSRA 1OROA 4P3NA 2QZJA 2Y9PB 3R6WA 2EJWA 4ABTA 1WX6A 5K0JA 3FBTA 4QBFA 1RVV1 3G79A 3KPVA 3NMZC 4W63A 5KQMA 4CMCA 4O4HF 1KERA 1RRVA 4YFYA 1OV4A 4P33A 2OXRA 5BNWA 2B83A 5GAOm 2F1OA 4EG1A 3L18A 2FI1A 2NXEA 3E9EA 4CIBA 4JR0A 4Q47A 3IR6A 2YWCA 3EQ7A 1R2QA 4JLVA 2GM4A 4B83A 1ZN8A 1G2IA 3M1AA 3B51X 4JBXA 3QXSA 4Q82A 1H2AS 2QTGA 4LF8B 4NONA 5J2TA 4S0ZA 5M04A 3T5GA 3L0OA 1OXTA 1H3HA 1NG9A 4JI1B 3LZ6A 3ER6A 2NUPA 3U4AA 5DLYA 5IYRA 3PU6A 1A96A 1V9LA 1OB5A 3SR4A 2I7CA 1U8XX 1RI3A 3P97A 1UZNA 2I8AA 1T5TA 3UXEA 1QSGA 3M54A 4KAFA 3G6WA 2QN9A 3JWGA 4FXPA 4HMQA 2PQ2A 3BZWA 2D2XA 3ZD9A 2JVVA 1UANA 1FFWA 2BTQB 3EVAA 4D6PA 1KC8C 4OL0A 3MWKA 3VR6A 3Q11A 1FL9A 2AR0A 3K09A 3BCRA 1D7AA 5FNVB 2ARKA 3TWOA 2CZCA 5EPEA 4GPBA 3ZS9A 2EPDA 2DWOA 1OKKA 2WU8A 3U4QA 2XQKA 3E84A 5IN1A 4LYEA 4PF1A 4YMTA 5CA0B 1MMNA 3KEMA 2VSNA 5J23A 2JZNA 5KKAA 5CFQA 3QOYA 4CNBA 2BGJA 3HP1A 1ZXXA 3JATA 1AHNA 1T36A 2G70A 3DQPA 4FN4A 3OLQA 3RIRA 4KN9S 1AA6A 5ED4A 2OAP1 2OQRA 4G2NA 2A5JA 1SIBE 4FXUA 5KVVA 1ZIYA 3KKPA 3OOCA 2KBTA 2CC2A 3CRZA 3MP6A 3JZDA 4YDRA 4AJLA 1TJ3A 3HO1A 4MI6A 4XM3A 5JD3A 1LJLA 1LLCA 4H7PA 1BH6A 4H7DA 1ZIOA 5BT9A 1RU3A 4KGZB 4C1BA 2IZ0A 3TL2A 3HP9A 2NO9A 5KNLA 3LCCA 3AETA 2J7PA 5AW2A 3RQIA 1A72A 3LQYA 4B09A 2OV2A 1YC5A 4BASA 4MB6A 4D9IA 2J3QA 5HZAA 5J2UB 3JYQA 2VDJA 1S7CA 2OHJA 3CKKA 2PJRA 4FCYA 4X07A 2GVZC 4JOSA 2WF5A 1QWOA 3VOTA 1VE9A 1UMCA 4RTXA 1W5FA 3DBOB 5JRDS 3NP9A 2NT4A 3DT9A 4V0LA 1Y42X 1ZRHA 3I0NA 3NHRA 5FWAA 4R0NA 3N76A 1JWBB 4J75A 4AY5A 1XPJA 1CKBA 2I66A 2OMKA 1I7QB 1OLSB 1V11A 1ZHIA 4L8LA 1KGSA 3IKMB 2CUZA 3AEZA 3CFYA 2HD0A 4R2MA 2F67A 1RM5A 4BX2A 2QDLA 2QR2A 2IU4A 3EVEA 4OXYA 2JARA 3ZE0B 3LKVA 1PL0A 3DE4X 1DIBA 1PJLA 5DEIA 5DISB 3I1YA 5HUQA 1XK6A 2QRPA 2JC3A 3TCNA 5INTA 1OXMA 5GMOA 1Q7YU 4TKUB 1HOTA 3CF0A 3D5TA 2Q7XA 3VPGA 4LY6A 1CSKA 3UT1A 2ZIWB 1ZFNA 1NN3A 1VQKB 2J6CA 2WWIA 3OZXA 5IANA 4ID9A 4YCSA 2A88A 5IHNA 5JS7A 3PX2A 3CZ9A 1K9MC 3DOJA 3AWDA 1R4ZA 2EGHA 2UDPA 3RQSA 4KX5A 2PMEA 3WDMA 1AMUA 2HLPA 3RIMA 3QU7A 2OB1A 1KFZA 1TKBA 4K9RA 2PH3A 5TSDA 2C77A 4BRZA 4RMNA 3KQLA 4HWOA 1G3MA 2N75A 4JEMA 2P69A 1ECFA 1S8AA 2O3QA 1TYBE 