2DEUA

Cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
364
structure length
364
Chain Sequence
AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGIIEQRLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of tRNA sulphuration via an adenylated intermediate
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/rna
molecule keywords tRNA
total genus 85
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 2.8.1.13: tRNA-uridine 2-sulfurtransferase.
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03054 tRNA_Me_trans tRNA methyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.280 Mainly Beta Roll SH3 type barrels. Adenine nucleotide alpha hydrolases-like domains 2deuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2deuA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2deuA01
2X3FA 2EJCA 1YULA 1OGJA 1PFYA 4KPUB 2CRVA 5KSWB 4ZCSA 1CT9A 1EE1A 1XE1A 1J1ZA 5KWVA 2BM0A 1S4MA 4HE5A 4PBRA 3CD6B 3QSYA 1KP2A 2IELA 3CCEB 4P3YA 4MWBA 1N0UA 4WSOA 4U9UA 4RPIA 3RHSA 4DE5A 3B82A 3CCJB 1ZH6A 1DARA 3CLUD 4MVYA 1EFTA 1I6KA 3IUBA 5F23A 1MB2A 3ZGZA 1MB9A 3MUEA 1VBMA 3QFTA 4JFAA 1TQ8A 2A1UA 3JQPA 2A1UB 3COZA 4MW5A 4EF6A 3E27A 1KQOA 1R6UA 1PFVA 1VBKA 3H9BA 3C8ZA 4YP5A 3UOWA 3ZUGA 2GPJA 1M8PA 2EL7A 1G8HA 2VYQA 4ZCIA 3VNVA 1IHOA 1KR2A 1VQ7B 1O96B 4AF6A 3FPKA 1H3FA 1JHDA 2IP1A 4C0SA 3IVXA 3W2FA 3CLTD 3ZJUA 1G7TA 3ISJA 2J09A 4F3RA 5DB4A 3UMVA 4G5YA 3MCAA 4HPWA 4F7DA 3FG9A 3RFFA 4MUNA 4YP6A 4NCNA 1UMKA 1GN8A 1K97A 1WY5A 1J21A 4EG7A 2C78A 1EFVA 1YUNA 1VQ9B 3AGPA 4PBTA 1QFJA 2X1MA 2BN4A 5J59A 4LBYA 1JZQA 4YAWA 3NBAA 1LI5A 1FFYA 1JA1A 2CV2A 1DDGA 4HE6A 3QTBA 3FDXA 2RE8A 1T6XA 1XNJA 4HJRA 4RUKA 1N2GA 3VNUA 2QTZA 4RD3A 1EWYA 3TNJA 2IJGX 2VNHA 2A1TR 3GLVA 4RD1A 2YXNA 2QUJA 2AG6A 3E20A 1QFZA 2HZ7A 5TEWA 1YIAA 3H05A 4FK8A 1QVGB 1ZM3A 3G5AA 4DQLA 1MOPA 4M0LA 1V47A 2CYCA 3IDFA 1B6TA 4S1OA 3CVWA 4H9GA 2CYBA 1ULHA 3N2YA 4MW9A 4MW7A 4C43A 2HCJB 4NZPA 3GMIA 1EXDA 3QFRA 1G8GA 3PNBA 3SEQA 4R0NA 1X8XA 5LM3A 3AVYA 3FWKA 4L2IA 3W2GA 1EFVB 4ND6A 4YMIA 1N2IA 2RD2A 1SURA 4WNYA 1VLHA 4R2MA 4JYZA 1QRTA 2PZAA 5EKDA 2GOYA 1WOYA 4RD0A 1F60A 4MWEA 2XEXA 4R71A 1MBZA 2CNDA 1EFPA 4TMZA 4CQNA 1CNEA 1WZ2A 1E64A 4GRIA 3INNA 4MW4A 4EG4A 1W87A 3RBAA 5EMNA 2QEXB 1IRXA 1I6MA 2DY1A 3KT8A 3FETA 4TN1A 1NURA 1KK2A 5HG0A 1BJKA 3RK0A 1XJQA 3PRHA 1NUTA 3G6KA 4Y7CA 1I6LA 5TV2A 5TR9A 1UFVA 4NAUA 1IQUA 2CUZA 1YI8A 3CW2A 1DNPA 3OZWA 1D1NA 3I1FA 1M1ZA 1WXFA 3P0HA 4MWDA 1LW7A 1KJZA 1VQKB 2PG3A 2VNJA 4J76A 1PFUA 3CMEB 4YAUA 1OB5A 3JQQA 1K92A 3LCJA 4G1BA 4YAOA 3AGQA 4I6GA 3W2HA 4PC7A 1M8GA 1JIJA 1X6VA 1O5TA 2ZUEA 2EFGA 3ZBTA 1M1KD 1M8FA 4R2LA 2RC5A 1WXIA 2QUIA 2YWFA 3IMCA 2B7CA 1VQ4B 2OTJB 1YUMA 1COZA 3ES9A 3AVUA 1T6YA 4K0RA 4U8HA 4JXXA 3AKZA 3IUEA 1R6XA 4G5FA 3TZEA 3IMGA 4ZCLA 1EFPB 1JZSA 2YWGA 1KKUA 3QE4A 4DDKA 3TS1A 1O94C 1M90D 1J70A 4B44A 3A05A 1GAWA 2DETA 4FWTA 1A8PA 1QFYA 1I2DA 2OV4A 1GAQA 4PC2A 2FX3A 1ZUNA 2X3UA 3ZZ0A 3S3TA 1IB0A 4LBZA 3CRZA 1J20A 1P7PA 4Y9RA 4LC0A 4YBRA 2CV0A 2D74A 3IOBA 1GVHA 1F9AA 3TQIA 1ZM4A 1K9MD 5DASA 2YWCA 3U6BA 4KR7A 2HDNB 3Q10A 1W34A 3CVYA 1N0VC 4KR6A 3ND5A 3H97A 3ZC3A 1ZH0A 4ZCPA 4WQMA 2VTBA 2DXIA 4BWVA 1TYAE 3X1JA 4L2IB 5FO1A 3CC2B 4ZCQA 2BF4A 1WQ3A 1T9GR 3CLRC 2BV3A 2E0IA 3ZXIA 2Z3VA 1YITB 2CSXA 1MRZA 3KT6A 3QE2A 1HYBA 2A1TS 4RD4A 5HXBA 2A84A 4DDHA 5H16A 2NZ2A 2D5BA 3W5VA 4MW2A 5JBQA 1JIIA 2Z09A 1JJ2B 2E89A 4B48A 3ND6A 4N3NA 4ACBA 1TYDE 5K0SA 3MLBA 1VQLB 5H7XA 3PENA 4B3XA 3VRHA 5JBNA 1M83A 1YIJB 3LO8A 4I6EA 5BNZA 2QTLA 1Y42X 3W5UA 2JANA 1CNFA 1G8FA 4J75A 1Q77A 3IVGA 4MUIA 3SDBA 3MXTA 3AG5A 2WSIA 4MQ6A 5TEVA 3CXCB 1TEZA 3GUZA 2BVNA 3UY4A 1IFXA 4Q93A 4ZT7A 4UAJA 1U2RA 1EP1B 4AF7A 1G7CA 2BGJA 3I55B 3OW2B 4B47A 1KQPA 1U3DA 4XFDA 3SP1A 1QGYA 2NSYA 4UZEA 3WY9A 4MUKA 3DO8A 1F7VA 4PGOA 3NV7A 4Y9UA 1QQTA 2WQ6A 3UK2A 1OWOA 4AQ7A 3W2EA 4MWCA 4NAHA 1VQ6B 4P2BA 1BQEA 2B5OA 2I1LA 1FRQA 3CLSD 3ELBA 1CQXA 4JZYA 1KQNA 1XNHA 3CLRD 1GO2A 4IW3B 2QJOA 5AHWA 5KCMA 1EUQA 3A4IA 3VGJA 1E63A 1O0BA 1S72B 2DERA 4CT0A 1ZM9A 4EH1A 1VQPB 1KK1A 1A8HA 1F7UA 4DQKA 2O8VA 1J09A 5H59A 3CCQB 1ILEA 3OZUA 2QTMA 2QMUA 3TZLA 2X1LA 1NUQA 2A88A 4LBWA 3CCLB 1U7DA 2CYAA 1W35A 4AC9A 1YI2B 4EGAA 1O0CA 2A4MA 3E1YE 1TVCA 1KORA 2QA4B 1LI7A 3P52A 1OWMA 4MVCA 1N77A 2AZXA 2OK8A 2DEUA 2BTEA 1G7RA 1H3NA 4CDNA 1FNBA 3ZIUA 2VTBB 1O97D 4A91A 4P6VF 4G1VA 4TS1A 5THXA 1GZUA 4TMXA 3AFHA 3H99A 3WNCA 1N8RD 3DV2A 2BYTA 4YAFA 3N8HA 3U6KA 4X0EA 5KHAA 1U7XA 1OWPA 1WDTA 2QTNA 3H9CA 4MAFA 1GPMA 4EG1A 3CVUA 3I05A 5J5AA 4CDMA 1I7PA 4MVWA 4ZCMA 4ZV4A 1JNYA 4EG6A 1AMOA 4DJAA 1QRUA 1JEDA 1Q86D 1KK3A 2B7BA 4TMWA 1SKQA 1PG2A 4ZCRA 2DPLA 4ZT4A 3W2IA 1IVSA 1BS2A 3W5HA 4Q16A 1N2BA 3OZVA 4ZGQB 3MHPA 1EP3B 1NJID 3HFJA 4PY2A 4ZT3A 2ZUFA 2OQ2A 2EIXA 2QUKA 1Q82D 4NBSA 2BSAA 3IH5A 1K73D 4M53A 3HMQA 1ZM2A 4RD6A 1JEEA 1H1TA 2E21A 5TGTA 3ND7A 2OTLB 4HJXA 2PZ8A 1NUSA 1FYDA 2ZP1A 2AKEA 1N2HA 3Q4GA 3MLAA 1N78A 3ZJTA 4RCZA 3K32A 3P0IA 3J81k 3VU8A 3B78A 4HK4A 1OWNA 3WYAA 4OUDA 4DNXA 4PBSA 1N3LA 1TLLA 1KH2A 5FNZA 3SJZA 1O94D 4M1KA 1DDIA 3BL5A 1FRNA 1VQ5B 5HUHA 3ZJVA 