2F19L

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEHEDIATYFCQQGSTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f19L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f19L01
5D2LA 2EXYD 1DQJA 4LIQL 5F7LB 5CIPA 5D8JH 5FYJH 4PJ8A 3JSSA 1F6AB 2FHCA 1HZHH 3MJ7A 2GFBB 5DA4A 3V0AC 5I71C 2FB4H 4J7RA 3IFNH 5CEYA 5DLML 2N4IA 4E41B 5I6XC 4UQ2A 1OAUL 5I18H 1I7RA 3QXAB 1GGIL 4QRRE 2AERT 2CMRH 5IIEB 1N0XH 1F6LL 3QFDA 1KN4H 3O6MH 2FYYA 3SDXF 4HHAA 1WBYA 5C9KA 1TZHB 2A9MH 1A4JA 4MX7A 5I8EB 1WEJL 4MQXC 2EO1A 3PWJA 1OSPH 1HCFX 4P0DA 4POYA 3VRIB 4MA3B 2YD6A 3UBXA 4EJ1C 3KPRE 4UILL 4UB0L 3P4LA 5GHWL 1FGVH 3RIFK 4C58B 3Q3GB 1A14L 2Q1EA 4WVRA 3SN6N 4OBRA 1TCRB 5JW4M 5LCVL 1TCMA 4B7LA 2NY0D 2P24A 1CXEA 1NCWL 5J57B 5E6ID 5F93C 4RA3A 3M45A 1RI8A 3E2HB 4NBYB 2CDFB 1AR1C 2AGJH 3GNML 3FT2B 2EYRB 4U0QB 1II4E 2DQCL 4ZSOE 3FFCD 4WFHE 5BV7C 4O2FA 4XP4L 5CINL 4D0CB 5L9DH 3U7YL 3IB4A 2P44B 4KVCH 2OSLB 4ORZC 1QBLL 1JF5A 5DJ6A 2XWTA 4MQTB 4KKLD 3G9VA 3VE0A 4DFIA 4L5FH 1YNKH 5JUEH 4N1HB 4FFZH 2KKQA 3MFGB 1VFAB 5DQJA 4WV1B 4XP6L 3CFJB 3S88L 5D6DC 3ZTJG 2B1HH 1OAUH 2XI9A 4LU5L 4Q6IB 1M7XA 1MI5E 1RK0A 1CE1H 5I1LB 3MLTA 32C2B 3REWA 4EDXA 1J0JA 2QQKL 2IPKB 3NIGF 4XZUB 2G75A 3GMQB 3P2TA 2LTQB 1X3DA 1AC6A 4M7KL 1WEJH 4NWTL 4Q2ZB 1W2KT 1KGCE 1NAMA 2P45B 1UKSA 4Z78B 1NCAL 5EO0A 3L5WA 4LSUH 3OPZL 1G7MA 1Z9MA 1WSST 4F7MA 3P4OA 1KXTB 4N8VB 4R7NB 3E2HC 4M7JL 2P5WE 5I74B 1G9EA 1MAMH 3BGMA 3B5HA 3ZT7A 1Y18A 3QHZH 3NZ8B 1I3GL 4DN4H 1J10A 3X3GH 3WKMH 4P2YA 3WLWD 2FEDC 3QG6B 1T5WA 4Y0GA 4XP4H 4OZGA 1DZBA 1OGAA 3QIWD 1S7XB 3RPIA 3WBDA 4U1NA 2AVGA 4IRSA 2DI9A 3MGTB 5I66A 1CGSH 5C8JA 5FO7A 2OR9L 1RAMA 1NUDA 5DFVD 1H15B 3GSXB 5EH1A 4UINH 1BBJB 4JO4H 2JK5B 3CFCL 4HXAH 5DRNB 1BECA 5JPMB 4RGNC 2M26A 2JELL 1DQLH 5CKAA 4EEEA 5D71H 3MRLB 1FORH 3Q1SL 5ESVA 3QCTL 3QJFB 4XPTL 1XF4B 4ZUWB 5TE7H 3PWLB 4LHJB 1FFOB 2H45A 1CZ8L 1DSFH 1R3LB 5CJQH 5DJZB 3IDNB 3MXWH 5DEFA 3TN0C 3BN9C 2XN9D 2HRPH 3DMMB 1KBGH 1NMCC 1TPXC 4JG0L 2ESVA 1JGVH 4KK9C 2YRZA 1DUZB 1I8KB 1A7NH 1YN7B 4UV4H 2V2WB 5KSAC 3BMWA 1QRNA 4HS3B 5GRJL 4G6KL 2JJTA 4O9HL 2ZUXA 2X41A 4M6OH 4PG9B 2B0SH 5E00B 1Z3GH 5JDSB 3CFEA 3IXAA 3IU4H 3HI5L 2VDOH 4ODSL 5DMJB 3GGWA 4GKSB 3X3GL 3KDMB 4S1DC 2OMBA 4IOSD 1LGVA 1QFPA 3QEQA 1CF8H 4K71B 1JTPA 4KKAC 1JHTA 4LRIC 3DOSA 1KSRA 5I1DA 2ICWB 3QNZB 5F9WB 3WNKA 3Q5YA 2WUCL 1EGJL 1L6XA 3ARTA 2P7TA 4Y8AA 3WXVH 4DKFH 3AM8A 4LL9A 2P47B 4KC3B 2VLJB 3GMPA 3VFVB 2JCCA 2I60L 2K3TA 2XWBB 3PV6B 3HMXH 4W70A 4ENEC 5FCUH 2DLFL 2ZUVA 3OMZA 1P7KB 2X4TB 3WHXB 3STZA 1HHIA 3CMGA 