4PO8A 4D57A 3N7TA 2BMWA 1M2KA 1XMVA 3W4JA 4R4JA 5LL6S 4GI3A 3PTLA 3WDKA 3R5TA 4GKJB 3BMOB 4FR5A 5DDIP 1ZJ5A 1MO3A 1SHZA 4AZ0B 4Y2UA 1JG1A 4OXIA 1L5NA 3EGWA 3HNPA 3FLAA 3IEIA 1AQYA 1SXJB 4XONA 3OQBA 2QX9A 5FTMA 2BFDB 1NRWA 1X1EA 1C6VX 1OH5A 5D6WA 1YITT 3L7LA 3M33A 4E5PA 1FX0B 2N1BA 3FETA 3OSUA 4B6QA 1UECA 3OZRA 3IEXA 1B15A 3LQQA 4F5ZA 3HKCA 1WDMA 2ROTA 3TTYA 3BH6A 3DLAA 1MF7A 3JQ8B 2D2VA 4JZ3A 1X86B 5A4AA 1GGEA 3WRXC 2P7IA 1JIUA 2X0NA 3EGDB 2OHVA 3FOAA 2P65A 2ZRNA 1K8XB 3Q6MA 3RABA 1S7GA 4FFVA 2NTEA 4CV2A 2N9UA 3V3TA 3QWAA 3HACA 3DVAA 1MMGA 2V7PA 4EMKB 1GTG1 3KUCA 3KZKA 5HP4A 4GM0A 1U2SA 1RNLA 5JYEA 1Z06A 5K0BA 4WA7A 3CPJB 3DJFA 3CPWS 2QTTA 3MG9A 3I8OA 1IY2A 2ERXA 2OHHA 4LTMA 4ESHA 1K73U 3WK9A 4DADA 1I9GA 3TUJC 1XEAA 1G42A 2JFYA 1CUCA 3V76A 2H11A 5K3FB 1DKQA 3OTHA 1SQ0A 1NBIA 1NBMA 1IJKA 4DUPA 5E9WA 3LWBA 5EHNA 3C14C 1OXSC 4CQMB 3ZCTA 2HGZA 4J2OA 4FX2A 4F46A 1Z6XA 2Q2NA 4KX3A 1IYZA 3H87A 1SPXA 4JOCA 3LQKA 4LNUA 2CXSA 1JQBA 1OH6A 4R31A 2GD2A 2E5QA 1N06A 2CXTA 1HE4A 3BFJA 4JLUA 1ORVA 1YZHA 2QD4A 2CFRA 5F98A 3RSOA 4DREA 3OC0A 2CSUA 2PNIA 3QTTA 1A4XA 1II8B 4ALNA 1XDDA 1F48A 5HWSA 1EUCB 2A36A 2E37A 3NRCA 2TMKA 4WRRA 3ROQA 1EVQA 4KQ2A 5CO7A 2BP7B 4IV8A 2NSHA 3IEMA 1R6DA 1I5LA 2HV8A 1AMNA 1QE3A 2OCKA 3QENA 3D1VA 3L6EA 1QF6A 1WVMA 4G7WA 1IWBB 4QUGA 5GJVC 2ZTGA 2FG6C 2HNAA 4M7PA 3LWZA 4LFAB 1JHAA 1ZUD1 5CNJA 1EPUA 1OHHD 3N8NA 2CHGA 3OKPA 1P5HA 1PFUA 4U2EA 2PH1A 2ZANA 2FPEA 1D0SA 1W48A 1KH2A 2ZULA 3OTIA 2C5FA 2EQJA 3HTRA 1F6WA 2NYAA 4DMRA 4TTVA 2IEBA 5BN3A 1O5TA 3II6X 4KRYA 1WMEA 5GAN3 3EVBA 3NDIA 2QV0A 4RELA 2VUHB 4CF6A 3B3AA 1T4CB 5A71A 4Y7DA 1ZBJA 5EP4A 1O57A 4DZTA 3CC7A 2P75A 1EJBA 4W8HA 3PGMA 3AU8A 3KJFA 3K0AB 2OGZA 4CV0A 1ZAYA 1Y6GA 3R41A 4EPYA 3ABIA 2GJSA 4Z4SA 3OW2S 1NVVQ 1XNIA 3DE5X 3WS7A 2E4HA 4F04A 3OE7D 3EC2A 3MWEA 4L28A 1ESNA 2H0AA 2R6AA 5E9QA 4JLNA 4D0RA 1XB2A 1WLSA 3DAYA 2OCGA 3G7UA 1XT6A 4Q48A 5BR1A 4BLVA 3G6KA 2GK4A 4M0LA 3FKJA 1SC9A 4OUKX 1X7YB 3IAUA 4HKTA 2QMEA 1XWWA 4JBGA 2ZPIB 2JZ2A 4M7AB 1NQUA 1KQPA 3W5SA 4AY6A 2RHHA 4MULA 1V3QE 1ZYUA 1SBZA 1KZ6A 4FDMA 4KN5A 5HQJA 1YZQA 3VDNB 1OI3A 2CUNA 