1U0BB 1GTRA 1FNMA 1NSYA 2YY5A 4RD2A 3WBKA 1S0UA 1MAWA 4F4HA 2X0KA 1OB2A 4MYUA 3V76A 3ZZTA 3SEZA 3HV0A 3FH0A 1O6BA 4ZT2A 2CV1A 1Q19A 1WQ4A 2VXOA 3U2QA 4YHBA 3L92A 1D2RA 1KQSB 3LE8A 3COVA 1PFWA 3A04A 2J7KA 3CCUB 1YJWB 1QUFA 1K8AD 3X1MA 1JMVA 1O97C 1QU3A 4ACAA 1BX0A 4U7JA 4KR9A 4FZJA 1Q81D 3LOQA 1GAXA 1EFUA 1D2EA 1KAQA 2O5RA 5FO0A 1EUYA 1F4LA 1KP3A 2RC6A 4PC3A 1WXHA 4JXZA 1D8TA 3KT0A 2YWEA 4ZT5A 1OBHA 3SZGA 4M4SA 3CCVB 2HGZA 5IHXA 3M5WA 4RJLA 3I56B 3IMEA 1NYLA 3MMXA 3L93A 4G6ZA 4NDAA 4XSVA 4ZT6A 3OTWA 2PLFA 1PG0A 1KTVA 5IJXA 1IJEA 3G71B 1YIDA 1KK0A 1YJ9B 4MW6A 1QUEA 3QFCA 1OD6A 2QJFA 2V0GA 2J4DA 2PZBA 4G5GA 1ELOA 1TTTA 5AN9A 1R5BA 1GTSA 2JAXA 4UZFA 1XNGA 2AHOA 1FNDA 1XB2A 3FHJA 1TFUA 4MUHA 4QRDA 1SM4A 5TY0A 3ZBUA 1O96A 3PNVA 4DLPA 4Q7JB 3G6EB 1B2RA 3G59A 2DCUA 4NX2A 1QGZA 3WBJA 2G36A 4N3GA 1QNFA 2C77A 1JECA 1WKBA 3WNBA 1QX4A 4BPRA 1W2BB 2Z08A 4QREA 4AS1A 3FNRA 1KC8D 1JILA 3SYTA 2A7XA 2R6HA 1EXMA 2A86A 2B7LA 1JA0A 3HL4A 4ND7A 4YALA 4U63A 3TQOA 1WJGA 2J08A 5DEOA 1TUIA 1ZJWA 4EFKA 2CFOA 3DPIA 3FOCA 3QFSA 3AG6A 2C5SA 2H29A 3CCSB 1K4KA 1Q11A 4KPUA 4MLPA 3AL0C 3CCMB 1VL2A 1BX1A 5GV8A 2R5WA 3RJZA 1WXEA 1RQGA 5LFAA 4TMVA 2QUHA 3P26A 3DLAA 1F20A 3ZZUA 3ILVA 3HZRA 4MW0A 1NP7A 3K9WA 2VZLA 3HGMA 4I6JA 2BPOA 1R5OA 3D6VA 1KAMA 2QN6A 2PMDA 2BM1A 1T6ZA 1NI5A 2D54A 2J5BA 3VMFA 3CVVA 3FIUA 1O95C 3QTTA 1WXGA 2QTRA 2TS1A 3COWA 5K0TA 2DLCX 1TYCA 3F3MA 3OP1A 4PC6A 2H2AA 5HUJA 3CC7B 1GJRA 1KH3A 4K03A 2NPFA 1NUUA 1KH1A 1EP2B 1EJ2A 2PXHA 4K1XA 3CCRB 4RCYA 3G4SB 1K4MA 1T9GS 3KFLA 2PFSA 4KKVA 1IJFA 3CMAB 4MVXA 4H3SA 4J0QA 3CVXA 5DK4A 4EG8A 3IODA 3AVXA 2E1RA 3MMPA 1VQ8B 1N1DA 1N2EA 4MULA 2GM3A 3WNDA 1QU2A 1J1UA 1TYBE 2BMWA 4M2LA 1M8KA 3FY4A 1Q15A 3N9IA 2ZITA 3P0JA 4EG3A 1YJNB 2XNJA 1N75A 3KT3A 4EG5A 2WQ7A 2PIDA 1JB9A 2XNCA 3PXUA 3NBKA 2JA2A 1FDRA 4YP7A 1YHQB 4NATA 4ARIA 2CT8A 2VNKA 3LVBA 2QDXA 3CA8A 4B4DA 2J07A 3CLUC 4XFJA 1R5NA 1KD1D 1G59A 5J58A 3JQRA 1NZJA 5DSZA 5GV7A 1GR1A 2YWHA 1OWLA 2GKSA 5FA6A 4B43A 1GLNA 3CLSC 3IOCA 1QTQA 3A2KA 1VQNB 3IVCA 1QJCA 3U1VA 3ZXSA 1H3EA 2OK7A 3AVVA 1V8FA 4GU5A 1QRSA 4MW1A 3FI0A 3JXEA 1KRHA 1E62A 3CLTC 3CB4A 2WB2A 1VQMB 1HA3A 1R6TA 4OJMX 4OUDB 3OJWA 4FN5A 1JGTA 1G7SA 2GQFA 1FNCA 3VO1A 2XRYA 3IOEA 1ZUNB 4ARCA 3AVWA 2V0CA 2PIAA 1AIPA 2DUMA 4E1AA 1VBNA 2VNIA 3OJXA 1B23P 5TS2A 1H85A 4LBVA 1N2OA 1J9ZA 1NUPA 1QG0A 4ZGNB 3AVTA 3B8HA 1MC1A 3D6UA 3N05A 1IQ0A 1MJHA 4MUGA 1M8JA 1OBCA 3X1KA 1OGIA 4QFMA 3FJOA 1JIKA 3VO2A 1EFCA 2DR2A 3SZ3A 1DG1G 2QJTA 3UC5A 4MYTA 1MAUA 1QGAA 3CC4B 2E18A 3Q12A 4QHYA 1N2JA 3COYA 4MUJA 1H42A 1Q7YD 2XRZA 3PNYA 5LLTA 2BGIA 3AIIA 4MUFA 3RK1A 2HMAA 2YWBA 4DDMA 1QVFB 2D13A 4TMTA 5H5JA 3WXMA 4MUEA 4QBTA 1NDHA 1QH0A 4ZCTA 3CPWB 1IQRA 1IH8A 1U3CA 3CR8A 4PC1A 1VQOB 1O95D 3P27A
chains in the Genus database with same CATH superfamily
3HFNA 3DEIA 1MB0A 3QYJA 4BGEA 1LJOA 3IEUA 1I14A 3KXLA 1A97A 4PWZA 4ZCSA 2NM0A 1K8XB 3K4HA 4Z0TA 2BM0A 2AUMA 2XDWA 1AZTA 5I7EA 4WSOA 2WA1A 3T3IA 2VBSA 5B1EA 4XGRA 5L95A 1UJ5A 3T3GA 1CQPA 3RUCA 1UBKS 4RK1A 4Z02A 1DARA 3WBFA 1XU9A 3HUUA 4BL5A 2O8EB 3QIAA 1VQPA 2O0KA 1YJWT 1LS1A 2CH4W 5AW6A 4I1VA 4BNFA 1B73A 4JFAA 3V3TA 1FE8A 4N5HX 4PZ0A 3E27A 1KQOA 4G9BA 5LJ5g 5FBZA 1WJSA 1O6ZA 2I3GA 1PVDA 2RK1A 2W6QA 3LGFA 3IB6A 3TR5A 3ZTWA 1KHTA 5FIUA 1I1HA 4E6EA 2HBPA 2VYQA 4ZCIA 1P2FA 5M5BA 1ONOA 4QFCA 4MAAA 4PZDA 2ZM5A 1RZUA 3JTMA 3MJFA 3PWKA 5FPQA 4JHXA 5CQYA 3TE7A 5B55A 1JHMA 4MIKA 4FYWB 2VAWA 5F5XA 5J9FA 5J3OA 2RGXA 3HBJA 2HKQB 3FB9A 5SICE 3BFVA 3KYJB 3PE3A 4B4WA 1N5DA 1P61B 3CF6R 3GFBA 3AUUA 5EGSA 3RNLA 2YBEA 4I46A 5KMGB 2JBHA 5GAMg 4HDNB 4FONA 2L0AA 1U02A 4HPJB 1L5KA 1FZQA 2GKOA 2PUVA 2ZTSA 2YJ4A 2V5UA 3Q5EA 4MI6A 4XJXA 4GKKB 3PF9A 4WXEA 1R4MB 1W6UA 4AP6A 2ZTVA 1ZSZC 3OPNA 4NCBA 3GA5A 1GNTA 5LNK1 2F1RA 1BI1A 1Z06A 5FUMA 2JVJA 1GGEA 3NWPA 5TQ0B 2L69A 2P3OA 2Y93A 1YVRA 1YZKA 1QPBA 2R00C 4MV1A 2FCRA 2M9UA 1LRKA 1USUA 4RD3A 4MLZA 3MO8A 3DBRB 4P4TA 1E5VA 1JQ5A 2C95A 3T34A 1KO5A 3UJHA 4BCCA 2PE3A 2VNHA 5IBCA 4PSDA 4JD5A 1RWMA 2AKAB 2PUFA 1GPNA 1HDZA 3QVSA 3RIHA 1QFZA 4Q3CA 2IEDA 3OBIA 4G86A 2QRZA 4NULA 4MPDA 1XZQA 2DTXA 3ONNA 2NZJA 2QHXA 3KDAA 2RN8A 3O3MB 2ZAEA 2Q4EA 2CN1A 2BHSA 4RORA 2C5GA 3INRA 5LB2A 1P1IA 4G0QA 1G8GA 5JFGA 4XTXA 2M51A 1XTTA 2YN4A 1KC8C 1MAAA 1SHJA 4IX1A 2PS1A 7ABPA 3ZX4A 1I1QB 2RSLA 2Q2QA 4LI0A 1CVRA 4O4LA 1WVGA 4WNYA 3TR6A 5HZHA 5IRCD 2IQIA 2FWBA 1TVKA 1I9GA 1FFAA 1SU4A 4KQIA 3OZAA 1IXDA 2J3QA 3V6LA 5CAEB 1NKSA 1RM3A 4LZOA 1IOZA 4P82A 4DDUA 4ZO4A 2EERA 4N0MA 3VPAA 2CNDA 1LPMA 2I7DA 3ETGA 4DUYB 2GZAA 1E64A 4OLJA 5L6LB 1WZ2A 3A6PC 4MQEA 1DOAA 4ER7A 3U39A 2FRVA 4E7LA 2RHJA 4XUDA 5A71A 2VBVA 4JEIA 5JCZA 2Y0EA 1ECJA 2LJ1A 1PJ7A 2HSJA 2Q3BA 3ETNA 3FDZB 3GB9A 3I9LA 2AI2A 1ZONA 5HK8A 4ZOLF 5BXYA 4X44A 3RVBA 1W2GA 4YT8A 3L7NA 4MAMA 1XQ1A 1Y6JA 2XSZA 5TPZA 7REQA 1E59A 3SC2A 4GI7A 3TEJA 3WISA 1ECPA 2J6CA 3PX2A 4LRWA 2ZB8A 4PGMA 3W5BA 2D7CA 3M82A 2J30A 3ZH9B 4LXHA 5AYFA 3F74A 3CMEB 2JGIA 1U0HC 3LCJA 3BGSA 4GNRA 4YR7A 3LDHA 3ORYA 4YASA 2AN5A 2HYIC 3DLBA 1CEYA 1ZM7A 2EHJA 2F1JA 2OHVA 2WWTA 3I6ZA 2XYGA 4UCQA 2QMEA 2VO1A 3BUSA 