4R8WH 1HEZB 4JLRB 4HKBB 1NGYA 4L4TD 4KKCC 1RPQA 3LVEA 3HZKA 3HCVA 5LJYH 1IL1A 3QR2A 2BCKA 1JYWA 3ILQC 4UBDC 1CZ8H 5I1KL 1ULVA 2WIIB 4LCIH 3ZT6A 3T0XA 1ZWIB 1G9NC 4O2EB 3GSOB 2DBLL 1Q9OB 5E2TL 1NEZB 3S9DB 2D9CA 3N1FC 3BKCH 4M4PA 2Q76A 4XI5C 1KFAL 1DDHA 1QP1A 2YSSA 3S96A 1HE7A 4FMKA 1GIGH 3BT2H 2CLVB 1J1PL 1TVBB 4BYHA 2HVJA 5EZOH 1C08B 3HS0A 3SGJC 3KLSA 4Z0XA 4MQ7A 5I1HL 5JA9A 2FIRT 2B4CC 4P9HL 4NZJA 3C5SB 5FDWB 4WW1B 4EOWH 1BM3H 3ARGD 4OUOA 3BXNB 3TN0D 4DTGH 4JR9L 1ACYH 1M7DB 4JO3L 3NCFB 2Q87A 2BVUA 4P23C 1X5IA 3KLAA 4X7CC 5CEZE 2YUXA 4Y2OA 4XAKE 3O0RH 4Z95H 3MODH 2QLVB 4YJZL 3VWJA 2I07B 3B9VA 1QLRA 1YEIL 4H20H 2XXMB 1QQDA 1YY8B 1LNUA 1D5IH 1P6FA 2AEPH 5DUBA 1IGCL 1HNFA 1C1EL 4XHQA 2J2ZA 2FLRT 2VMFA 3MRRB 5DJ8A 8CGTA 1K9TA 5CZVL 5J12C 1OB1B 3RZWA 2Y06L 4TTDD 3GMMB 1LK2A 2W0LA 5IKCB 4X4XB 1RIUH 3EYUH 3HUJF 3EGSB 4GLRH 2C1OB 4OD2B 2R9HC 2ICES 4K8RL 4GRWB 4NZUL 1SJEB 3GSVB 1MJ7H 4NC1E 3NFSH 5DSCB 1DQDL 3QIUA 1T3FA 5ALCL 1CXKA 5IQ7L 1NJ9B 5E5MB 5ICZA 1Z5LB 1HSAA 2C9AA 1ADQL 3UX9B 1JPFA 3UDWA 3QUYD 3H9SB 2EYTB 3MCKA 3ME0A 4AEHH 5EBGA 3QPXL 1D6EA 1P4BH 4KI5C 1LEIA 3EYQD 3JWOL 2PYFB 5JORB 4EI5B 1JYVA 3QEQE 1DANU 3P0YH 3TVMD 3CU1A 1E4XI 4HULB 5CWSB 4M6NL 3UAJD 4WO4D 2XICA 2ICCA 2I9TA 3BP6A 3OJ2C 5H35B 5T1LD 5C0JA 4E5XB 3MA9H 2V7HB 1XR8B 1EBPA 3W9EA 4XNUH 1RK0B 3GSRA 3SDYL 1ONQB 3F62A 3P9MA 1BFVL 1TFHA 3L95A 3SDDC 4FN0A 3RPKA 4LLWB 4LRNH 1CTOA 5J13B 4OGYL 4GMTL 3RWDA 3V4UL 3JWDH 4UUJA 5J6GA 2D7PA 2DQJL 3DX6B 3NIDF 1YEHH 3VGAB 1JGUH 1OW0A 2XQBH 3LOWA 1UWGH 4M4RA 3VFRA 3ABZA 1DE4B 1L7IL 2X89D 1MCKA 3BPNC 3GMLA 3FQNA 4ZYKB 3ARUA 3ULUD 2YZ1A 2W38A 3V95A 1I7ZA 1T0NB 4U6YB 3ARDC 4CRPA 1HXMA 1F4WH 4WHDA 1AO7A 4QXTB 4XPBH 5E2UL 2ITDA 1AC0A 1PSKH 5T1MA 1NLDL 4WEMB 3QPQD 4U31A 4OFKA 5HTSA 4I2XA 3S35X 3TWCH 1T1WA 3TO4B 4D0BA 1I85A 3ZDXF 2X09A 4KJQC 4F57H 1WWBX 2DIBA 3L9RA 5IMKA 3S35H 2AJVH 4LEOA 1F4AA 4I9WE 3X11B 2NW2B 2V7NA 2UUDH 4M3KB 4PD4J 4NT6B 3N50A 3UXFA 1FFNB 1H15A 1NUFA 3S5LA 3GO1H 4YHOH 4ELKB 4NQEB 3S37L 1HQRB 4QHNB 4X7EC 5TQ2L 1BBDH 2X42A 3I6GA 5ESVB 3H3PH 3GSWB 3UTQB 1H3PL 2R1WB 1BFVH 1JCKA 3TCXA 5F1KC 2XTJC 1MWAL 1CT8B 4IOIB 5MEPA 2LU3A 4EZMA 2HMIC 2CGRL 3BIBX 1FG9C 3M17B 4NUJA 4AZ8A 4BUHA 2BVYA 2XQBL 4OZHA 2Z4QB 2H2PC 2LTQC 5DHYB 4FFZL 3ROOA 5E9DA 1GGUA 1S7RB 3O2DL 3C60B 1ZT1B 3QUYB 4HF5H 4KGJA 1XGRA 2DB8A 4Q6IC 3G6JE 4JFFB 3KS0J 4Y16D 4AY0A 1FJ1B 4HUWB 2FEEL 1UACL 3LB6C 3A6BL 2O5ZH 3GJFK 3U9PL 1QFHA 3DURA 3MRBA 5E6YA 4TPRL 2VN7A 5DC9B 1FBIL 1VA9A 2J88L 4ODXB 3GJFA 3QO0B 2A1WL 1JHLL 4OLZH 5HGHB 1LO0L 2ZUQB 1JF1B 