3W2EA 3GT3A 1J0CA 5AM5A 1OA0A 3QKUA 4HXGA 4Q9JA 2X3YA 5EE9A 1TUIA 1NM5C 4MVWA 5F21A 4DJ5X 2Q49A 3KE8A 2UYHA 2L82A 3PK0A 4R5HA 3GNSA 4YUWA 2JM8A 1JO8A 1UODA 2XD4A 4G89A 2ZT6A 4S05A 5LXTB 5JANA 3H5WA 1QPZA 4G0YA 1OLXB 3MCWA 3BJRA 3VSAA 2DRIA 2JGIA 4XN3A 2RK1A 1EUZA 3AB8A 4NK5A 2I9PA 1EFDN 4EYGA 4FYVB 1KYZA 2HHLA 4FFBB 2VK1A 3NC0C 5JG7A 4MLPA 4ZD6A 1IAQA 3U4CA 1G4AE 2NWQA 1XTTA 5DWVA 5KQPA 3PXAA 3AFGA 5JD6A 1VPWA 2GERA 4N47A 4FEEA 2HL3A 5FUQA 3AHEA 1FP7A 4HH0A 1RLOA 3MNFA 2ONCA 3A6LA 4R2LA 3EQ9A 2YUTA 2FSUA 4CL2A 3QEKA 1RC1A 4TXHA 4HVAA 5FQOA 5F12A 1TA4A 7ABPA 1SHUX 3BH4A 5C37A 3ANNA 3AR5A 1FVXA 3NT4A 2UZ4A 1E2PA 2XQVA 5ER9A 4BJHB 3JU3A 5EXTA 4OQXA 3ZTWA 2Q0HA 2CGEA 1NVDA 3KQYA 3RYFA 1NUSA 2R1ZA 2A28A 4C06A 3RS4A 2W0ZA 1XTRA 2QTMA 2P9TA 3DUWA 4G7XA 1ELOA 2F2TA 1R0CA 3NRJA 1IXYA 3NVMB 1OVMA 4CMHA 1PW7A 3WP1B 1GPJA 1Y9ZA 1WA7A 2FGKA 3F9CA 2WTUA 3VTAA 1NV9A 1VG9B 1TUBA 5HQTA 3I12A 4LN1A 4KI7A 2C54A 5DYIA 2R6R1 1FFSA 4YRTA 3CG4A 3S70A 1Z4KA 1SK9A 5L6MB 3RVOA 4AICA 1XROA 1E1QD 3KUFA 4IM7A 1D1QA 5ICGA 2Z5LA 3S3TA 4OJTA 5DTEA 1IZZA 3P0FA 4TT3A 3F8TA 3NU1A 5AK4A 5C81A 3W04A 4F4HA 4D3YA 5TVKA 3PUIA 2C0TA 2R9VA 5B2EA 3AOGA 3MCVA 1G59A 4HGZA 3SIPA 4C14A 8OHMA 1XZPA 5JISA 3EAEA 4L9AA 3UAOA 5LJ3f 5ALNA 1TL7C 3OFND 1USGA 1YITA 2CNKA 4DZRA 5A1JA 4HNHA 4QXQA 2YWWA 2RQTA 2AFHB 2F3UA 4YCMA 4IS2A 1I9CA 4JLBA 1PJ8A 1JXAA 2O1WA 4JSRA 4IVNA 2ZSBA 2QA4B 4WKBA 1U63A 2FO0A 3A8TA 1N75A 4INZA 4Q24A 4B7AA 2RI0A 2YHIA 1YH3A 3O1HB 1DLIA 3UC5A 3H8JA 3GBSA 5LP6B 2KPOA 2VFAA 3M4ZA 2FB9A 5LBTA 2XD9A 3O47A 3AESB 2PH7A 4Q3OA 4L50A 1L4YA 2C7QA 3JQPA 1UDXA 5I01A 2TMGA 4N0AA 2QQ9A 5FOQA 4DT1A 3TMAA 3M2PA 4IVPA 2P9QA 1M6EX 2ZRAA 3ORYA 1KQOA 2FFAA 3DSRA 4MV3A 1OIWA 3N2LA 1MV5A 5THKA 2EBWA 2WR8A 1U1TA 3IO5A 3W79A 1EWTA 4Q3CA 3V8BA 3JCMh 1M8KA 1Q3HA 3HVHA 2C2ZA 2JJ2D 1X7ZB 3HL0A 4HNRA 4MQBA 5IFKA 1W5BA 3T1NA 2SBTA 1H93A 2D2EA 2QM0A 5HKKA 4JY7A 1YUNA 5DXJA 4B4VA 1C8VB 2DPHA 1IRXA 3IP7A 1OTXA 4ZOAA 4B82A 3R7AA 5KOIA 1I1OA 4YT2A 3TW6A 1CF2O 4Z0HO 1R9NA 4KXNA 1SKBA 1DCTA 3X2FA 1I2MA 4EHNA 2YWJA 1IBRA 1UOEA 2AYYA 3AONB 3P7MA 3LFHA 4D7AA 4FU6A 1CEXA 