4R2LA 2DAQA 1IEVA 1GBQA 2J7IA 2WIGA 3KALA 4O4JB 1UXIA 1ZLMA 1WMDA 4BKQA 3IMCA 5GINE 2WWWA 4B74A 5GMKh 1TQ4A 2ZUUA 1VQ4B 3UWKA 4UPEA 1M8MA 1R50A 1UQRA 3KZMA 4I2VA 3A4TA 1SKAA 2BFNA 4K0RA 4LYYA 1NQUA 4WCFB 3K35A 5CGZA 3ZCUA 1E3MA 5LMNB 4JLKA 4G01B 4ZCLA 3DQZA 3RSGA 4XOIA 3ASZA 4URFA 3A05A 1K66A 2BD0A 1HYGA 1D09A 1EFKA 2HU5A 1AQLA 2OV4A 2VKTA 1LZKA 2GBGA 4QVAA 4OQPA 1YFNA 2HNAA 4R9NA 3HDHA 1V8ZA 3DUWA 2P0EA 4UBNA 4DQVA 2PZKA 5CW1A 1GSAA 3HO8A 1D3BB 1KJYA 4O1HA 4RENA 4EMBA 1N6PA 4B3SB 3EWIA 1W581 3A1UA 2VYVA 1JIUA 1RJEA 2Z4TA 3UT6A 4FC6A 3NVKI 3A7EA 3QKSA 1M76A 3AJEA 1FWZA 3MTEA 4IDBA 2HB6A 1R4ZA 3C8MA 1X75C 1CDOA 4XA8A 2KK4A 4BQOA 4DQ0A 4HLUA 3OCCA 4C0HA 4DHWA 3AJRA 5JASA 1C3EA 1EE2A 2D5LA 2WT9A 4K2AA 2JLVA 1YJWQ 2JVIA 3KUDA 4BWGA 4KO1S 1G16A 1OLUB 1HYBA 2JTEA 4RD4A 1DCKA 3DV0A 1F8UA 1JHVA 1NXXA 2IEZA 5FYDA 4DDHA 4Z4IA 3IJEB 4DR4B 3KVRA 1QR6A 3QVXA 1DMRA 3BXXA 1IBRA 3B1YA 1Y8QB 4G0OA 5D1HA 2Y1FA 1F5NA 1HZZA 1U7TA 3LTEA 5BMOA 1KO4A 1GU7A 1HE5A 4JVOA 4OK3A 3FSRA 4BMXA 3DFKA 2PSFA 2EYQA 4LC1A 1SU6A 5IVPA 2WHYA 1T29A 1NYFA 1EUDA 5ADWA 1FFXB 1XTSA 4K6MA 2JANA 4OSEA 1BFUA 1WLSA 3D0QA 4P4NA 3WLQA 2JFNA 2B98A 4TV9B 4OLFA 3SDBA 3EG3A 3TQCA 2G40A 1ULTA 2PO7A 2V6GA 2MI6A 1ZSZA 3NHSA 4GECA 4P5PA 5E6RB 3HL8A 1EVLA 4P93A 2POCA 1BCSA 3LZCA 1G7CA 1NC1A 4IQFA 1SG6A 4YJ2F 4ETIA 4LWQA 4OJQA 3WY9A 4KDEA 2OCBA 1YKSA 4XVCA 4RVSA 5JARA 1TAUA 1ZVMA 3AV3A 3CUUA 3L6OO 2EKDA 4GF5A 2ZAIA 2VHJA 2Z6BD 2XCLA 1BQEA 4HWRA 2N47A 4JI3B 2ZZFA 3U3XA 1DBWA 1RTTA 3D81A 2ZPUA 3A3PA 4GSYA 5IS2A 1N8RC 1F1JA 2BMAA 3HYCA 5KCMA 5A9SA 4MQ4A 1EUQA 3QVOA 3EGWA 2VDRB 3KSRA 1GNQA 1XJWB 4DNRB 1IK4A 3R1IA 2CXXA 5HF9A 2XCQA 3CH6A 4HLCA 1F8XA 3OF3A 4JT2A 5EQJB 1UADA 4FP9A 5GJWB 1QK4A 2ZYUX 3D64A 5H59A 3CCQB 1V95A 3CCMQ 2PT7A 3MUFA 3R0IA 5SZJA 3UCXA 2PRJA 2HCRA 1KQSS 2YVKA 3GL9A 5DULA 4Q9JA 1WW3A 1LSOA 3HP4A 3EQZA 3CSDA 3Q6QA 1PHPA 3LYUA 2OBMA 1VM6A 3R40A 4QBIA 4B3DA 1Z29A 4BEVA 3OLVA 3UV3A 5ER6A 5FTJA 4K6HA 4NDZA 4KIFA 1Q7YU 4L75A 4IQ8A 1IY8A 1VPVA 3T35A 2OGSA 4LQCA 4PZEA 1IUPA 2CJPA 2NZ8A 1TTHB 1N33B 2P62A 1QOZA 3LHDA 3H9GA 3SMQA 4Y2PA 1MABA 4M54A 3N6VA 4YAFA 2WIKA 3HUDA 4ND5A 3LS2A 4QRIA 5D5PA 4LHSA 1VSBA 5J5AA 1T3GA 3L9WA 4RMNA 4BDTA 4Q6WA 1CZHA 1ZUYA 4HCJA 2JD1A 5D3MB 4BTLA 1KDPA 4WINA 5DH9A 1M2OA 1OYOA 2DPLA 4QBKA 1WR8A 5AJUA 1ZIDA 5A9SB 3TLYA 4YHHB 4WY2A 4DWVA 2PBRA 4N6OA 1MV5A 1AH2A 1WB9A 3RS4A 4M8NE 2JCGA 2FZGB 1EP3B 4HB2A 1VTKA 5EINA 5DLDA 4RVDA 1QQ6A 4ZT3A 4TWAA 1NT2A 4NBSA 3TW8B 3QZ5B 1H9AA 3CIOA 2HK6A 1O9BA 1QRAA 4F60A 1RWNA 1Z8HA 5AOAA 5EA2A 5EEGA 3JCMQ 4NMWA 3T8YA 4HGQA 5JXGA 2YY6A 1BCSB 2VCEA 3SD4A 4GC9A 4KIGA 2WMOB 1SU8A 4B4VA 2HF2A 3WI7A 8AT1A 3WLIA 2P3QA 3E3MA 4CCYA 2C2MA 1Y9EA 3OIFA 4TV9A 1PVVA 3MJXA 2EP7A 2W58A 4GKVA 3X0DA 4ROTA 2M0OA 2D1QA 1RE0A 3H2KA 3ZY6A 4TM7A 5AM2A 2F9MA 3LKBA 1NN0A 4M7AC 2D1FA 4UQOA 1ZG3A 1H2FA 1DADA 2FFJA 3WDMA 4IEIA 2CB0A 1ZU4A 3CC4A 3WHPA 3ZU5A 3V76A 1VQNA 1C9EA 1GPAA 1H4TA 2KE5A 2M6SA 621PA 2IU0A 3B1JA 3LE8A 4XM2A 3QXEB 3L6RA 4N4AA 4K9NA 5FWXA 3NE5B 2KHZA 4BB0A 2XWSA 5A6SA 1G6OA 3H86A 1UBRS 3VR3A 5LLSA 5LP1A 5EWLA 4IICA 5DGIA 3VA7A 3O8NA 1I4WA 1RQ7A 4RY0A 3GP8A 1QHHB 3SZLA 3DDNA 2VP3A 2Y6UA 4UMVA 4BO3A 4FZJA 4TZ0A 3MRXA 3LW7A 2WE8A 3SFMA 2OGUA 1QYVA 1UWCA 2O2DA 4JMPA 4ROSA 5E1DA 2YCBA 4BFTA 4E2FA 5JDCC 5GZ6A 5FUQA 2V8OA 4EMHA 1SBZA 1OHHA 3QFFA 3RS9A 3G71B 1CLEA 2PWBA 4P7BA 4UHJA 3WL7A 3ENWA 2E4HA 2ZL6A 3KHSA 2J4DA 2ZBGA 2M6LA 3WGUA 1TTTA 4EY7A 2FMHA 4D8TA 3GROA 1ZICA 4WBSA 2P2GA 3FHJA 4QOGA 2PJUA 4MVJE 2KAFA 1Z0JA 4XCVA 3AX6A 3MPUB 3PNVA 1RWOA 4YRAA 3G6EB 1T8WA 3FKQA 1JHAA 4P35A 1YJQA 2HSEB 2ENWA 2RHRA 1FFSA 3I12A 2BE9B 2BGUA 2WWHA 1R18A 5F78A 3WKAA 3RKSA 3O4IA 2TYSB 1CUZA 3QUIA 1UMBA 3RVKA 2XNKA 3LRTA 2O3SA 5DF1A 3UAVA 3PTLA 3WLOA 1SD5A 3RB8A 3W34A 4UTOA 5A0GA 1JALA 2OQVA 3LMKA 4QOEA 1I5OB 2R1TB 4MA4A 1ZU5A 1OA0A 1DV1A 2RHOA 1N5MA 1REQA 3K73O 2DT8A 4M7WA 1GFSA 1TC1A 2I6TA 3BH7A 1CDDA 3QFSA 1QXSA 1OOTA 4D8XA 2RK4A 2DSNA 4R83A 1N5ZA 2BFCA 4J9FA 3CCMB 1S6YA 2H54A 3S5UA 1BX1A 3DUFB 4LY6A 4Q7QA 2BGMA 1EDBA 3D3KA 1M9NA 1RACA 1L3CA 3P26A 3NORA 2GARA 1SBCA 1PQPA 4HDSA 1EUCB 1QONA 1STOA 1UPCA 1HDIA 4MK4A 3MA0A 4AN1A 5EJ7A 2FF7A 2XOKD 4QKQA 2G3RA 2BPOA 4I36A 4LZWA 4A16A 4C8QA 5CB4A 2YYZA 1OJLA 3PG5A 2P9ZA 2E4XA 2P65A 1GTJ1 3A7DA 3EZFA 2RH5A 2ZPTX 1KK7A 3IPAA 4JB3A 4UTZA 5LB4A 4LF6B 3OC6A 5AUNB 3IQDB 3GPIA 5JFTA 4ETNA 1VQ7T 1FPQA 6REQB 4M77D 1ZMBA 2FKAA 3F3MA 3TDMA 4PC6A 4JZKA 3UK0A 4LDZA 2IHBA 1GRVA 5CA0B 3EG1A 2GTHA 5ILOA 3RS7A 2NPFA 4FFLA 4JLGA 3F7TA 3MWYW 1EP2B 2FW8A 3AYXB 1MTOA 1D1CA 3WB0A 3WLTA 3E7FA 4AS3A 1AG9A 1GKIA 2DQZA 4Q01A 4PLTA 2ZUTA 3VU1A 5ICEA 4F9FA 2FG5A 1NRIA 3LHIA 4NV1A 2VUHB 3EPLA 1DCTA 3A27A 4WASA 1D0YA 4BMDA 1XQBA 2JLBA 3PFNA 4PAWA 5LA6B 2QVGA 1XYVA 1T36A 4HUJA 3ZV5A 4B8ZA 3FGPA 2J9FA 4HATA 1YJNB 3RTAA 5DBFA 1NFQA 2R86A 3O8OB 4D0SA 4IUTA 1W44A 3JX9A 5EJ5A 3NBKA 2BFMA 3CW9A 3JQAB 2OA0A 2CREA 1JG7A 3EXAA 1UPUA 1FDRA 5ELLA 3CZ4A 1POXA 3G8AA 1G8XA 2O3RA 2FK7A 1GUZA 2GCNA 3GGDA 2OHJA 4J2HA 4F71A 3E82A 4ORZA 3CA8A 4H7HA 1NKVA 2JN9A 4KTTE 3ASYA 1E60A 2UXDB 4DQ2A 