2GJ6B 4GRMA 2ADGA 3W2DL 2G60L 4N90D 3SKOB 4IRZH 1QSEA 3EJJX 2X2YA 3K8LA 3OXRA 2EYSA 1N2RA 2ENYA 1UCBH 3GO1L 1EGJA 1FYTD 3WDHA 4XNQA 4JO1H 1RZJL 4R4FH 1H3GA 2X4QB 1J7VR 4X6BA 1IGIH 5CJ5A 3H3KA 1DLFL 4PGBA 3VFWB 5I9QC 1RHHB 3O45B 3KG5A 5ECJE 3QCUH 4DEPB 4LSVL 3GI8H 5IWLC 1J05A 3MA7A 3QEUB 2NY0C 3TM6A 4HKJA 1S9WB 4Z18A 5K9JH 1DP0A 4S0SD 4NKQB 3HLAA 1X5GA 4R7DB 1QG3A 3UDWC 3VXUD 2W07A 3BQUD 3NFSL 3G6JF 4U1HB 2Y1VA 4P59L 3X3FH 4JFQA 1OGTB 2YEZA 4JO4L 3K2MC 2F74A 4X0KB 1UQSA 1KCRH 3TT3L 2BVQA 2I9LB 1IGYB 1J0IA 5IVXB 2HN7B 4PY7B 5IP4A 5EZLA 1R6VA 3PQYB 4YAQA 2IADA 2AS5M 4XPAH 5DD0L 3NOIA 4PJ7B 4FQJH 1BIIB 3V5HB 5C0NC 5DD3L 1G7LB 2AXFA 3P4NB 1RY7B 4NRZB 2F58L 4WY7H 2FX7L 2W9LA 1S7TB 3V6OC 1KCVH 2YPLB 1IQDB 2ZJSL 2J8UA 5IB4A 4L4VA 3LS4L 4QTIH 1OAXL 4P23B 1NGPL 5DRWB 1NDGA 1Q9LB 4LAQL 4YHLL 2A0LD 3VFSB 5KG9A 3CD4A 1FZJA 2FO1A 1MELA 5MP6H 4OQ1A 2ZPKL 4P2OC 2Q8AL 3IFLL 1T21B 3FQTB 2MOVA 4OGYH 1KCSH 1ROWA 2AJYL 1MF2H 4POZD 3MRPB 3S3PA 3W11C 4EI5D 3QHFL 4JPWL 1KTDB 5HYFA 1IGFH 4X7TA 2D03L 2V17H 5IBLD 3KPSD 1QD0A 1UWGL 2WQ8A 4KDVA 3IAQA 5DDHA 2Y5TA 1I9JL 4CN4A 3SGJA 32C2A 4KROD 4KKLC 5FDYA 4ODVH 3HTLX 2LABA 1EO8H 2CIIA 5I2IA 3DUSA 1F4WL 2DM3A 4HWBH 3HZYA 4YEFA 2H3NA 2XA8L 2AI0H 3VXMA 3DVNB 4YQXL 3L5WB 3QDAA 5LG1A 1OF2A 3C08L 5IHZA 3UYOD 4HIJB 3BW9A 1YEKH 5T3ZH 2R1XB 4MCYA 2IFFL 2QEJA 2P24B 3HE6C 5B3JF 2F58H 4JVWA 1CGSL 3HRZA 5ESQB 1JMZA 4N0RA 3I6LD 1RUPL 5KANG 5DJXB 3NFPB 4PJ7F 3UTZA 2EDJA 2O5YL 4HX1B 4OZIB 4XNXL 4MAYB 1OAQL 1QR1A 5IB1A 3U6RA 3WSQH 2I07A 1MHCB 4FG6C 4U33A 2FECI 1S7XA 3RPIB 2HFFB 1H3PH 2GCYA 3Q0HA 3BVNA 5I1HH 4PJXE 1V7NH 5EO9A 3QQ9D 5D72L 3MFFA 1XIWD 4U7MA 3VU2A 2IF7A 1ZGLM 1P53A 2P1YA 3PP4H 12E8H 3QZWG 3B9KA 4OKVA 1SHMA 2V17L 2RGSA 3EBAA 1G7IB 1NGZB 2VZTA 2Y07L 5EO1B 4KTDH 1JV5B 1I9JH 4NQED 2PO6D 4G6KH 1AXSB 3SQBA 2C4FT 5K9OB 2ILLA 4HJJL 2DQHH 2WQRA 3N9GL 4QRSA 5DJZA 4R2GB 3O6FA 4C59B 4PJIB 1I9IH 1L6ZA 3FO1B 3SDAB 2NY2C 1X5XA 4KK6D 3RVTD 5ISZD 5GSRA 5GGSY 4POZC 1ZANL 3KYKH 2CKBA 2V2WA 1MCOH 2XQYG 1JNNH 3VFOA 3OB8A 5JLZB 35C8L 5AUMB 4NO0B 4H26B 1V7MH 2FZ3B 2PXYD 1I8LC 2VSDA 3D85B 2DLIA 2H9GA 5DQDH 3C5JB 3QNXA 3QYCA 1DEEB 5D7JD 3TZVC 5CCKL 5BV7L 5KVFH 2Z91A 4NZUH 4MA1C 4MNGA 5E5RB 3DV4A 2HH0H 2Q6WB 4F3FA 1EHXA 3G08A 1JPST 1FFQA 2R23B 2O61B 1YNTB 1T5WB 2EH7L 1S78D 1FYHB 3GSWA 1U6AL 4PGZA 1I8MA 5F6IB 2ORBH 2XWJA 1XIWA 3RWDB 3WL9A 4HIIB 3QCUL 3FB7A 3WUWB 4Y1AE 3BFOA 2E8YA 5C3LD 1KJVB 4LBEA 1CL7L 4U05A 4OIIL 3PHQA 4QCIA 4JM2D 4YXLL 2NLJA 1FFRA 4X6CB 4ESKA 3S3SA 3WNPA 3F7RA 2CLRB 5D1XA 4XPHL 3FB5A 4HIHA 