3U7IA 4M1QA 2XNSA 1ZZEA 2PO5A 4LUCA 3OYBA 3TJZA 3NQ41 1U4OA 5FNVF 5FFNA 1B43A 3H8ZA 4IIVA 3HLYA 5GM1A 4EJSB 2HHJA 1GZ4A 2RJNA 5CA0F 4NDAA 4XQ9A 4MYRA 4LDQA 1W5EA 2ORYA 5FWXB 2XZOA 4HT3B 1T3LA 3G8YA 4JMLA 4DAEA 4FOTA 3NTXA 1YVRA 4P4GA 1Q0SA 1AHHA 4C5CA 3NBAA 2XUAA 3CC7Q 4I50B 1YJBA 2Z9CA 1N0IA 3DNMA 3IUQA 3DHVA 1I94B 3B52X 1UL1X 2OQVA 3DA8A 2O01E 1MZVA 1C2TA 1STOA 3LY5A 4ROXA 3ZLJA 5CX1A 3DMGA 4X1KA 1E9BA 1CUYA 3DD5A 4RZIA 3DZHA 4BO0A 1VI6A 1D3BA 3AY0A 2P0PA 4XYEA 2EG9A 1NYFA 1ZCAA 2RAUA 4X7EA 3A8JA 5FR2A 1TMGE 4XPZA 1OXUA 3C3AA 1K8AU 3DZKA 5ECDA 3LF1A 4BI3A 4HZIA 3KJHA 3GG2A 4EW6A 1TTHB 1H92A 4EGAA 1ZONA 5J2UF 3K0FA 1WB6A 1AOJA 1QQTA 4O25A 1PGQA 1P1CA 4Q4HB 4EB0A 2X4IA 2ZREA 4NCIA 2D1RA 1M2OA 2ZVQX 4D25A 3GHHA 3A7DA 3BGOS 2OBLA 2ZI3A 1UKEA 4YMHA 4OG2A 2JATA 3ZWOA 2C92A 2ED0A 4Q7QA 4EKIA 2XX3A 5KQSA 2X3UA 3ROGA 3WGMA 3T41A 1XWFA 3IAM1 4KXFB 4I4IA 2ZP1A 4X06A 2C95A 4CT0A 2BD0A 4QELA 3HM9A 1KVSA 1C7EA 3BWYA 3EOAI 3JCZA 1DRWA 5B1YA 1PGJA 3VSEA 1UJBA 1GPWB 3FWKA 5ENZA 2V7GA 3HU2A 2FMTA 1GZ6A 3FJ1A 3AT1B 1LQ2A 1XV5A 4KKVA 3CM0A 4AUEA 5EWMA 2UXBB 1BI1A 2O5CA 4Q7MB 5HCKA 2IS1A 1GZ7A 1KR2A 1VYUA 4DCNA 1W36D 1DKPA 4X7DA 4D0LB 5I9SA 1IN5A 4ZXPA 4KRFA 2FPSA 2RGDA 3N1UA 5TS2A 3AP1A 3EZ7A 1B2RA 1V7ZA 2NGRA 3N86A 1DO0A 4FIBA 3BK7A 1VQ5T 3IP1A 5IT5A 1Q7CA 2DWQA 2NPFA 1YI2B 3IBGA 5KHAA 3C12A 1WGSA 2ESRA 2XNCA 5LJ5f 4L0DA 1SQSA 3JQDA 1EHYA 2BDUA 3WL4A 4MV1A 3L7NA 4RL6A 5CK5A 4ND7A 3O2JA 1ZSVA 3EQ6A 2Y3IA 5FHQA 2D0IA 1MLDA 1KFKB 2RJEA 1IXKA 4JEUA 3CVXA 4RYDA 4ZC1A 4Q3AA 4FQ8A 3MUOA 1QS0B 4RVNA 5DNWA 1A8QA 1YIJA 2QQSA 1U3FA 4F6LA 3NHMA 2GJRA 3FJPA 5AQEA 3PHIA 3HCCA 3QVVA 4MUAA 5MGNA 4RENA 3R9IA 3G89A 3MQ4A 2XUOA 1N57A 3ZKWA 3Q8MA 1BU5A 1MZPA 3ZNNA 3ZDXB 5DNDA 3RT1A 4ZVVA 4EW2A 1E3LA 1ADFA 1YJ9B 4Y8VA 3WGIA 3GD5A 1CKAA 1B14A 5DW0A 1AZTA 3HPRA 4YB8A 1Y0BA 3K8OE 4X64B 3SQDA 2JHAA 4JYCA 4AJPA 3PEEA 2BGGA 3VC7A 4NMLA 3BCUA 1NEBA 4FYPA 4EO7A 3D2AA 2GN8A 3ODPA 1ISPA 4KYVA 2HIAA 3HDJA 1YITQ 1Y8AA 1TK9A 2XMGA 2MJLA 2A35A 3WQBA 1DRVA 2CFTA 2VXYA 1GHTA 3PTZA 2Q5QA 4LZJA 4GXRA 1H3FA 3B60A 3D8UA 2QEQA 4DMKA 2H7YA 3ZD7A 4FYKA 3WQZA 2ZTUA 