5KU7A 3MEAA 3O8VA 2L18A 3GLUA 4FFBA 4HX2A 3GNGA 1XTDA 5CYPA 1QMGA 3OOEA 4QASA 3AHDA 4B6EA 4YV7A 1D1AA 1PJCA 2BMVA 1BSVA 2JM8A 1AQ6A 1VKOA 2JAOA 3H6KA 3OT4A 3BW1A 3PP8A 4RJKA 4UMFA 4BO6A 4CMBA 2ZCJA 4UMDA 5F98A 2I4MA 2IZ0A 5JJIA 2BOVA 2RQRA 3S6WA 2FSHA 1TW2A 4OI0A 2PRSA 4CFZA 1SY7A 1B6GA 1Z25A 3KRTA 1J9GA 3EIXA 1RI0A 2ZSDA 1K28D 1LX7A 2DPYA 3F9IA 1TO1E 3GVXA 5A5EA 3X25B 1Y6ZA 2YVQA 2KRSA 2VQEB 5JAMA 1DQZA 3CB4A 3BWDD 3NIGB 3JYOA 1KAGA 4BX3A 1THMA 2HUPA 3EA4A 4JJ8A 5JD3A 3K0FB 1FDWA 2VXCA 4N7MA 3DMRA 2C03A 3QITA 5A02A 4I3FA 4U5XA 5IPFA 4TTTS 5J2TA 1UDWA 5IW8A 1WULS 2PFKA 3KXDA 2EFJA 1J9ZA 4ZRMA 1YZFA 1MC1A 2BKDN 2ZBQA 2P35A 4RKRA 5BN5A 2WG2A 4MUGA 1TAHA 3I35A 1DX4A 1QVWA 3D6TB 3IQZA 5F3RA 3K09A 4NPHA 1DT5A 2I33A 4P5DA 3LNCA 3TQTA 3L7IA 1PZXA 3TPCA 5LQKA 4MUJA 4R9SA 1Y81A 4Y91A 2QK4A 4CC3A 1DTSA 3EXFA 4UUOA 3TK1A 1U2EA 4FZ5A 1VFNA 4HPXB 2D1XA 2B37A 2G7ZA 2P5SA 4HHEA 2RNAA 4TMTA 2ZT5A 3GLTA 4OI4A 4Z7QB 3L4EA 4UTRA 1ZBDA 3VHXA 3WBBA 4ZCTA 4Y2XA 1NXPA 2O3JA 2QQ0A 1QK5A 4QGSA 3HY3A 3DAFA 4IIUA 4RY9A 5BMVF 1Q5PA 3V8RA 2HXGA 4Y2HA 4DEVA 2ALJA 1V29B 2BI8A 3JQFA 4K46A 5CLHA 1CT9A 4G1CA 3SK0A 5C8XA 2DOKA 1FX7A 5J2TF 1I0CA 2C57A 3QPDA 2YRCA 4IO0A 4MRAA 4Z49A 4N76A 5CT4A 3DF7A 4DE5A 3LX4A 3NCHA 1JBEA 1OIVA 2DO3A 3K4QA 4PQGA 2JDID 4ZRDA 3Q3AA 4X24A 2UZIR 3TSZA 2AN3A 2E7ZA 2WUVA 4K3UA 3JASB 3VBEA 4OKIA 1VIMA 4F46A 1K5PA 4CI0B 3KNZA 3C8ZA 2OBRA 2FX5A 3QMVA 4MMXB 1GNPA 4K8RB 5CNMA 2XUHA 1E3IA 2IP1A 4RULA 3QO3A 2HWYA 2R7MA 2ZB3A 2I6FA 3ESDA 3HCEA 3HJAA 1XMSA 3AM4A 4C6TB 3U19A 1A1VA 3D0RA 3TEEA 4M7AB 4B9EA 4HPWA 4ABYA 2P0KA 2F43A 4LTDA 4ZHSA 3RFFA 1X6GA 4ZQGA 3OOYA 4RTXA 3VPXA 1CZUA 2Y9PB 4WK4B 3A6GA 1UM9A 4J0IA 3ZZMA 2EKZA 4ATNA 5HIIA 4CV0A 3BD9A 1YJ5A 4M78C 4C04A 1A71A 3L0IB 3RTGA 4ETMA 2AA3A 4ERNA 4HL6A 3A4MA 1SIWA 3ZPNA 3TFQA 4WD3A 3X1WA 4TXLA 4C0BA 1PWHA 4KOEC 1C0LA 1YBMA 3KHKA 3BB4A 3F49S 5GONF 4GBJA 1RT9A 4FNOA 1E3TA 1UXHA 3UMFA 4MITA 1KXZA 2J8ZA 4LUDA 1N2GA 2Y68A 2ZJ7A 5K3SA 5KAPA 3DMTC 1VLYA 1I24A 3DOOA 3ZHOA 4DRZA 5JQGB 2R8PA 1IHWA 1AC5A 1U3GA 1ZMRA 3CRQA 4JT9A 4BNLA 4LYEA 1CY2A 2YXNA 2RI6A 1IBKB 1XC7A 1I32A 3L7KA 4EMTA 1Z68A 3HLYA 3SVZA 1JQKA 4GXTA 5JEDA 2YJTD 3GBVA 1MOPA 3AB8A 1GRIA 1E6MA 2QKYA 1IQPA 2QXTA 3SB2A 1B6TA 4KJZA 4H9GA 4FW1A 5CX4A 1P18A 4RMGA 3PNBA 4F1KA 1G5RA 1VKJA 3I8SA 3KEQA 4O4JF 2HD4A 1NR1A 1RXEA 2G63A 3Q87B 1Z4JA 1V1MA 1K75A 2WU0A 2HQHA 1SQ5A 4G63A 4F2HA 4I4TB 3RVOA 4KOAA 4HT9A 2JAQA 4J4TA 1LDNA 4ALLA 2ZCUA 2DL5A 1C2YA 3F6YA 1WOYA 3VJRA 2W4QA 4MYDA 4QSMA 1E8DA 4KB5A 3OTOB 2RG7A 4IPTA 1KEEB 3FRIA 4QPCA 3VJKA 3CCJQ 1KMHB 1CUGA 2FI1A 1DT3A 2GUWA 4HGNA 4M7AF 2B69A 3DCIA 4GZMA 4IF6A 3HA7A 1HT2E 2PYIA 2LZ0A 3LT0A 4MW4A 5EMNA 2QEXB 3ZY3A 4EVRA 4NOKA 3QKIA 2ZRFA 2WJVA 3D4NA 4XIGS 4ESRA 3BSFA 3T7RA 5H83A 4AIIA 3A9VA 1KHCA 1QFSA 3AT1A 3AJAA 4E7ZA 1G2QA 1KS2A 2H1HA 2ZBRA 1F2UB 3GEMA 1JIQA 3HR8A 3LL7A 3PRHA 3TINA 2DVMA 1VSVA 2K9GA 2NX2A 3E35A 5CVJA 3VYHB 4ZYYA 1LLFA 5I8PA 4Q39A 4XGNA 3FYSA 1C9JA 1XYGA 3KKKA 3PXGA 2RJDA 4UVDA 2D2EA 2QJWA 3O2QB 4LJ4A 1HZZC 5IAJA 4M7DE 3QVTA 1KJZA 1KSGA 4Q6BA 4L85A 5EE3A 2VP5A 3ZNQA 1OB5A 4FX2A 4YAOA 3CISA 1X2EA 3MB5A 2QMHA 5HFNA 4YY3B 1XTPA 3DW3X 3NTVA 4M77E 4YCLA 4W1SA 4F5EA 2QPOA 2SNIE 1UC9A 5EQTA 1T1GA 3MJTA 5DGCA 2YWFA 3OYKA 5JC1A 1WMEA 2Z5VA 3PFFA 3I2KA 3P71T 3FPEA 1COZA 3LLSA 4Y0VA 1SU7A 1V71A 5J4YA 2V1QA 4QQ8A 4NBLA 1Q7EA 1JQJC 1R6XA 1SD1A 2FG7C 2H8GA 1UKZA 1YCHA 3DZ8A 3W5IA 3EZNA 4B8YA 2PL3A 2VKNA 1U8RA 5LUAA 3TF5A 4RHCA 3BFXA 2I67A 3MWDA 1JJVA 1A8PA 2AHRA 2QU8A 3AK4A 4FNAA 3LHSA 2EGAA 1NT4A 4EAQA 2WV9A 4EKEA 1Q74A 3BBLA 2GT1A 1LS6A 2ODAA 2PSSA 3UGJA 5A4KA 3ABQB 2CV0A 4H6VA 5A04A 2RQTA 3AWIA 4YA6A 1VJ5A 1QG2A 3GFFA 1LBSA 1K9MD 4AAYA 1WU7A 3L1HA 4TXNA 4CTMA 4BZWA 1BDJA 2JF0A 4XCXA 5ED4A 5EIBD 3Q10A 3NR2A 1ZQ9A 1Z7GA 1N6RA 3H97A 1A9QA 5FB3A 3K9CA 2GZ3A 3LDAA 4RYDA 2TMGA 1MX3A 1ZRNA 2XIJA 1DAIA 3BTOA 1C1XB 2G71A 3NTQA 4HWGA 1YRAA 1VB3A 4LDWA 1TUBA 1Y63A 2G09A 4FHDA 4IJQA 3ZXIA 2ZIUB 1C3OB 1RMQA 1KARA 1D9XA 2QD4A 4GMXA 5DKFA 5J5CA 2W2QA 4OLBA 2Q46A 3C98A 1IUNA 4KDRA 1JV2B 2LKDA 2LVBA 2QG4A 4EABA 2Z09A 1E2HA 1L4BA 2PKXA 5IT9E 3F2IA 3OE7D 4GOND 1YB2A 1NVTA 2H7XA 4DABA 3D8TA 2AJCA 2QRQA 4B3XA 2Z5FA 5EHQA 4ASUA 4EB8A 5JECA 3HRTA 4XUCA 3QVGA 1CZLA 2ZATA 3D2BA 1Z6AA 2D5IA 4G0NA 4LMAA 3FLMA 4DIEA 3ASKA 1RADB 2QTAA 2RHZA 5IXYA 1G8FA 1TM1E 1E4OA 2OAEA 4W9MC 4A53A 3IDAA 1JI0A 3EBOA 1SPBS 2PQMA 4QATA 3BICA 2GAOA 4Q1FA 3COPA 4I55A 5BT9A 5KYGA 3I9FA 4OVKA 3GWZA 2WE7A 4LWOA 1DL5A 3FBWA 1X1SA 4F85A 4Y6QA 3I04M 3CCST 1CSEE 4RHYA 3LCMA 2QR3A 4KKUA 4UZEA 4I0WB 4NYMQ 3NOOA 1SRRA 1ZAKA 5B3LA 4KRFA 1HX7A 4LMPA 3HS3A 5D1NA 1FYVA 2WQ6A 1OWOA 3TJMA 4PN7A 1Q57A 1W1UA 3ELBA 4HGYA 3LIIA 3E0XA 3ORQA 4BWFB 1SZDA 3AILA 4AVZA 4WZ6A 3K72B 5DLEA 3R7FA 4EI2A 4J6YA 1E3SA 2N9UA 1J49A 2O8CA 1HE4A 1G8YA 5LJ5e 3TNJA 4TYWA 2I3BA 2O8VA 1JBMA 1GZ6A 4XDZA 4ZVLA 2GMWA 2DKNA 4RZQA 2P4RA 4BN0A 4F12A 5JS8A 1H8HD 2OTJQ 3CB2A 4CM5A 1NY5A 2A88A 2XTZA 3RK4A 5KQGA 4A4EA 3CSSA 2XUPA 4HO1X 2J3KA 4RA6A 2LCFA 2VYFA 3LI2A 2IYXA 4IYJA 3KXKA 5C34B 3MRSA 4ZZ3A 1B76A 1RUWA 1VG9B 