5CIPH 1FPTL 4KTYA 2EDKA 3FTGA 2FX9H 3CSYB 3QJFA 1QTYT 4P4RB 5AG8A 4JGUA 1TQBC 5B39A 3VFNB 1MFNA 2D7TL 3IDXL 4CVUA 5ANME 1KN2H 2EC8A 3K1KC 4MNQD 1INQA 4YDVA 4JDTH 4RAVA 3EDFA 2HTLC 3CAFA 3MNWB 4UU9B 3P30L 3H6JA 1NFIB 3PF2A 1ACYL 5BRZE 3KLHC 3VWKC 3MRLA 2DQJH 3V4PL 5D8JL 4OKDA 1JGUL 5HYQA 3V2AR 3OPZH 3TGXA 3OKDB 2OL3B 5EU6D 4HLZH 4P46C 3RWEA 4J6RL 3NIGE 1U92A 4AIZA 4X80H 3FHAA 1VGEH 4HK0A 4QHKI 3B6SB 3L1OH 1K8DB 4KUZH 3TCLB 4M7LT 2FJHA 3HZVB 2PTTB 4NQDD 4WTWA 5E8NA 4AL8L 4Y4FB 3LSOA 5FKPB 4GXUM 3KNBA 4OZHE 3D85D 3HAEA 3PWJB 4X6EB 2VITB 5C70A 4F57L 2VIRB 3EFFB 5GHWH 1YMMD 4PJFB 3B3IB 4OF5A 1JHTB 1GC1C 4W6XB 5D1ZA 3HUJA 1KPVB 4P2RE 2AK4E 3V5KA 1T1YA 5ALCH 1BFTA 1XGRB 1JI1A 4XC3L 2DKUA 5L88H 4NOFA 4WTZA 3ROLA 3FQRB 1YEEL 1MJ8L 1IGTA 3ARZA 1J0ZA 1FV1B 4GAYA 4NN5B 1KN2L 3LN9A 1FORL 1BZQK 4C56A 5C0CE 4G7VH 5KTEH 4YQXH 4GJTB 4JFDD 2WM0A 4M1DH 5IFJA 3T65B 3GSVA 4X8XA 5DC0A 1EVTC 4KK9D 2F8XC 1QSEB 4PJ5A 1NDMB 1V3KA 4FQLL 1Z0MA 5AYQA 1QSFD 1IILE 1CYGA 1B6UA 4N9GA 4P23A 3VJ6A 4K2UL 2Q3ZA 4XP6H 4LK4A 4HUMB 4EQ3A 4UOW1 1URLA 4XXCA 4FABH 1J1OH 1G6VK 3OKMB 4OTXH 2X4QA 5A2LH 3CCHA 3EFDH 2B0SL 4KUZL 4OIAA 4UT7H 2NY1D 4EI5A 5B38G 3VFTA 3EYVA 5HYJD 3SKMA 4EDXB 1MPAH 1ZAGA 1HHJA 3ILQD 3B5TA 3CFDB 1Q72H 4UDUB 3JWDL 3DX8A 2D4FA 1OT1A 4TUOB 1NUNB 3AS1A 5EOQH 5HPOA 1AY1L 4N0FA 3BWUC 5IV2A 1B0RB 2VLKA 3RY4A 3QAZC 2VE6B 1WFNA 3DBXA 3L3HB 2OQJB 1LP9F 2C5DC 4JFZL 1M7DA 4ZQKA 4AJ0A 3VRJA 4JO1L 2YHGA 3TJEH 4N8CL 2P5EE 3ZLQC 3T3ME 5FKAB 3X13A 3GMMA 4GG6B 4JZJC 4NYLA 5IJVB 1IGJA 3KPLB 4OZGE 2A6IB 1KXQE 3HRZB 1L0YA 1IM3A 2VL5A 3OKKA 5E2TH 1I7ZB 5E4IA 4M93C 1SMOA 2YWYA 3DGGB 1FNAA 3ARVA 2C4FU 1QR1B 3OB0K 4S1QL 1NCUA 1ZA3A 4M62H 1RUQL 5TQ2H 2ZCHL 1EAPB 5C7XH 2AV1A 2ADIB 1B4RA 4KJWD 2IWGA 3EJYC 2F54A 2Z0BA 4HFWB 4C57C 3NPSB 4N5ED 1T21A 3MLTB 4XCFH 5EU5A 1DLHA 25C8H 1Q8MA 3PL6A 4WJ5B 4L4VE 4YXLH 3TJHD 3C5ZA 3BP6B 4JO3H 3QAZB 3O81A 5F7MC 3T2NH 4WGWB 1NCCL 1OARL 3RVVC 5KS9B 1XCTB 2KUTA 3QDJD 4JRYD 5D7KD 4OZHF 4ODTL 4LAQH 4NHUA 4UDTA 2DYPD 3BJ91 3UTSA 5LWYL 4XVTH 3FAXA 3NZ8A 4IOIA 2R2BA 4OI9A 3RGVC 3PP3K 5D7LD 1H3VA 1LEKA 3VXMB 2J88H 2EXWC 2X5PA 4MSWB 5ISZE 3SHSA 5H35A 2FEEI 1MCBA 4HUXB 3LKQA 1JHKH 1ONQA 1KYOK 3QNZA 2E7BA 4JKKA 4Z7VB 4WNQA 5E8PA 3O3AB 5ITFA 4LLWA 3QB7C 4PTUB 2P7TB 1IQWH 4H1LG 4WDIA 2A77H 4HX1A 4NOBA 1DBML 4G8GA 4MAYA 3AXLB 4CAGA 1YPZE 2LVCA 1VGEL 3MV9B 3QISA 1NUGA 1RVFH 3QFJA 4JY6B 4R8WL 5IVZA 1INEL 4J3SA 4D3CL 3NCJH 4TSAH 4M5ZH 4XCYB 3DROA 4JJ5A 3L3GB 4OSUH 1UA6L 1L9NA 3PJSB 4GW5B 1RJCA 1KCUH 4HPYL 4K7FB 5C08E 1V3LA 1HXMB 4RIRA 