5AIAA 1WD7A 1RJ9A 1CYEA 3FNGA 5KEIA 1XDSA 4PS1A 2D06A 5GAMg 1GZ3A 2GHRA 2REXB 4QPPA 4UM5A 5D87A 1VQ4B 1BE0A 1D0XA 2YHUA 2WWFA 4WZEA 3K9GA 1TYCA 1RACA 3H1FA 1EFPB 2CXNA 5FWBA 3BA6A 1NNEA 5LQAA 4XOUA 3EC1A 3BIOA 1M8GA 1NR1A 4CF5A 2RHTA 1LJUA 2QG4A 5KCZA 2KLHA 2BKAA 4YH1A 1DG1G 1G8SA 3TEFA 1N8TA 3I39X 4TGLA 3HEMA 1SRLA 3TG2A 3UOAB 1EK0A 3VAAA 1PJTA 4BN4A 3R9XB 1QVPA 5KO2A 4UTXA 2XYHA 2KWIA 1C4WA 3UPDA 2JNGA 1D6NA 2Y1OA 4MDFA 4M54A 2R5AA 3ASVA 4AWXA 5ALTA 1SQFA 2I0NA 4ZVUA 4LDVA 2QRNA 4NBKA 2FVXA 1M1YE 3WGHA 1IU9A 1U65A 3TRIA 2JVIA 4JBHA 1MGPA 4U9HS 5IKMA 1K0SA 2DIEA 3B2EA 3O9MA 3TLJA 1QLJA 1U5BB 2Q5HA 3VH3A 3F90A 5KVSA 3VU9A 2FP4B 4OVKA 5CR9A 5A0DA 4ZMRA 3MQFA 2D5LA 3ESDA 5EZYA 4PX9A 5T4EA 1P19A 5EKSA 1DVRA 1RQGA 3ZBQA 3T7IA 3TTUA 3IQLA 4IJKA 4PJOF 1YQEA 2OP0A 2EJBA 2PKWA 5T4HA 4KNVA 3JAME 1PJAA 2E82A 2JFNA 1J99A 4ZI7B 3JB9F 3G9UA 4LECA 4H60A 3ORFA 4QTUB 3O4IA 4KLCA 2Y99A 1QVVA 5DTRA 4PN7A 4F7UB 2Q9BA 3TG8A 3WLKX 2GILA 4KH1A 4CODB 4KNYA 1CZLA 5KDOA 1UBJS 3ZU2A 3U23A 3NEAA 2HJHA 3KE9A 4WEQA 1AO3A 2ZAOA 4YCCA 3F5FA 3BF8A 4Q01A 2VHTA 3M6AA 4IHJB 3VU0A 1SH7A 3LC7O 4QODA 2QR5A 3OJLA 2C0QA 3LO8A 4QV2A 4WK0B 2O0JA 1R3UA 1AU9A 4RQBA 4CL8A 2Z4SA 1M8PA 1E3WA 3G49A 2RKOA 5FLYA 2I4LA 3ZJUA 4PLCA 2OCXA 3IMCA 1Y6ZA 4GMXA 2GOYA 4M7AF 5GAJA 1MB0A 4LY9A 2OAUA 2QRLA 1J0BA 4CXMA 2NV2B 4TWZA 5FBKA 3IQDB 4YCAA 2OKCA 3BD8A 1VHOA 2RHMA 1OT5A 3CT4A 1C3LA 2RHIA 4DQDA 4B3TB 1V8BA 1FXUA 4X45A 5EC8A 5EJAA 4RY0A 4CM1A 4ESOA 1ZN7A 4PM4A 1S96A 4JDSA 2DM1A 4N41A 1XTDA 1N5IA 4P86A 4IIHA 4U6SA 3U3OA 3ZBDA 4MCIA 2Y6VA 5IJXA 1A5SB 2POCA 2ECKA 5LMNB 5LXTF 1H42A 4V1CI 5J1SB 3D7LA 2D1FA 4F4DA 4FDUA 2XE8A 3UJHA 1PSZA 4K40A 4YJKA 4ARZB 3PGXA 3I9OA 5DS0A 3CCJT 5GAOp 1ZMBA 1E1MA 5CJJA 3VHXB 1XXLA 3OIWA 1YR2A 3QNMA 3ETJA 1QCNA 1O95D 4ZTFA 3MRXA 1HEUA 3ULRB 2WHXA 4BE9A 2QQGA 2FKAA 3CRQA 4F12A 4GSLA 4YHBA 3CPWA 1QZZA 4B5LA 4CKZA 2G9VA 4FNGA 3ICOA 3QLTA 2HF8A 1YIJQ 3ETEA 1LPBB 2XXAA 1VQ5A 4KXLA 4LOKA 3VGJA 2FPUA 3QLUA 3H4TA 3ICQB 5AYVA 4FYYB 4CKCB 1KSWA 5BSVA 3WMXA 3EG2A 2OG2A 4LZAA 3BY7A 1FBNA 2I9KA 1ZITA 2IH5A 1EI9A 1PF7E 4J29A 3AWIA 3AEQA 4KXXA 