1LI7A 5GOZA 3BCDA 3P19A 4PGHA 4G36A 4WLUA 2DEUA 4YT5A 1EVYA 5TQJA 3H1FA 5HZGA 5DP2A 5GJVC 1PEDA 5CLJA 2FRDC 4OQ4A 3TAHA 2NZVG 4HCZA 1J2RA 4LPSA 4W9NA 2O50A 3G13A 3MC1A 1E6KA 4RL4A 4JPBW 5EE5B 3T3OA 4DGSA 1WDTA 1P4JA 3EG5A 1USKA 1ZK1A 1Z34A 1H2EA 2JRCA 2XZLA 2L82A 2YRXA 3FYUA 2EGUA 3HLKA 4A23A 4OHUA 1W88A 2YXBA 1JNYA 3N2IA 4O4IB 1NEBA 1M2FA 2NU7B 1IN4A 1UK8A 2Z1NA 4DA7A 5K0ZA 2BRUA 2C3YA 2ZSFA 3RNJA 4FN4A 5H4GA 1KSFX 4L16A 2IE8A 4RM0A 2OFOA 2WIFA 1FJGB 3RU2A 1PP4A 4BVFA 3KAJA 2PV7A 3W8EA 1N2BA 3RUHA 3ZZ1A 4ER5A 1C30A 2Q7XA 3OMCA 3R6NA 2BFFA 4MKZA 2Q8QA 1KE1A 1R66A 5DHPA 2GYYA 1P4AA 3KU1A 2OQ2A 3LCCA 1YITQ 3D4OA 5DHSA 3T1YB 2F5KA 3I8XA 4BLPA 1EXNA 1W19A 1YCDA 2XODA 3FNIA 4DXHA 2GK6A 5LMCA 4CXMA 3OYLA 5D6NA 4C0LA 3T7KA 2JAHA 2PZ8A 4ZI7A 1E0AA 1N2HA 2XQJA 3I4LA 1JX6A 5SY4A 4JJCA 1MJGA 4EY6A 2GBPA 5JZBA 3PUJA 1E18A 4E7OA 4US2R 3LWIA 3UJ3X 5CDFA 1KVUA 4WVFA 2E5WA 4PBSA 5KJ1A 5LBTA 1TLLA 3AETB 3H18A 1TMOA 2CC2A 2FP4B 4QJBA 3D1LA 5DMHA 3NWEA 5MDHA 3R9XA 2K5IA 1TNDA 5BN4B 1GWNA 2OTLQ 2PX2A 4HSGA 3KB6A 2CXPA 4HNQA 4TN5A 4UHBA 3JSCA 1GCAA 4DA8A 3SJBA 4PYJA 3IAM1 1M3CA 5C8YA 4A7PA 4X62B 3DWFA 2WIAA 1T26A 1WQ4A 2IPLA 3ACCA 6AT1A 1L1FA 3OZGA 1D2RA 4NVRA 1PFWA 2Z5GA 3ZVNA 4C92C 2KYMA 2P6MA 2PAAA 5K03A 1B7TA 1E1RD 1GCPA 4R9VA 2XVYA 5AVZA 1XPOA 2F1HA 4MDXA 5FBKA 2WUFA 3T9BA 1KPGA 5F4OA 1O97C 3MWFA 4QGGA 4ZAVA 5C1OA 3ZFJA 4RHTA 2AF4C 1E0SA 5KTOA 3TREA 2GHTA 3GAZA 5KU1A 5FO0A 1OXSC 3WR5A 4MPRA 4EB6B 3ASTA 5JNLA 2B1QA 4MHTA 3O90A 4NQRA 3NAMA 2C2HA 4NKRA 1HG0A 3GGCA 1PR5A 4RWZA 3G0GA 3CMCO 1BVUA 1NBMD 1VE1A 4MI1A 3IMEA 5ERGB 4HV4A 1DRWA 4DV4B 2PLFA 4IUUA 5BN3A 1I30A 2H5IA 2ZK7A 4N4IA 1RRGA 3IUQA 5IKEA 3DMDA 3ORHA 2IYRA 5DIFA 2LPMA 2M32A 3CVOA 5K6TA 2V0GA 1RXUA 3F6CA 4DSUA 4PQEA 1LLDA 5AN9A 2FZVA 4ZAZA 5T3YA 4HFMA 5E4JA 2DECA 4YV0A 1JZTA 1RL2A 1SEPA 1TZKA 3L6UA 2P75A 2O6LA 3KTAA 5TY0A 1XVUA 4L5JA 4H27A 3T5BA 4BNYA 3DMTA 2DCUA 1N2SA 1RRMA 1SPKA 3GFQA 4NX2A 2B21A 3QYGB 1TUEA 1GCQA 4PW0A 5FBQB 3T61A 2KT1A 4FTWA 5AI9A 1ZSGA 1FUYB 2Z08A 1J90A 1NVGA 1FUEA 2YXYA 2X53S 4DKXA 4KGVB 1SOMA 1GQRA 3KL4A 2VH5R 3CCSQ 1T5BA 1X80B 4C89A 3WLAA 5JYEA 1HRKA 4W8HA 5H82A 3EIWA 3GRUA 16PKA 4M1TA 4TKVB 3UZUA 2WMNB 4RACA 4CT4B 1SBHA 4EJMA 4YXWA 2DYKA 3DPIA 5KCHA 6GPBA 3AG6A 1FSSA 4AY4A 1TH7A 1GA1A 4C92E 5LL6S 1P0FA 1V7PC 4Y92A 2V4MA 1RHKA 3R20A 3G7NA 4MLPA 2QYZA 1ECCA 4NV0A 5CXXA 5KJCA 2ZZNA 3GLHB 4E11A 4EHBA 5B2FA 2JCVA 3PX3A 1Q82R 1SRMA 3JWEA 4K9LA 3I39X 4ER0A 4ZGBA 4OPMA 5DYTA 4DJEC 1ODLA 1F06A 1PJ2A 3B2EA 5GOTA 2H4ZA 4UUQA 1HXHA 3V5NA 3PJEA 5AVUA 1ZHOA 1WAMA 1G8SA 4OU5A 4EYOA 1DXHA 2PMDA 4TL7A 3ZDEA 4DY4A 1KU0A 1ORRA 3QJYA 1H8EA 1V1JA 1V9LA 2OECA 2ZJ3A 4J0CA 3CESA 4YP0A 1OH7A 4EKGA 3IELA 1FB5A 1ZD2P 1VQLT 2VJJA 1RHJA 5HDQA 5D7UA 1RC0A 2C1XA 4OHPA 4X54A 4KQJA 3AYZB 1JRLA 1KH3A 3G2PA 4LVCA 2G1AA 2IXTA 4D2IA 4R1LA 3NASA 5BQFA 6NULA 5CU7A 4CFYA 4KE6A 3SF8A 1PR1A 1PYGA 3OBYA 3LVFO 2JIOA 1IJFA 1XVTA 4LHEA 4X8HA 4LXCA 4M75F 4OMOA 1J39A 1L8OA 3GNTA 5B4UA 3MMPA 2ZU6A 3WDKA 5TMPA 4G0VA 4F3KA 1X13A 4NPAA 3VPCA 3W8DA 2XU8A 2YMLA 3EC1A 3QKUA 3PPIA 3N8KA 2NU8A 5B1DA 3KT3A 4CV3A 3WQBA 3E5NA 4F4DA 3T3NA 1JB9A 4JR2A 4E47A 1SK8A 2AXNA 3DNPA 2B4QA 4EYQA 1U8TA 5JPCA 4Q9DA 1YHQB 4E2XA 3F6RA 3EXG2 5CMLA 3NPMA 3X28B 4C7VA 2NYVA 4PZCA 5LKAA 2HDHA 3NHWA 2WSEE 4P36A 4WA7A 3V4LA 1EUZA 2YUQA 2GD0A 2J07A 3RIYA 3G49A 1P6XA 1YJ9T 1LY1A 1Z7BA 2EF0A 3MPOA 5REQB 3VH2A 3U4QA 5JZOA 2C0IA 3MTDA 3B9BA 1QVGP 1KE2A 4TPKA 3U4HA 4I5EA 3GLGE 2YVUA 5IYZB 1MZVA 1Z5ZA 2OG2A 4G2NA 4P2NA 1GR1A 4LDAA 5JATA 2GKSA 1WDWB 1BQ3A 3CLSC 4V3CA 4FFPA 2EJWA 1QTQA 3AERA 3OPXA 4CGZA 3A5ZB 2BIFA 1FTNA 2HA3A 4WN9A 1RWKA 4K88A 2AX4A 1M0TA 4X7BA 5AI4A 5C3UA 4UEQA 4PO3X 2F3RA 2J85A 3NRBA 4KMMA 4HOYA 3UXYA 2A5YB 1JQDA 2D0PB 2V97A 4XX0A 3H2JA 1B6SA 1JI3A 3VTFA 3PGGA 1C7IA 1PLJA 4FKMA 4FE7A 4FYYA 5F33A 2OTLT 4COKA 1ZBXA 2Q6VA 4ITUA 1MNQA 4EMKC 4MRSA 1FNSA 2GLUA 5DW0A 3HKEA 2ZJFA 2C97A 3E5RA 4PAQA 2VV5A 4CVNA 4A4GA 1UBGA 1M1NB 2CT4A 2UYGA 3SX4A 4FYHA 3FAKA 4L27A 4RCBA 5DYWA 3HHPA 3ZCTA 4CRWB 2IGTA 1RAGB 2NVWA 1PHTA 4I8IA 5TT0A 3RSSA 2V6MA 4EQZA 4Y0NA 1CJKC 3F98A 3MWLA 2UYYA 2WYWA 3TGPA 4PU0A 2E4AA 1QB8A 1X92A 2YYYA 3GAAA 2GZMA 3KJIA 4M22A 4OM7A 3RU7A 2ZZQA 2ZROA 3OSUA 4FQ5A 2I3ZA 2ZFUA 3SX2A 3UKJA 3C5EA 2RHWA 3OCUA 3ADOA 1G3YA 3JCMV 2OMKA 3BCSA 3L2WA 4XCQA 3NIBA 2BDUA 2PCLA 1I2AA 3AEKB 4X63A 1ZX6A 5H3HA 3RK1A 3EXHC 1L5SA 5D01A 4MUEA 2OOKA 3FMVA 5EUMA 4GD3Q 1UBJS 1YZ3A 1DBSA 4C7XA 4E7HA 1UFFA 4B6RA 3EPHA 2AE1A 1SUAA 1PL0A 3PA2A 2BLLA 2XXJA 3G5TA 1W2WB 2L8DA 4AECA 4NYMR 3ZI4A 2NSLA 1S2DA 2WF6A 2EQBA 5JH7A 7MHTA 4NL4H 1YJBA 2D5CA 1JJIA 4KNVA 5BSGA 1G2OA 2WJIA 5EMKA 3CF2A 5TQ2B 3TTVA 1AXEA 4NEHB 4RPIA 5JSYA 2PY6A 5ITSA 2IYTA 1K8YB 1SBTA 3C85A 5DM0A 1S4QA 4CMAA 1NYGA 1ZGCA 2MWMA 4YJFB 3SHQA 1HC7A 1GZ7A 1OI1A 5F23A 3RSZA 4HNRA 2PMBA 2VL7A 2ADMA 3RFXA 4J0GA 4K9SA 1G9SA 4C92B 4G6IA 4HAOA 1H0KA 1UDRA 3H9BA 5B1YA 3TLGB 3FOZA 2CCGA 3KELA 1GNLA 4PYQA 3R5KA 3IYLW 1F2TB 2Q9BA 4B81A 3BM5A 1IN6A 2CLLB 2FF5A 1MP0A 3E9QA 4MWTA 5CNKA 5AKIA 5HBRA 4K5QA 4M1QA 3N6RA 3O5ZA 1XMQB 1YFZA 1WLYA 