1HILA 4L3AA 4NKMB 1WIUA 4E0RB 4F9PA 2WINB 2VUYA 3KGRA 1ZLSH 1S5HA 3AS3A 1GOGA 2Z31A 2IAMD 2AK4B 3VFNA 2MJWA 1XT5A 2CLVA 5C0ND 1IAMA 5DZNA 4WU5A 4OD3H 5KSAB 1EHNA 4JHAL 3N0PB 1T20A 3S5LB 2EE3A 4PD4K 3QH3B 1AGDB 1PJ9A 1V7NL 3DMMC 4IIQB 2BFVH 2BVPA 3QDME 5EORL 3PGFL 4MHHG 3BPOB 3QDJB 43CAA 3ROOB 4M6ML 2ITCB 3KWWA 1S7RA 3GI9H 4FNLH 1JP5A 2R1WA 2VLMD 3CH1A 3FOMA 1RZGA 5INDB 3BN9D 3T0VA 4RMWA 1JZ4A 4P5TA 3SKNB 4N0CC 5E99L 5TF1H 3QFJD 1BIIA 2VLJE 3LAFA 5D7LB 5MP6L 3QUXA 4Q58C 4X5LA 2CO6B 1U91A 3DETC 1QPXA 5JQ6H 4XH2B 4NNXA 2HJFB 1D5IL 2VXSL 1F8TL 1A4KA 2XTJB 3OKNB 5B8CC 3CXDH 3I9GH 3WKML 4PJCE 3QG7L 1D9KB 4L4VB 4LOUC 3TBWB 5CP7B 3DX9B 4D8PB 3DIFA 5CZVH 4GAJL 1XEDA 1EAJA 3D2UD 4LSTL 4PBWD 1MCEA 4GXVH 4QHMA 1RIUL 2XYCA 4DKEL 1Q9OA 4YBLB 2Z93B 4JGMA 3D0LB 2HT2D 1A7RH 1LEGA 3LRSA 3ARYA 3EOAB 4Y89A 5I76A 1T1YB 3HFMH 2E9BA 5C3TA 1IZKA 4NQCB 3H42H 2A6DA 3QIUB 4WEUD 4R26H 1H3TA 1YJDL 1KCKA 3FO9A 4DCQA 2A73A 1BMGA 1MFAH 2VLKD 3JV4A 5BZDA 3Q1SH 4JRYA 4JFDE 5HSFA 4LGSB 3H3PL 4EVNA 2CDGB 5EBLA 1JZ3A 1IAOA 1NMBH 1U42A 4F7PB 1MHEB 2DS4A 1B6DA 2VXVH 3VXUE 3TNMB 4UZGA 1F90L 4IDJL 4RFOL 1IGYA 3RVXD 1FO0A 5E8EA 5FHBH 3MV9D 1VACA 5CWSA 3C6LA 5ICXB 3F7YA 2H26A 2J8HA 4MDJA 2I9TB 1G9MH 1MQ8A 3CVHL 4TUJA 2YC1B 2CJUH 4FQXD 3TCLA 1FL5A 3SPVA 3FJTA 1QYGH 4TPRH 2BJML 1AGEB 4L8SC 3RTQA 4NN6B 3PP4L 5F7NC 4QXWA 3TV3H 3D2UA 1LO0H 4I77H 2F19L 2OCFD 1A9EA 2R56L 4K3HA 5FM5O 3VCLA 4F7TA 5HVHC 2ZCKL 4HV8A 3MNZB 5C08D 2XZCL 1M7IB 4NPYB 3MSPA 5HYSA 3B3IA 4JFXA 1CLZL 3OJDA 4NQTA 2OQJA 4Y5YA 1ZK9A 1I7TB 5C09D 2HFFA 5M94B 2I60H 4XCCL 5DSCA 4X99A 5GS0D 1AQDB 4QF1A 2PXYB 4IOFD 1KTDA 4U6YA 1PW3A 5DMKB 5FKAA 4OLVH 1T04A 1WFUA 5LGHL 4QHUA 5ETUB 3MACH 5F3BA 5HY9A 1DLFH 1N5YH 2WBWB 5JPNB 5FK9A 3LN4A 5JZ7D 3GIZH 5AZ2H 2KQNA 5T5NG 4BQ8A 1MLCB 4PLJC 4ZUTB 1MI5B 2V7NB 4YE4L 5L6YH 4N68A 4NT6A 4LMQE 3VJ6B 1FNSH 5D2NC 1FFNA 1R3HB 2LU7A 2HH0L 2QBWA 1U3JA 4D2NA 2DMCA 3AAZA 1JGEA 1E6OH 5IBLC 4NUGL 1CGVA 3ZDYE 3QBTB 3QUKA 2YMXH 5DVNA 1O7SA 1AGBA 1F42A 2EDEA 2EIBA 5K59E 1HHJB 1MHHA 5DO2C 1DEEA 4I0PA 1WIPA 1AR1D 2WV3A 4K23L 4OIIH 5F88A 1KYOJ 2DQGL 2H32H 4IRJA 1MHPH 5IUSA 2PYEB 2AJXH 3OKEB 3UCRA 2W0PA 3WNMA 3D87B 5C71A 3VFRB 5GISH 4G8FA 1ZLVK 1JNLH 4N8VG 4NHUB 4ZUSB 1UYWL 2CH8A 3VFMB 4HF5L 5EO9B 3QUMH 4YEEA 3BP7A 4TVPH 3E3QE 5JOPE 1YYLL 3MRJA 5F89A 2R69L 2BNQA 4JQXA 4MS8D 1KTLB 3SE4A 2UZXB 3FO0L 1YEIH 4H20L 3ARBB 2VABB 3UTPE 1KELL 1N7ML 4G43B 3P73A 3PWPA 3FB5B 5B39G 1NCDH 3EHBC 1FVCA 5CP3A 5HGHA 4HIEB 4WUUE 2ADGB 4WUUA 2GCYB 5C09B 5CMAA 1XIWC 3NN8B 3ZL4H 1DBBL 2Z92B 