4GI5A 3RMSA 2L3RA 3QLEA 2TS1A 2JW4A 4MVCA 5DY9A 1E4EA 4PRKA 4D8KA 2ECPA 3X1JA 4BEBA 4F16A 2SRCA 3BDVA 3P26A 1HNZB 2EZ8A 3TK1A 3LX4A 2JM9A 5ALIA 1PT9A 1UTIA 4CI0C 1X3SA 5D84A 2O2SA 1Q1EA 2Q0XA 1R4NA 1RXEA 3MILA 2O54A 3OJWA 1J7JA 2XA1A 1XRRA 3X2SA 1QQ6A 4PCAA 4ZGGA 5BQOA 1Y3FE 4RXMA 3MWLA 3D81A 5JO9A 2E4AA 3R7SA 4W7IA 3L2OB 2P1RA 1R66A 4LHWA 1EKXA 5CA1F 2IHNA 4PWZA 2IDKA 3H8VA 4OFWA 4NBSA 1NX9A 2B21A 1QV7A 4D4MA 2IYTA 4PXSA 4Z4WA 5AT1A 4MICA 4TL8A 4ZOEA 1BVUA 2X22A 4JFAA 4MWDA 4NICA 4U8HA 3MHXA 5HIMA 2I22A 3L2UA 4FHFA 2QVLA 3SOPA 2J41A 3STHA 5BMOA 4XTRA 4PG7A 1QIKA 5EPUA 2H4FA 2R2AA 5LP6F 2RH8A 1W4ZA 1Z8FA 1KQSB 1JBKA 2PZEA 4WUTA 1SCKA 3VYVA 2JW5A 1P7WA 1WW8A 4HH4A 4RF2A 1OXBB 3IDOA 1CY2A 3HNRA 1Z37A 4Q12A 2B4KA 4D0SA 1X39A 3C7KA 4I55B 4EF5A 1NG1A 1UKCA 2R1VA 5IXBA 3OW2A 1RMQA 2C2HA 2RHBA 2ZDGA 1C3VA 1HYEA 4QXPA 3L4BA 1V9CA 4JLJA 5U4QA 2BJVA 1R1DA 3EQZA 1OLOA 4BDSA 2DC1A 2BBTA 4POOA 5FL7A 1H3EA 2BGIA 5HIKA 1BB9A 1IZ7A 4Z3OA 2FYTA 1TD1A 1NUAA 2QLMA 4JNKA 1ZVJA 2RNAA 3RW9A 3S2YA 3BMNA 1I0CA 3CGGA 2FFHA 4BJ6A 1GZUA 3EDYA 4ZOLB 4LDXA 4RVDA 2CXHA 1XR3A 4RDCA 4X8MA 4ENQA 1PHPA 3LUHA 2HMYB 2PTGA 4ZYLA 1TUGA 4QTZA 3VTKA 1N9KA 4PBRA 3SC2A 5CPFA 5LJ3j 4RPJA 2HQ1A 4KUHA 3KKOA 1IBSA 3LIIA 2I4IA 4PZAA 2JK1A 2C78A 3KOWA 2O3JA 4DR2B 2AGVA 1U9ZA 1F0PA 2ZYAA 4DDWA 5JSQA 3V4FA 1LQTA 4QFBA 4KR7A 5HGXA 4X8IA 4X54A 4Z89A 1N2SA 1KRHA 4KDCA 3VV2A 4GI7A 4PICA 1WDWB 3QFSA 4JUVA 4GE0A 2HDAA 1WOMA 1Q74A 2YXLA 2L2PA 1SG6A 3RUCA 2QVCA 1VLLA 3RR2A 3TSCA 3JTEA 4F17A 2CBGA 2M98A 3GIBA 1FP2A 4LI3X 2PS1A 4IUVA 2I4RA 1PX2A 2DJ5A 3LDGA 1FJXA 5IJ0A 1WY7A 3OQPA 1QVFP 2EJGA 3HXTA 2IZZA 2VPTA 5ECYA 4OSOA 2X35A 1R8XA 5A2GA 2G07A 4J7UA 2XMQA 4H3SA 5ANRB 1AGRA 1C9EA 2R6FA 4R2JA 2K7AA 4DSTA 3L1AA 3FDZA 2KYBA 4N7JA 1JEQA 4FLMA 2QTVB 4L1KA 3Q1KA 2WA2A 1Q0QA 1Y5LA 3A2MA 3ZQJA 4A4EA 4J4BA 1Q1AA 3SD4A 1P92A 2YYZA 4QVKA 1WPRA 1LWNA 4PYOA 4IJUA 1PT7A 4MYTA 3SLDA 3JV7A 3M58A 1OTHA 1AVTA 4JZ4A 2OBBA 4NFSA 3V32A 4ECAA 4V0OA 4TTTS 4BQQA 3RESA 1T0JB 3BEOA 1WQ4A 3T35A 1GDHA 2JVKA 4JHLA 4GZ5A 5CLGA 5IH7A 1DJMA 4OYHA 1M1NB 2W8ZA 1I6KA 1KS9A 3O74A 4C2TA 1GVNB 