2HQ1A 2RKWA 5FROA 2FYTA 2Y3IA 1NVFA 4J3NA 1QGOA 3OCXA 2CDTA 2XMPA 1ECLA 3H4MA 4MYSA 3COSA 2ANCA 4UCXA 1C50A 1JFFB 5DI9A 4QUDA 4GGOA 2XKBA 2BGKA 3SYRA 3B3JA 3QYAA 4X61A 1RM0A 3UJCA 2JGLA 4QEZA 1DFGA 1CUVA 2X1MA 5CXSA 1JDTA 2K87A 2PUOB 1YNSA 3K0BA 5C31A 3WIVA 3ADDA 1JZQA 1CETA 1ILWA 3EDYA 2AG0A 3SEMA 3E9FA 1RAAB 4GLKA 1BEUB 1GZ4A 2R62A 3HA5A 3HKDA 3MTQA 1VQLQ 1L5FA 1TIPA 4R1TA 5F7XA 4J2TA 4WNAB 1VP3A 1Z73A 3HBFA 4FUTA 1FMVA 1Z5VA 5HCKA 4N0PA 4FR5A 4XOUA 5DNYB 3IAHA 3BCFA 2BFBA 4EPWA 1L7VC 2RGNC 4M9UA 2JD2A 4F7UG 1WOSA 5COBA 4LSZA 3GLVA 1PLKA 2ZJAA 1XTIA 4H7PA 4J90A 1GUDA 5TEWA 3TO5A 2VUSA 4GXRA 2R8EA 1SVSA 4GPEA 2BMJA 1J2YA 2HI0A 2JBAB 2O06A 3G5AA 3G82C 3HCBA 4FS3A 1WBBA 4DQLA 1AWWA 2HJ9A 4G67A 1UD8A 1GUYA 1US8B 1ZWLA 4N12A 4PVCA 4XYBA 4QUKA 3U4MA 4HTAA 1NBME 4HAIA 5JAUA 4E30A 1SB8A 3NPFA 1X1DA 1ZIOA 2Q3MA 1V5IA 2QSYA 4IIJF 5TGZA 2H9AA 2WZNA 4EB3A 3UA6A 4JOQA 1RWPA 1UL1X 1MHNA 1F9EA 4GVLA 1A9XB 3WRVA 3WIEA 3GR6A 5J5VA 3PA1A 1IXZA 4G41A 1NEGA 2PZAA 4K9DA 4A2CA 4B79A 3CYFA 1TX4B 2GOYA 3O8QB 3SC4A 4BNNA 3GJXC 2RI3A 1DAHA 4ESOA 2EG5A 2EWMA 4EBBA 1KJ9A 1WU8A 4WKNA 5CT8A 1AUPA 1EA5A 4LRQA 4PJLA 2A5GA 1DUVG 2P7IA 2WD8A 3QA3E 4Y2JA 1OQKA 5CXQA 1VLOA 2D3NA 4WOJA 3KT8A 5DX0A 5BSHA 1JLHA 4RTMA 4E1VA 3KSZO 1E3WA 2OM6A 4UM9D 3U3DA 4BCDA 1BJKA 1WCXA 1W4RA 3BJEA 1T5DX 2R6JA 3U61B 2DAPA 5L8RE 2NXJA 2J4CA 1A9ZA 1KQ1A 5A4DA 5LPNA 2O48X 1YI8A 3ESCA 5ALDA 5TLSA 3CW2A 4G4IA 1MB4A 2EAYA 1WXFA 1X7ZB 3LX6A 4ZOEA 4CNQA 3RNOA 1RYDA 3NGXA 5EXDA 5JFOA 2WZDA 4CEHB 1WUJS 4D7AA 1V2HE 4JKYA 4IP0A 2OGTA 2G1PA 4F92B 4QGAA 1K8QA 2D8JA 2C98A 5A0FA 2HCFA 3ZDBA 4I66A 3TCNA 4PNZA 1DJPA 3V7CA 3PUVA 5DDIP 4QZVA 4RHEA 4O02B 1CD5A 4RVOA 2Y1KA 2YN0A 4GL4A 3STYA 1UQTA 2BEKA 3CQ9A 1ZOLA 2BFWA 3D8SA 4XGQA 4C1BA 4KAAA 5EJ2A 1KO7A 2HRBA 2VEOA 2PSEA 1T4BA 1YZYA 3O4HA 4HCBA 4O4LF 3B1VA 4ZZ2A 4CQMB 3EXHA 3KQOA 2AWOA 4TUYB 2Z95A 4ZQCB 4DDKA 4IEEA 3ULRB 1PRYA 2O3UA 4ZGEB 3MUOA 1EM6A 1BVHA 2IZ5A 4KBYA 3SC3A 4BVBA 3AFGA 4MWGA 1KY2A 1OJ7A 4N3BA 1KAOA 3OA2A 1U0LA 3FPFA 3KBOA 4X1YB 3T9AA 3TW0A 4LJ9A 4M7DB 3RYFB 3IULA 2IIBA 1ZX1A 3AHIA 5DMXA 2WAOA 2AOXA 1C3XA 4IO1A 3OAAA 3TOCA 1W8DA 4P81A 3P8HA 1U5CA 4A8TA 2EV9A 3HB7A 4JUAA 3OH8A 5KOJB 2P6PA 4JA2A 4IGIA 3WYNA 2V0NA 1TJYA 1CY8A 3LQFA 3TEFA 4PPQA 1DEAA 3LWHA 5LYJF 1MCZA 1T0IA 3D7NA 3ZK7A 3IIKA 3SXUB 4BE2A 3DONA 1IK6A 1NX9A 1Y3BE 2CSXA 2IF2A 4EM6A 1BNCA 2ZE7A 2DXBA 2N1MA 1YGPA 2ZETA 5K1ZA 1D2MA 4DMRA 3THYB 4RZ2A 5GY7A 5ALVA 2CT3A 4N3NA 1EKXA 2R1VA 3IIMA 4RQTA 2X0DA 3ZWKA 4CG3A 4WZBE 3QOFA 4A26A 5CFQA 1WUHS 4Q5IA 4UNQA 4CODB 5C5CA 4RY2A 4C4RA 3JS5A 2AXPA 3TL3A 4DA6A 5KO2A 5BNZA 4FU6A 2J6IA 4MR9B 2WMDA 4MRMB 5FWNA 1Y42X 3ZGVA 3TNYA 4NL2A 1V11A 4P4LA 1OBOA 2PMEA 5CD9A 1Z6QA 1PGQA 2CDCA 1SCAA 3P9PA 1TEZA 1CRLA 1MQ9A 4B7XA 3DCJA 4PYNA 3NETA 3WYFA 3LQEA 1GFZA 1BIFA 1VI2A 3OAAD 3OW2B 2OQRA 4XWYA 3R5HA 4XB1A 5M3BA 2OXIA 4QYTA 5DM4A 3SP1A 3TD6A 3QLVA 1NW5A 4KVFA 2XGGA 1N8SA 1EK2A 4BNJA 4YECA 1G9TA 2YV4A 1RRPA 2XCRB 4WERA 4MWCA 5AK5A 5AOBA 4YQEA 3I0ZA 4A3SA 3LUGA 4EUEA 2F1OA 4NCAA 3FROA 3GPCA 2BZYA 4D99A 1XCOA 5EHNA 5M2QA 2XPCA 2P11A 4QGFA 1ZM9A 4MMYB 1G55A 4REOA 3SAJA 4DR7B 4XKJA 2P4SA 4MS3A 2C5LA 1AWXA 1FU7A 3PB3A 5AVRA 3OT1B 1D7AA 1M1GA 2YQ4A 3CUSA 1K8RA 3K96A 1W94A 1MNEA 2X1LA 5JSKA 2ZWMA 3RV3A 1JSZA 3HA3A 3CPEA 5M29A 5JTUA 1GYQA 4B3BA 8ATCB 2K5LA 4FD2A 4M7AE 2FNAA 1NMYA 2LXNA 3D4BA 1VQ5A 3OIWA 3EMDA 4GOXA 2ODBA 4NK4A 4GT1A 3GIBA 2IXBA 4QGHA 4E2YA 3GRZA 1IC6A 3ZWXA 4EUSA 4WKOA 4F04A 1UP7A 2CDAA 3NTLA 4C0AC 5BRJA 2Q6KA 3AHUA 2QLLA 3C74A 3LHFA 1RAHB 1ESDA 2H0QA 3L7MA 2WD7B 4L6AA 3T41A 2P6NA 4EYSA 1ORWA 3QENA 2O59A 3EF3A 3TPFA 1UBOS 1P9OA 4AZWA 1I81A 3K70C 2HBRA 4CIAA 5CAIA 1JNXX 4LDNA 3WL3A 1GZHB 3CLKA 3GXOA 1FJHA 4NYIR 2OD7A 1YTLA 4XVQA 2FU5C 3VM6A 1WZUA 1ESMA 1BS2A 4F16A 5KAMA 2YZGA 1JQ3A 2MOXA 4ND8A 4W7IA 1CRQA 2I6UA 4MR7A 4M75G 1WXDA 2VYND 3HFOA 1J2UA 2ZYIA 3G2LA 3KM0A 3OJ0A 4L7QA 3QKRA 4LRXA 1I5LA 4H60A 3M0UA 1F1BA 5LJ5f 4J9BA 2I8CA 2CE7A 2QUKA 1X8LA 1PS0A 1XZFA 2YQ5A 4HXFB 3BTSA 4Q9IA 2GXUA 4YXFA 1H1TA 4Q4HA 1XDWA 2MSWA 1M90R 3TM5A 1AT1B 3CURA 3UN1A 2R751 4GPD1 2OX7A 4RHFA 4HFRA 4P92A 4KR3A 5DP1A 1QKKA 2SCUA 4PXYA 4HQRA 5GADl 3ROMA 5FV4A 3VKGA 1LJUA 4LD9K 2G1JA 3KQQA 4AKTA 2QNRA 2FZEA 2DZ9A 1MGOA 3WYAA 4IMRA 2FMTA 3SQXA 4W7SA 1T2EA 4EI9A 4F84A 5B4TA 1QG4A 3GU3A 1N3LA 5DNEA 3T7SA 1TDJA 3CR3C 3VR4D 4XN3A 2CKKA 2Z58A 5I9MA 5FFFA 4EW1A 4QUZA 3CWCA 1MQSA 1UH5A 4JL5A 4LPKA 4MRNA 2GZ2A 4F4HA 3DTNA 3AOEC 4NP6A 4TTVA 5JG7A 3TQHA 5K6AC 2O19A 1EHYA 1ZUIA 2ZRNA 2FHDA 4JGBA 4RAOA 3PYXA 3IEPA 1KIAA 3U2QA 1WJRA 1D2CA 1KQSB 1OKKD 1YIJA 1Y3AA 3CJTA 4FC7A 4I1OA 4YJGA 4D8VA 5ICSA 5CM9C 2X5KO 2QF7A 2X0EA 4Y6SA 3ZE7A 2WB4A 2CY0A 3E8MA 2CMHA 5DHUA 4KRTA 2WFLB 3OTIA 2CP5A 4Q7LA 1NVVQ 4YCDA 1JMVA 5AVJA 1QU3A 3L1KA 1BX0A 1F4PA 1FPMA 2PS3A 3OIGA 3I2JA 1PG5A 4MKGA 4U7JA 4B3GA 5FPPA 1TMGE 1NBEB 5FPSA 4MKFA 4KZPA 1RLIA 1X9IA 1U0OC 2I6SA 3WO0A 1DKPA 2DHQA 4U2KA 5IEJA 4DNPA 1Z4NA 4J0JA 3SQLA 4M4SA 2V7XA 2GZHA 3A2LA 1XCPA 4NU5A 4HT8A 3DSRA 4RMJA 1PG0A 4NZOA 2DBZA 5BXQC 1LQ2A 1AO3A 5F5NA 2QA5A 3IE1A 