2GTWB 3SJVB 2GK2A 3FO1A 4Y5XA 5MHSE 4WW2A 2BP3A 5CD3A 4FQXB 4YPGB 2W60B 4UMGA 3BGAA 1OP3K 1CN4A 2F5BH 3CSPA 2CKBB 5TDPB 3FN0L 4PB9L 5I15L 4FZ8L 3EO0A 3IFOB 4OZGF 4MWFA 4X7DC 1YMMB 1VEPA 1JN6A 4KRMB 1NC2A 1LE9B 2GITA 2DQCH 1MI5D 2AAVA 2YRPA 4KY1L 4GFTB 3U7YH 2MPAH 4WUKL 3RWEB 5T3ZE 3GKWL 4R4NC 4RFEA 2XOTA 1AIFB 4S1SH 3ARPA 2BK8A 3ARED 1QEWA 3OAZH 3FCTA 1B90A 1CDIA 2FJHB 5I1CH 1HWGB 5AUMA 4HG4K 4M5YH 5E9DB 2C7UA 1KCRL 2EDHA 4JPIB 4AIOA 4NSKA 1QSED 4YO0B 3FFCB 2HN7A 3T3PE 4OUUB 1T20B 4CNIA 2ZNXA 5IEHB 3QQ9C 4LLDB 4LCUB 5D4QA 1JZ5A 2VKXA 2Y5EA 5KSUA 5FUZH 1HH6A 2XRAH 1KPVA 4F15C 2XQYK 5CFHA 1R3KB 1KCVL 3DO3A 4S2SB 3JV6B 3RVUD 3C09C 2NR6D 8FABA 1OAXH 5GRVK 1QA9B 2W91A 3TIDB 2Y07H 3MRNB 1QSFA 4BZ1H 3VFSA 1GCFA 2CJUL 3GM8A 3WCYA 4HIHB 4FQQA 1BQHB 4MDIB 4MB4A 2PYEE 3CSYA 1RZ8B 4M7LL 4QY8B 4DN4L 4EIGB 3QDJE 1Q72L 3O8XD 4ELMA 5GGTL 4MJ6B 2FIKA 1A1NA 3IVKA 3JTTB 5IMLB 4JZNB 1OCWH 4KQ3H 1BZ9A 1L9MA 4R0LA 1F5WA 5DK2A 1FIGH 3HLAB 4PJAB 4XWGL 3QWOA 4FRWA 3H7BA 5BV7H 2AQ2A 2V9RA 3WYRA 1NBYA 1ZOXA 5I30L 4O58H 43C9A 1IEHA 5MEOA 3SO3B 3DX8B 4LLAA 1L4IA 1BVLB 2R2EB 4HUNB 5C08A 3KPSA 5EUKB 3RA7L 3CUPB 1U6AH 3QCTH 3R0MA 5C0FA 1J8HD 5EBLB 1U8KA 3QUMA 3DBXB 4FFVC 1J88A 2B5IC 3CSBA 3HZVA 3WDJA 4MD0B 2F9BT 3LQAC 3ROLB 2ADFH 3VGFA 3RQ3A 4UIKH 3H0TA 3VXNA 5DJXA 3I50L 3MV9E 4Q9QL 4MA8L 2FX9L 4S1RL 3CSGA 4S10A 1ORQB 3NCYS 4LASH 3V6FA 3VXRE 5DJ2B 4JKWA 3IETA 4RA0C 4GT7A 2ZCHH 3D39E 4U3XA 1MHCA 3P9WB 4JB9H 4F2MA 3C5ZD 1VFBB 1Z0NA 1AGCA 2IPUG 3QULA 4Z7VE 5D1ZD 2FH6A 2PW2A 2DKSA 3ZE2F 5C9JB 5DF0A 1RMFL 5GGRA 5HJ3A 5FO9A 3CLEL 5EORH 2WBJC 5CLTA 1U3HC 3C8KB 2FO4B 2MQ0A 3T2NL 4QHMB 2V2TA 2ZKHH 1S7QA 1KJ3L 3RI5K 3VXMD 2CXGA 1T5XA 1MVUB 5GISL 1ZGLP 1QKZL 2BC4A 3NACH 3T2PA 4CBPA 4R9HA 1UZ6F 3PDOB 4TSBL 4JAMA 1KJ2L 1XR9A 2A73B 2E7HA 4XVJL 1U8MB 4H88L 1GSMA 4IMKA 4N0FB 4RWHA 4DQOL 3KPPA 1HQ4B 4PJIF 4NCC2 3I9GL 5A3IC 4NRYB 4F7PA 4HIJA 3RAJL 1J1XL 3F7VA 3NH7L 3EYVB 2VLJD 2IC2A 2OI9C 2X9YA 3INUL 1N5AB 5IFAL 3PHOB 1FO0B 5E8EB 4HD9A 3VMNA 3RWCA 4G6MH 4JFOA 5B3NA 1TENA 5D5MF 3P4MA 1F45A 4RDQF 2E7LA 4ONHB 3VFUB 4GG6A 3MOQA 4BSWB 2IH3A 4XRCB 4OLXL 5E8OB 5HYEA 4W6WB 4C55A 3F7PC 4D3CH 2YD5A 3KPQB 3CFBA 3VFPA 1MAJA 3U1SH 3UROR 3QFDB 1CDCA 5A16B 2ARJQ 4XPGH 3SE8H 4D9RD 2IPTH 1BX2B 3TBTB 3EIFA 3PGCB 4WI6A 4DZBA 1JZ6A 1UXWA 2NXYC 4NKDA 1PQZB 5SX4I 3LDBB 2ED7A 3WFDL 4AMKH 1MFCH 2HFEB 3LH2L 4Y16C 2FL5B 2FX7H 4G6FD 2F53E 1EAPA 4NYLB 1YDPA 3QIBB 1XH3A 5EIVA 4NQXA 5I75C 1VPOL 1HHGA 1A47A 2P8MB 4NO3A 1DFBL 1NANH 4I18A 4QXUH 4WI5A 1OLZA 1Q9KB 1R3IL 5E6IC 3RGVB 