3IXLA 4UC4A 4MR9B 3PL5A 4ZCQA 4S1NA 3PQFA 1M2JA 2F3RA 2Z6AA 1CZOA 3PSHA 2BRUA 5D3KA 2AF4C 1YC2A 3UK2A 2P1DA 2AN4A 1YS4A 4J0JA 4KQWA 3TXAA 3OZ7A 3D6TB 5FI0B 1SJ9A 4JUFA 4C8QC 5TEWA 3S0JA 2QDXA 2K7ZA 3TD6A 4HX9A 2J59A 3STYA 3P19A 2PXXA 2LCLA 5KTYA 1K4US 3QBYA 2AMVA 2BFBA 3EGOA 1RTTA 5ALGA 2I65A 4F4IA 4BHTA 3L01A 1U9JA 4BP8A 4YJDA 3BQMB 1VKJA 1VQ5Q 2BGUA 3B1ZA 3H99A 1BVYF 3LP8A 3ECSA 5FRDA 2C8KA 3WICA 3UMVA 1SCUB 4C20A 1FLNA 1L6IA 1IN1A 1T0HA 1NQ5A 1PT8A 5GANe 3CCJA 3IP3A 4JENA 2Q3JA 4QVZA 1GNTA 4BDYA 1P3JA 1KE2A 3OCXA 1GUYA 1ZD4A 2B4YA 4Y2RA 3OZFA 2WWRA 5EZSA 3RVBA 1KKMA 4N40A 2BCJQ 3PXDA 1M73E 4B3XA 1KHIA 3RG2A 1PJSA 3DLIA 1UM8A 3TGLA 3BCFA 1E2DA 3D6AA 2YDXA 3R4VA 2VP0A 1CUXA 1M9NA 1Q0HA 4F5WA 2O0MA 4S12A 1C8LA 2IY8A 4DIFA 1WOOA 4MVJM 3U3JA 1VE5A 4KGVA 4MCAA 3WMFA 3MSCA 1KY4A 5GJVB 4EYOA 4DLNA 2HWXA 2WG1A 4OREX 1O9HA 2W6NA 2HU2A 3DDZX 4V02A 1Y0YA 2LZ0A 2V26A 3PUKA 2IH2A 3I5MA 1QU2A 4X7PA 3THWB 3K09C 1J06A 4CWAA 1AKQA 1LV7A 4FS8A 2KRMA 1G8JA 3LPCA 3DXYA 2QG9B 1SRQA 4UUAA 2DQSA 3B9BA 4L16A 5TPWB 1CF4A 5BYKA 3V8QA 3SXUB 2IKSA 4HCBA 2H5JA 3N59A 1IQPA 4J1NA 4Y2GA 3S2ZA 3RRBA 3T7JA 1T9HA 5LJ5j 4R41A 4HEQA 2O8CA 3WLLA 3N8DA 3OQMA 1LSJA 3ILHA 4H1UA 2PUVA 5K0SA 1V5FA 2Z2XA 5FR1A 1W0KD 1ZR4A 3C70A 1LTHR 4ZV7A 2IV3A 4P0QB 5ICFA 5BPFA 1P0PA 2M02A 1UJ2A 1WJRA 1PR3A 1FYEA 2KVQG 1T9CA 1RIFA 5HF5A 1H69A 3CA8A 3K5WA 2FPIB 3UKOA 3ORQA 4YRIA 3AC0A 3RVSA 1EM8A 1U2DA 1H9BA 1IULA 3OF2A 1F06A 4WXRA 1JZTA 4DABA 3W90A 4P6YA 1Y7TA 3KD2A 1EFLA 3H11A 4L4SA 2F1HA 2CXXA 3MUNA 5IC6A 3MJFA 4F6RA 4NEQA 2FP3A 3OJFA 4BV8A 5JPIA 1VLJA 3PX3A 1BGVA 4UHBA 4U2CA 4CMIA 2ROLA 1XZHA 4MRSA 5HJ5A 2C5BA 3HK2A 4KQ6A 3O3CA 2L0XA 1IOLA 3GEPA 1JH8A 1TGVA 1TM7E 5JPDA 2I99A 2O31A 1X8JA 3LOQA 4C5EA 4BO8A 4KAXA 4FFWA 4JXXA 4OLJA 3C5EA 4MQLA 3CUYA 3TL6A 4YJ3F 3JVDA 1FDUA 1ZA2A 1N8RD 5AK6A 1Q3TA 1VQ9B 1B74A 1BYMA 2PMBA 3WNBA 1QYDA 1NMSA 3P32A 1JLMA 4W6QA 3PQ2A 1EAMA 2X77A 1JVNA 1YRLA 3OAAA 4DBVO 2F90A 3LBIA 3DCYA 1Q7EA 4WZBE 2PUJA 1ONNA 3VHRA 1XVAA 1VBNA 4YELA 1JGTA 3M2TA 4L4XA 3DXZA 3ZWPA 4BMZA 3FH0A 3PFWO 1I6WA 1BCSB 2XB2A 4BNMA 3KQVA 4JKOA 4HVCA 3HXQA 2ZYUX 