1FFEA 2FFAA 4Q3KA 1P9RA 4AZ0A 3F73A 1OV6A 5I7UA 3SHTA 3N5KA 4O2BF 8ADHA 1EFNA 3FUXA 3I9OA 4BGDA 1IXYA 2DP4E 3F67A 3IPYA 5ALPA 3RS0A 3G0OA 2IBSA 4L0QA 3REOA 1ZVQA 2N75A 4OOFA 5E2IA 5JMWA 5AVQA 1T9DA 2VHCA 3M6IA 3FCEA 5F1KA 4N3GA 2PYDA 1JECA 3R0XA 3WK4A 2IW3A 2OR3A 3CNNA 1RXIA 3CX4A 4KR0A 1JIXA 3I92A 3YASA 1J0DA 3CRNA 1S1MA 3ZS9A 1MOSA 3URMA 2PA3A 5CDGA 1P17A 1Q95G 2OC4A 4EJSB 1S8FA 1ZK4A 4QGBA 4GZLA 4PKCC 1ISMA 5FOWA 2IXDA 2AQIA 2X4WA 2JZNA 3B3GA 3W4JA 3C0CA 2ECOA 3AQIA 3KXIA 3PDIA 5DEOA 4Z4ZA 4LDUA 1E5QA 1QRDA 5J4KA 4YJ2B 1U9JA 1L9XA 3G05A 4M7DC 2YVLA 4JUBA 4X8LA 3OYEA 1K4KA 1JEQA 6LDHA 2AMJA 2KB0A 2WYVA 1HRDA 3PE0A 4K9MA 4AFSC 3QLEA 4NCKA 3TRHA 1CS4C 2WI8A 1ISRA 1N92A 1WXEA 2C9CA 2WF9A 2K6GA 2X77A 1Q1ZA 2ZSAA 4WK2B 2ZWVA 2FPUA 1EIZA 1E1MA 3K0AA 4DLXA 5HW0A 2B4TO 4BX9A 3CX6A 3BC9A 4ZDWA 2Z0WA 3HGMA 4I6JA 3NIDB 3C5VA 3OX1A 1HFJA 2R44A 1QX3A 3EXIA 5KPDA 1N32B 1JQLB 3KZVA 2ICAA 1WQ7A 2J5BA 1MMAA 3UEOA 2Q62A 5FLEX 3BY7A 4MPTA 4MPPA 4G1MB 1MEOA 3H3XA 1DJOA 3LC2O 1Q0TA 2RMKA 2Z2KA 3CH7A 3TOVA 2C7RA 4M78B 3BGWA 1YS6A 3CTPA 1Y96A 4TTSA 4MUYA 1P5JA 4PAGA 1N1EA 3CMAB 2DWUA 5KOIA 4DYVA 1S1CA 3E61A 3V00A 2BEWB 4XIFA 4EUKA 5KCZA 4MULA 1CJTC 1CFJA 2GYUA 1C7JA 1JEQB 3MCVA 5I2SA 1PV1A 2OBXA 4YAJA 2C0PA 1E9EA 4CF4A 1X74A 4XPIB 5LU8A 2KPOA 2QSZA 2WJAA 3QQ5A 2GFHA 3NHLA 3I5UA 3QXCA 4NOLA 3AUXA 4Z4CA 1AN9A 3D7KA 2QWXA 1DC6A 3K1ZA 4KH1A 4IIXA 3B48A 4J6EA 2ENUA 3R9WA 3E9GA 4EL5A 3IAS1 2I66A 3TSYA 1T4DA 1U1EA 3ZPXA 2R3SA 2I71A 2CHGA 5GIPE 4M8SA 4AFZC 4NQZA 2Q1XA 1BG6A 4BQSA 1ZY2A 2I4IA 2X9LA 2NO4A 3IMFA 3LY5A 1DQNA 3ZV4A 2ZEJA 3W6ZA 2IYFA 3GHHA 3KSUA 5DGTA 4CIXA 5TMBA 1T91A 2VBIA 4PO9A 5EAIA 3WGLA 1NNLA 4P7KA 1OWLA 3AR5A 5CBPB 3A9UA 4PJOD 1VLVA 4DWJA 2P9YA 1WJQA 3D2CA 3NUQA 4IIGA 2EYZA 2B30A 3WLNA 4M1MA 2PGXA 3IKTA 2HREA 1V43A 1GT6A 4UFPA 3DE2X 2WJZB 3O84A 4P80A 1Q81U 1E62A 3H4VA 4LJLA 5CDTA 4CETA 5IKPA 1FF9A 4NEQA 4ZEWA 2HF8A 3FFTA 2FRWA 1HV8A 3IJPA 2EX4A 4TS9A 2WB2A 3O8QA 3Q2OA 3T5AA 2YMQA 2GHIA 2GQFA 2GF9A 1ZR2A 1NHGA 2AVNA 1N2CB 1G2PA 2H06A 1TRHA 2R4TA 3VU9B 3ZEIA 3V55A 1SC3A 2VJCA 3EAFA 2OMEA 1U8CB 4TXMA 3UPDA 1AUQA 2WAYA 3KJFA 4TOIA 2AE2A 2I8LA 4WDQA 1D0IA 1ID1A 1S2LA 2WAXA 3QI7A 4YC7A 1A9RA 1N2OA 1VCHA 3E9YA 2AZVA 1P9WA 2JHCA 3D6UA 5FA8A 5FWYB 3I2GA 4YJ3A 2DG2A 4OPOA 1IQ0A 5HOQA 4EX6A 2XBUA 1OGIA 4YJGB 4DR5B 1O8CA 2P68A 3LD9A 1RCFA 3BJRA 3OBBA 1NMSA 5G1NA 1LCKA 2FL7A 1P45A 3UC5A 3T5GA 2PGNA 2CZCA 3LLUA 3WSVA 4EYEA 1M5TA 2IIQA 3SOZA 4DVJA 4IURA 1U2SA 4Z4SA 2B5VA 5LWQA 3ZWBA 1K9AA 4ME7A 4L22A 3ED5A 4PJOA 4OOSA 2FY8A 2P6UA 3KTFA 5JADA 1AE1A 1XNRB 4ZZ0A 4LQLA 2D59A 2WTXA 1WZIA 2DLPA 2FWRA 4MCHA 3I55Q 4A63B 1IVNA 4GBQA 2QI9C 2XYHA 4X1KA 5F1PA 4ZI3A 3SVLA 2ZOSA 4RZ3A 2AXEA 1JG3A 1D7OA 2GUGA 4UVGA 1HYHA 4KVZA 4DQXA 4M0EA 4CIDA 1N6IA 4DSTA 2XYRA 4F38A 3NANA 4H1HA 5AT1A 2OKCA 2RCYA 4F11A 4I1UA 1KP2A 2IELA 3CCEB 4P3YA 2I6QA 4GR4A 4Q4HB 4QYWA 5DTIA 3RAFC 2CCJA 4HN4B 3M3PA 5GANe 4OQFA 5L3ZA 3ZWCA 3UHOA 3H2HA 3KC2A 4WEOA 4ON9A 3ZI0A 2FJUA 3BMXA 3FFWA 4IHKA 4KSBA 2E85A 2O57A 4YQFA 2WHQA 4DKJA 2C04A 2R8OA 3JQGA 4OO3A 3K20A 4JB0A 3SWNC 1BJRE 1H05A 1T0PA 1XOIA 3KKEA 2BKLA 4HZUB 2DJIA 1P3Y1 3QEMA 3EEOA 1P1FA 3REAB 3HKBA 2F1IA 2J05A 3ZUGA 1U0JA 1V2GA 2DXUA 2GPJA 5E7JA 1W36D 4YLYA 4NENA 5C8VA 3CZ5A 1LDYA 1SIUA 2DFDA 4IIJB 3ZJYA 3LDUA 3LNNA 3WB9A 3IVXA 3T94A 4BE0A 1SFRA 3MBIA 3NFCA 1MVNA 4IHJA 2D0NA 1G7TA 7GPBA 1U0SY 5HVNA 3CFYA 1Q7YC 1P7CA 2XQIA 1DIRA 3UJ6A 1KD1C 5JO9A 2XXAA 3GT3A 2CL0X 4RO0A 4CQLA 2DILA 1MFPA 1WY5A 1M34E 2DPMA 2JJ9A 3AGPA 4CF3A 4AG1C 1YV9A 3TSWA 1P91A 1NE2A 4HDAA 5KTPA 2ZE8A 3PJRA 2LW7A 3W3AD 3BILA 2XY4A 4B1FA 4XEUA 3ZHRA 1FXUA 3GEHA 4LJYA 4FFOA 3B70A 3QELB 5CB6A 2NTEA 3FPGA 4YRFA 2JCXA 2EGGA 1YZVA 5ECYA 3CCCA 4A1OA 2FWPA 4B35A 2HU2A 3VPDA 4B6QA 2W4MA 4GEGA 3GUYA 4HJRA 1NOJA 3UICA 4NCXA 4AWAA 4PGGA 1KY4A 1LPBB 3L7AA 3CF4G 3R4CA 2Z9CA 1X1QA 4L8LA 5LJLA 3NB0A 5J2UA 1HQDA 3H75A 1UBFA 2A1TR 3DDUA 3T12A 4BNDA 5JZSA 2CP6A 2GFIA 3R0VA 1E7RA 1GU0A 1BXGA 3H1BA 4RNDB 1GDTA 1CIPA 2RGDA 1U9ZA 1CZKA 1YHZA 3D0OA 4FMBB 4QLAA 3KV1A 3VZPA 4LOAA 4ED9A 4K86A 3GZNB 4CMIB 1V47A 4DSZA 2CYBA 3ZU6A 1ULHA 3JALA 4NZPA 4DQUA 1RAGA 1XRSB 3WGTA 2CH4A 2MR5A 4QTXA 1N8RR 1RBQA 4BV9A 3FBTA 1C1DB 3SYMA 3ZWDA 2PVSA 4YMIA 1M1NA 4HRYA 4P5NA 4OYRA 1DZIA 4PK4A 4PL6A 4KTVE 4LSWA 4LYFA 4QOJA 2PZGA 2ZTLA 5LVAA 5I7WA 4JYZA 2R57A 2CF5A 2ZQ5A 1BOOA 3LXUX 1V11B 2AX3A 4H7JA 2DB3A 2KVOA 1HFWA 2MYTA 3O2NA 3K94A 1MO2A 3E22A 1PCXA 4F4CA 1NUAA 3CCRA 4M6WB 2HHJA 2VRNA 3I4CA 4LF9B 1G20E 1VXOA 3BMOB 4F7UE 2DL8A 2GTPA 4I8XA 4JLOA 4X90A 3ROZA 2EDAA 3X2FA 4F1WA 1P4MA 4DIOA 4PPNA 3FUTA 4EEKA 2ZYAA 3BHJA 5AUOB 3AR8A 4TKUB 3I83A 3NHPA 2EG9A 4OMUA 4Y7CA 3KYDB 2IXFA 3C3PA 1OX4B 3BL6A 5AXBA 4F72A 1I2ZA 2ZKIA 3WIUA 1C9DB 2ET6A 3NEAA 3RANA 1Q12A 3S55A 4A0SA 1OZ3A 4B31A 4GO1A 4CDRA 4QO8A 3HB5X 1CHDA 1JEYA 4K7JA 2XZDA 3ZWMA 5KNDD 3DCNA 2BZSA 1RKXA 1I01A 3DOEA 3ZHUA 1G1AA 5AWFC 1V6AA 3VS6A 1G60A 2X9QA 3DD5A 3HCPA 5T4EA 4QVDA 1DKNA 1KO8A 1AKWA 2XUKA 3JCMg 4ND4A 1R8SA 4L4ZA 5A88A 3A6LA 1NTOA 5FP0A 2VSXA 3EAEA 5LZ9A 4ZZ1A 1UMCA 3GJ6A 1QDUA 