5ID1B 5JOFB 3BP7B 1G84A 4LCCA 1WZLA 1A3RH 1AP2B 4B53A 4AM0B 4PJ8C 3SDXA 4GO6B 1WBZA 2ZWLT 4KGLA 4EN3D 4HFUH 3P73B 4P9ML 4RAVB 5CGTA 4O2FB 3U4AA 4CW1A 3QIWB 1QHOA 2GJ6E 1NAKL 1C1EH 2AV1B 2QHLA 3CJJA 4ZPTB 2XPGB 3GMOB 5DFWH 4WRLA 2Z8SA 1ZHNA 4U2YA 2EDWA 1MCPH 2C1PA 2XZCH 5HYQB 2H9GB 5LBSH 5ISZA 5MEQA 4OF8A 2BZDA 4WV1A 3MOAL 3JZ7A 3HG1B 4G8GD 3H9HB 4K7PH 2AJSH 4M61A 3L1OL 3L3DB 3SCMB 2WZPD 2ZUQC 4X4YB 4DAGL 1YEJL 3WUZA 3IU3A 1ZLWK 1V8HA 1ZTXL 1ADQH 5LGHH 3KPRD 4UDTB 1JWSA 5C6WH 2ID5A 1EFXA 2WBJB 3EJZC 3KNBB 1N6QH 2NY5C 3L3KA 4EN3A 1C5BH 1A1OA 5C0CB 5FB8B 3AY4C 5D7LA 5GGUB 2WWMD 3EFFA 1GXEA 5FYKE 4LP4A 1MJJA 4FFWD 5HI5C 1A7RL 4YE4H 4GKNB 2YN3A 1FN4B 1T0MB 2IG2L 3LN5A 1R3IH 1LO5B 1A4KB 2AK1H 3OKNA 3PNWB 3TZVD 4YHPA 4PRPA 4WFHD 3Q48A 3U2SA 3KYMA 1EO5A 3IT8D 1YEEH 2IGFL 1RD6A 3MA9L 4P23D 3WFHB 4OFYA 1YA5A 3I3DA 5JA8B 4CN1A 1IGTB 5LQBH 1TVHB 3MQIA 3HI6L 3RTQD 3W9DA 2DLTA 5ADOH 4LVOC 3C8HA 2X7LB 4E0RA 4XMKH 4L3CA 3UMTA 4FA8A 1OGAB 4OCRL 1NFIA 4QT5A 4HLJA 3WKNA 3QEHB 3KR3H 3MRIA 5M7QA 1IC5L 1P2CA 2P8PA 5BO1H 5FEBA 2ADFL 3W82A 2FD6H 3CFKB 2OK0H 1IKNC 3F65A 5AZEH 2C3HA 4PJBF 5GS2H 4K55A 5CD3B 1L7IH 4FTVB 4WWID 1HXYB 2DJUA 1HOCB 4NZTL 1VB9A 1KG0B 5KW9H 5TDPA 1OTSD 4XTRD 3SGDI 4X7SH 3G04B 5GS3A 2OJEB 1YMMA 2VQTA 5HI4C 3GIVA 2F53B 4P46B 4UBDD 5KS9E 5F21B 2H1PL 4RGOH 4EQ2A 5E8NB 1DQJB 4FQPA 4O5LH 1FNEA 1HKLL 1IKFH 3LIZL 3RBSA 4LDEB 4RISL 3SGEI 4L8SB 3QIBD 2WUBH 3HMWL 3D9AH 4MDJB 3MXVH 2ESVB 3KJ6L 2VIRA 1CI5A 4TUJB 5I75B 3OF6D 4YHKL 1CLZH 2I26N 5CHNA 4QYOA 4LPUA 4PJFA 4TNWK 4DJMA 4BA8A 1QBML 4YX2L 5J89A 5BS0B 3GKZA 1YPZF 5DD5H 3LEYL 1A6UL 3JVGC 2NY7H 3PGDB 5E08H 1HIMH 4TQEH 4ZSOA 4M9PA 4WUUD 3J8F7 2BY1A 1IJ9A 3G5XA 4WIQA 2EDQA 4OSUL 1MFBL 3O3BB 4ZO9A 1OVZA 3QEQB 4QHLA 1KIRB 3MO1A 3RWIB 4LHUD 3C6SA 3RAJH 4NN5C 3GMRA 3M1BB 1K2DA 5TH2B 2MPAL 4WUKH 3FRPG 3VA2C 1TJHL 3SDCC 4PRIA 1H8SA 1AQDA 4R4BA 1LHZA 1FZOB 2R4RL 3G5VA 1IM3B 3OKKB 1YJDC 1QFWH 3SDDD 1I1YA 3DWTA 1KCLA 3GRWA 3DRQA 3MTRA 3HC3L 4I9WD 2GAZA 2MHAA 4XNYH 1YEDB 2HT3C 3I75A 4KVNL 4MMZC 4EVNB 5F7EH 4M5YL 4PP1C 2FBJH 1E27B 3WE6A 1LEGB 2OP4L 5J1AA 1AGCB 3QULB 3HA0A 1BQLH 1FL3B 1JE6A 3VDBA 4ALAH 25C8L 5SX4H 3WJLA 3MBEB 2BCKB 2EDXA 4GG8B 1JMXA 1ZLWH 1ES0B 5H8DA 4XBGA 5ITBH 4PJGE 1TJGH 1VFAA 1UM5H 3RP1A 5HHOD 4X7FC 2OXHA 4IRZL 4OCLC 3MRCA 1CFBA 5DK0B 2EO9A 5DGRA 1FH5H 3UJJH 3VXTB 1XGQA 1A6TB 5D70L 5FFLA 3ULVF 5HXMA 4J6RH 1Q9WB 1IC4H 3BO8B 3RTQB 3UTSB 2R69H 4J3OC 1CDHA 2XKSA 3VRIA 4PRAA 1HIML 4TQEL 4R97C 2R2BB 4L3EE 1FVEB 3UPRB 2UWEA 1U8KB 4UIMB 4HJ0C 3IRPX 3EYFB 3SOBL 1NGXA 