1KE1A 5EZQA 2J0UA 3CC7T 5KSWB 3TS1A 1EWRA 3N2NA 2RI2A 5GAOn 3HVJA 1YLOA 5GONB 1Q86D 1I5OB 2P8JA 3DB2A 5EJ2A 4ZI7F 2PX4A 3ZEIA 4NBVA 3VHQA 4PFZA 3RBBB 4YUXA 2YS6A 3H16A 3LL7A 2IT1A 1HBJA 2XKBA 4NU5A 4FNMA 1WXTA 4F7UF 1NLZA 3WIUA 3RUHA 1WUIS 1JF8A 1QHNA 5FQNA 5EJGA 1R0KA 3QBTA 4IHJF 5ELLA 1WXDA 3MJ4A 4M78G 5BUZA 5H3HA 2K2WA 5FLKA 4CKWB 2DBMA 2L18A 2O20A 1CR1A 5HX7A 1TPZA 3PXXA 4TQGA 4IG4A 5H7XA 3GLFB 1PFGA 4QOHA 4NYMQ 4TM7A 4L2IA 3FLMA 2R6HA 1EXVA 3D4BA 3SNHA 4DPLA 1PG0A 4TX1A 4XR9A 4QU5A 3C74A 3RC9A 3TZKA 3IRVA 2CLLB 3SKYA 2I3DA 1TLLA 4ZEVA 2AHRA 1KI6B 3MYYA 4FJ1A 2XRFA 3B48A 1Q82D 3WLAA 2FWMX 1IB6A 5ALLA 2DFKB 4HJXA 3C0CA 5BSGA 4RHUA 1TEHA 3T52A 1R8JA 2MR6A 4FDTA 4G6ZA 5E6SB 1SVNA 2FMHA 5CJPA 1PIWA 1MV0B 1AZGB 4AG5A 2GBCA 1BDMA 4MTLA 5FI5A 2NTVA 4U9IS 3OHPA 2D0OB 3M9WA 4XX1A 4NH0A 3ZI4A 3SBEA 5JNSA 2EQAA 3SF8B 2X4WA 2WLSA 4NYIR 1UK8A 1KC1A 2VO1A 3NM6B 3M6UA 4G36A 2RGCA 5LQNA 5GMKm 4WX2B 1QFXA 4CN8A 4EBBA 4EJFA 3LUFA 2ZUEA 1ENYA 1A27A 3BZBA 5BSTA 4BNKA 4PZ9A 3T15A 1N34B 3HYNA 3PUYA 2QMHA 2HAXA 5H4GA 1BMTA 4LRSB 2JIZD 1O96A 3D0QA 1N2CE 3CCJQ 5HJ2A 4TMXA 2QV7A 2X5JO 3VX4A 4MZXA 4I6GA 1ODCA 2R6DA 4WVFA 1AD5A 3PD1A 4K7JA 3GMDA 4W5TA 3BD9A 1T9BA 3BBLA 2KROA 2FEKA 4OK6A 2CMKA 2H07A 1XYVA 1AKRA 1PNVA 5H4HA 5FORA 5HZBA 4BX0A 2DCUA 1UEJA 2H5LA 3CNNA 5FUWA 3OTWA 1PVOA 5FOXA 2C29D 2GXQA 4GICA 2X4YA 4OFZA 1J25A 1JIKA 2FFJA 1IFXA 1U0JA 4D9EA 2R5NA 2ZBGA 1MA0A 2G3YA 4QUEA 3NEJA 1LLDA 3I30X 4JJZA 1DO8A 1KD1R 5CAEB 4JLMA 3W3AH 2JEYA 2AOTB 1BI2A 2FE4A 3KR0A 3TINA 1O97D 5FUBA 2C9DA 1JKMA 3TTWA 4PLTA 2HBRA 1M1YA 4OB2B 4ZGEB 2F8SA 4CLEA 3K1AA 3WK4A 2NU7A 2AQ8A 1I81A 4BWVA 2QQEA 4JA2A 3B7GA 1P4HA 2ZM5A 4XIJA 3OLWA 5KYKA 2B4RO 5BMVB 4YJGB 1E2GA 4GBED 1K5DA 2CVFA 1JMYA 3I83A 3H0HA 1BXRB 2MHCA 3DMTA 2VKNA 3OIVA 5ITZB 1NPRA 3CP8A 4P4TA 3ZVRA 4DCUA 2GUWA 5KW9A 1VLVA 2YY5A 4UPEA 2W2MA 5F2EA 3VUFA 2IELA 1A76A 2CMFA 5DWQA 1CRQA 2VQ3A 2X86A 3GFPA 3L02A 3JAMA 3EYWA 4WERA 1HLPA 3A6PC 1IOVA 4AUNA 3WB1A 2VJQA 2D8HA 5BR7A 4I55F 1XRSB 3JQAD 3QVLA 4C87A 5BSMA 1UBNA 5CT9A 2O07A 4MITA 1HKUA 1AG9A 4LJ5A 4QXRA 1L8AA 1V7PC 3KSRA 3IT2A 3ECCA