5EJ4A 4L9AA 4QT7A 1NRJB 3AEZA 4ER6A 3TX2A 1RMYA 4EF5A 5IF9A 2W00A 3L18A 3FHTA 3ASVA 4U7HA 4CUZA 4DMLA 1YQDA 2F7SA 2CGHA 4EHNA 1AMNA 1R0BA 5T4FA 1AOJA 5GAMf 2QX9A 3IP7A 1LNQA 3E4DA 3ABZA 4P4UA 4D74A 3EDCA 1E79D 1CG6A 3BOSA 3EXHB 2J5KA 4URWR 3VC1A 1X1AA 1JJAA 3FTQA 4UNSA 2WWYA 5YASA 4DCCA 2F90A 3EUFA 5ELXA 2OFXA 1ORTA 3LT4A 2A8YA 1VYHA 5ALLA 1DTWA 4LD6A 3G5UA 4FM9A 2X7HA 5DASA 3V6MA 1MGQA 2QZZA 2Q8PA 1OX9A 3GBQA 2QR2A 3ZX5A 2JS0A 2A7QA 4ZD6A 4XI9A 1MX5A 1WHSA 1YL5A 1WPRA 3HCRA 4RIGA 3FWZA 1LX6A 1YQGA 2MHCA 1JH8A 2I7XA 3GEPA 3W6NA 2DFNA 4AT1A 2IBTA 4M9QA 5JNRA 4RS3A 3PMTA 2EVRA 2REQA 1PO7A 3IRUA 1D1BA 1A27A 1AK2A 4XNFA 1M33A 2J3EA 2IYNA 2JKYA 1ZXXA 2P9HA 3HCNA 3MS7A 1JIIA 3MD9A 4FKZA 3KR9A 3U7IA 4AO6A 5B4VA 4KSCA 4RK5A 4RDXA 1KZ9A 2ZBPA 2LCLA 1QVFA 1XZNA 3PENA 2QN9A 3EHDA 2DLNA 5DRTA 1OT3A 2OORA 3QUAA 3TSCA 1YI2T 1NUHA 3K2QA 1VLMA 2O2OA 3P7MA 4O59O 2Q9UA 5LYJB 1TK9A 2BH9A 1THTA 4L08A 4Y7DA 1YR7A 1MRSA 4NNPA 1UOPA 1IZ8A 1OXMA 1HGXA 1XEWX 1VYTA 2GRUA 3S29A 5C9ZA 2B83A 2YHSA 1EGVB 4GGMX 4DIUA 3WQSB 3EB9A 3EXEA 4HXYA 5M34A 4CPDA 4NJEB 1W6RA 3SS7X 1T0JB 4XLCA 2HU7A 3PFCA 5FNVB 1E3LA 1T9AA 3PVDA 2HO5A 4CU2A 5FHRA 5JVDA 1M6VA 1YRBA 2PJDA 3IQHX 3KOZA 4JS0A 3KBGA 2WVAA 2I80A 2XR1A 3EIOA 3LPNA 4XIYA 5LSAA 1QORA 1CEEA 2F9FA 4GI1A 4PGOA 5LP6B 4IGKA 1P44A 1QQTA 3SIPA 5LU9A 3UTCA 3VJMA 3W2EA 1VQMT 1YSCA 2JCBA 1OXTA 4X6XA 1QV7A 4RHXA 1Z3IX 3G0CA 3P4UA 3SE0A 4RL6A 4CCYB 4EGFA 1C8KA 1UFRA 1YQUA 2J3JA 2AG1A 2ZWOA 4P7JA 5FOSA 3IP6A 4AICA 4EHKA 2LJ3A 1R8OB 4WX2B 1NG2A 3PGA1 1FFWA 2JN0A 3JD4A 4B3FX 3MT7A 2GCOB 2YR0A 3PC2A 2RPNA 4J4HA 2AT1A 4RFVA 3RVRA 3WFZA 2GZRA 3BJIC 4RDLA 1G5HA 4P3OA 3RRNA 3VV0A 2CXOA 3QK7A 4AB1A 1R0YA 4X1OA 4Y1EA 2MWOA 2ECPA 2VF4X 2O2EA 3ZE1B 3UB4A 1RXWA 3VPSA 4DC0A 2DJQA 1M74A 3IHLA 1HEUA 4L50A 5J1SB 2V4ZA 2BTEA 1H3NA 1PVOA 2ZRQA 3F7NA 1XZMA 2VTBB 1R6AA 4A91A 2GPNA 4RZHA 4QG3A 4DZTA 1E61A 3K6SB 1AHIA 1RAFB 1E7YA 1VQKQ 1H0SA 1SCBA 5F1YA 2BYTA 3N5BB 2AUTA 4O4HF 3RRMA 1RZVA 4NZNA 4R8LA 1X01A 4BUJA 4EG1A 2BISA 2CVQA 3IUSA 5AFSA 1A9YA 2QZ4A 2ADFA 4ZIRA 2LP4Y 2CUNA 1K08A 4IILA 1X6BA 4MWSA 4EG6A 4RY8A 4ZI2A 1RJ9B 2LTAA 3P1JA 2IHKA 3TIXB 1KZGB 1KC8U 1F2TA 4AWXA 4ENTA 5FBWB 4TMWA 1VKHA 1WZNA 4E03A 1M6HA 1G63A 1OROA 3EGCA 8OHMA 3A3KA 3W3AH 2H2HA 3PFHA 1G6KA 4GVPA 3BS4A 4BMSA 2IV3A 1GLGA 2B8AA 2XHEA 2ZIVB 2FUKA 4U9HS 4GWKA 2ZBEA 3HYSA 1RTKA 3FVVA 4DMHA 1JEEA 1W25A 1I0LA 1A2OA 3VRYA 1UZUA 4GMHA 3UJ7A 4DARA 4DMUB 3DTVB 1WUYA 2A6PA 1DIAA 4MV0A 4F8JA 1YBHA 4YI5A 1FDOA 4BMVA 3ZJTA 3JB9H 3K6SA 1RDFA 2HIHA 2ED0A 3HJNA 4HK4A 4WXHA 4C2UA 2PU9B 1BMTA 1GL6A 3AO0B 5DTQA 1NX6A 3CPXA 3ANYB 1HMPA 1XF9A 3E3OA 4DXAA 2J5QA 3HRIA 4EHFA 1U63A 3PT5A 4PNHA 3NHUA 1WMFA 1MA3A 4KQHA 4RD2A 3WBKA 1S0UA 1Q17A 2DPXA 4GW3A 5FAKA 2VG8A 4AS2A 3QPHA 1JW9B 1KVRA 4EPRA 5GAMd 2ZYHA 1K7YA 2XTMA 1JTFA 3BEOA 4GOLD 4JRPA 4PJOB 2IPXA 3QLJA 3D8UA 3GARA 4RA6B 2I65A 2ZR9A 5ICGA 4LXYA 1IUOA 3CCVT 3LQ6A 1P80A 5JCOA 4AJPA 3OU6A 2WF7A 3WGYA 3ER0A 2RA2A 3B7GA 3GVKA 1XEWY 1DS6A 4JASB 3BORA 2H8KA 3H8VA 3G17A 2V7BA 5AXCA 4JLUA 2KW5A 2X86A 3K15A 3TGWA 2ZT8A 4JLJA 1KAQA 1J8YF 1FC0A 2C3MA 2OL4A 2EZ4A 3A58B 1P4GA 3CX7A 4QQ6A 2J9RA 5DTRA 4ZAYA 5JSUA 1OBHA 2X1HA 1U3OA 1ZYUA 1IULA 1E7WA 4JI5B 4AVYA 4RJLA 3L2VA 1WEHA 4JNCA 4QELA 2H4FA 1IHPA 2H65A 3PTZA 2CZ1B 1VRWA 4M86A 1RABA 4MYRA 4QRHA 4IDGA 5CH8A 5EPEA 2B20A 4ZTBA 4IIJA 1LPAB 4V2UA 4MW6A 1U5AA 1F12A 4ZGJB 2H3HA 3NVAA 1OD6A 4BQPA 2DBQA 5EHIA 1O4VA 2PZBA 4HWKA 5U1PA 4UFNA 2WJJA 2OM2A 2C8LA 4J16A 4DDWA 2V96A 4BWYA 3RF7A 1OSNA 1VE5A 1VHWA 4I7EA 4Q4DA 2H85A 5CH5A 3QLUC 4A8HA 2X0FA 1OULA 2PR2A 1VQNQ 2D62A 2QGFA 3ZWAA 1IHDA 2V3CC 3Q3CA 4E31A 4X7MA 1L6RA 3EQ2A 5REQA 4NF2A 2Q0QA 3SF0A 3HA2A 5F4ZA 4EI7A 1R9GA 1BKDR 3BBPA 3I0NA 4AUMA 4IIMA 2RDMA 5EPUA 3HC7A 1Y8ZA 3LO5A 3FB4A 3L7BA 1QMCA 1AK9A 2A7XA 3FX2A 5EIXA 3W7VA 1H5NA 3DFFA 4HX5A 2O0HA 3ZHYA 5F7ZA 3LQKA 4OOVA 3TQOA 2RKBA 2C9DA 4D97A 5A3VA 2AYZA 4R1QA 1H3ZA 1UXJA 4C0DB 2W6ID 2NU8B 2GLTA 3OA0A 3RO7A 3OURA 5AW7A 1O3YA 3AINA 4KPUA 2QTWB 3KU4A 3ABRB 5DYGA 3DKVA 1TFRA 3B5JA 5DNVA 1ADFA 2YJZA 5K2MA 3KUUA 1GKUB 1PWXA 1RQGA 4MB2A 4ZHQA 3EFOA 4R5MA 1J07A 4JBXA 2KYRA 2R87A 3WLFA 1F20A 5G02A 5J63A 3V48A 3ENVA 1W46A 1P7VA 1W49A 1RYBA 2GTIA 2HL6A 5IM5A 4IBOA 4RIEA 4YJ3B 9ABPA 1A9OA 1QF9A 1L5NA 3RBZA 4C6RA 3OEEA 2QI9F 5GM1A 4Z1OA 4RJJA 4Z89A 3M2TA 1VHEA 1KZHA 5FBLB 13PKA 1WYXA 2DPPB 2DRKA 3B5EA 2XGSA 1WD5A 4HWTA 1D2NA 3HB0A 5FPHA 1P2DA 1NPRA 1KI4A 1FVFA 2OILA 5EC8A 4AKEA 5HUJA 1SG9A 4X65B 2WU1A 3GW8A 2EGCA 5JV5A 1N6OA 3H7AA 1YE3A 4I4IA 5FWAA 1J7KA 3W05A 1XMIA 3KTDA 5E2AA 1M7BA 3FOAA 3TL2A 1T9GS 1YKGA 2CVFA 3Q3GE 4FEEA 2JIRA 4GMKA 1NN3A 3WNQA 4D57A 2AOTB 1A72A 1UD4A 1CJSA 2I7VA 1L9KA 2XB6A 1PZEA 2YL2A 3B3AA 4GPIB 4JELA 5EIAA 1VQ8B 5JD5A 1R3DA 2XCIA 4CM3A 4R6XA 2J3LA 1TYBE 3HI4A 4B82A 3LC7O 4NLLA 3PPXA 1X2BA 3O91A 4QJ3A 1UAAA 2IZZA 1MUUA 2HZBA 3ANTA 3K70B 1I10A 3GJTA 3OIUA 2CLFB 5BSYA 2XNCA 4JJEA 3CCUT 4G97A 3CSUA 1AHNA 1F8YA 3PK0A 4HF7A 4E5VA 1U3WA 2JIZD 1BRTA 1TU3A 2XMBA 3F7OA 2O4CA 5EZQA 1NVAA 1GCUA 4KWTA 3FOEC 4U6SA 3CNQS 4EFDA 1R3UA 2EP5A 1AA9A