2BNUB 2GEEA 2Z8WC 3F7VB 3A0OA 1MJUL 3IS0X 4PJXB 4DK3A 4PB0H 3VFMA 4JFED 2HT2C 4YZFE 3EDKA 2YS4A 5L2JB 2A77L 4KTEH 2NNAA 5GRXG 2CK2A 4QHUB 4X6FA 5ETUA 3UBXB 5F3BB 4JE4B 2B5IB 3FL7A 1IEAB 1RVFL 4F7TB 3R06A 4P2CG 1YEFH 2XN9B 4PJBA 5EWIL 4F9LC 5IF0A 5I15H 4M5ZL 4YWGL 4XNMB 1MFAL 2Z31D 1JFQH 4PJHF 3RZCB 1K5NA 1P7QB 3ZHDA 2PTVA 4AG4H 3WUWG 5BQ7B 3PJSA 4FQJL 1YUHB 2H41A 5FF6A 1UADC 3HE6B 4WCYL 4LGRB 2FO4A 2V2TB 4UT6L 2Z8RA 5IKCA 1BVKB 5KSVA 5F70A 2XG5A 2NTSP 3OHXB 4NCDA 4MWFB 5D9SB 2XZQH 2GT9A 5IB2A 5E4EC 1B0GB 3V0VA 2LFGA 2XG4A 3RIAF 2IGFH 3DMMD 4FABL 5DJ6B 5EN2A 1YC8A 3BD3A 1SBSL 3JTSA 2D31A 3ULSA 5LVEA 5KSAA 1NMCB 2D3VA 3PXHA 4Z7OF 1WBZB 3E1F1 5C0BE 3FCTB 1U3HB 1UCTA 2BVPB 1YQVH 3I2CL 5LAXB 1BOGA 3WD5H 1FG2A 2MFNA 4XAKD 5EC1B 1VEMA 1HYRC 1QSVA 4PRBB 1AY1H 5D5MB 1KNOB 3V9FA 1GVIA 3CFEB 3HPJA 4L4TE 5KOMC 5F97E 2EICA 4L8CA 4JFZH 3SGDH 2IH3B 4XRCA 5KSUB 1MCRA 1FFPB 2J12B 4K71C 3ULUL 4AEIH 3FB8A 2E6QA 4DQOH 4YDIH 2MCPL 1YYML 3FQWA 1GPOH 5SV4A 2YA2A 4RAUA 5HHOB 1V3JA 2DMKA 3TIDA 5CUSL 1ZT7B 3GSXA 4JFDB 3MLYH 3NPSC 4QRPB 1MJJB 2VABA 1YDPB 1X7QA 5J11C 2UYLA 3V0WH 3QG6A 1HEZA 1J8HB 4JLRA 4PJAF 2KZ1B 2YZ8A 3QQ3B 4LCYB 1WFTA 1RUPH 4OCMC 3C6LC 5I76B 5E7BA 2Z31B 2Y72A 5ILTH 4OLYH 2WSKA 2QSQA 5HHNA 5C7XL 4YGVB 3SJVA 2DAVA 3SJVE 4QXTA 3ZDZE 3CFIC 1GOHA 4QNPE 3RGHA 5D72H 4H5SA 5DS8B 4PJCB 4F58H 5C0AA 1UGNA 2XTJE 1ZGLB 4HS3A 2VLKE 5TE6L 3MRIB 3WD5L 3WFDH 4AMKL 1S9YB 5JHLH 3P9LA 4IDJH 4RFOH 2LVEA 4CU8A 1T80A 3BJLA 4Y16A 2HVJB 3RWHB 5KJRL 3HR5A 3K8MA 4X9GA 5C07B 5JDSA 4XNYL 1ZT4A 2NY1C 2YXMA 5FO8B 1EEZA 1EH9A 3F7YB 3QI9A 1T2QL 1V05A 2DQHL 3N9GH 4B5EA 4MMXC 3GMNA 1C12B 3AB0B 1U3HD 2ED9A 4GAGH 2VO5A 4MD0A 2HJFA 3TH3T 1QSFE 3LS5H 3TV3L 3FFCA 4LQFH 1C16A 2A74A 2I5YH 1EJOL 1HYSD 2ZKHL 1M4KA 2OTWB 5TGBA 1KOAA 4H1LH 5GS0C 4LSRH 4P3CL 3WLWC 4S0TD 2YBRB 4KK6C 3RVTC 5HVHB 5D70H 1PZ5B 5EG6C 2ICWA 2XN9E 4X5WA 1N8ZB 3L7FA 3RVXC 1X5JA 2ZG1A 5D7IF 4UT9L 2BDNH 1F4HA 2CK0H 1FSKB 5GGRB 3PXJA 2Y6SD 5I73C 1GOFA 1MY7A 3O3UN 5SV3A 2OR7A 3TVMC 5IJKA 3STLB 5HVWA 5A1AA 5GS0L 2R2HA 3JTTA 2OZ4A 2AKRA 4JZJA 4N0UB 1BZ9B 4M3JA 2BVOB 4LCWB 3MLSL 4FXLA 3PUCA 4KRPD 4MD4A 1QFOA 2L4OA 3BEWA 1SJEA 1ETZB 4BK4A 2VH5H 4CU6A 5FUCC 5F8QC 4ERSH 5T3XD 3MV7D 5H2BA 3FONB 2IAND 2CRYA 3UYPA 4KZDL 3BWAA 3UTSE 1A22B 5A43C 5CZXC 5IMLA 5DYOA 1KG0A 3HKFA 3SBWA 3MPCA 3MLPA 4K3DL 3WE6B 5J56B 2D4DA 1QO3B 3QUKB 2EH8L 1WIOA 1I9RL 4Z7OE 3DRTA 2COQA 3VA6A 1VDGA 1E4KA 2CIKA 1RHHA 4GRLC 3CX5J 2X1PA 5EUOA 1R5IB 3RWCB 3EO9H 4XBGB 1MHHB 1TNMA 3BPLB 4KZEH 4M8QB 3O4OC 3QXUA 1EFQA 1ORQA 4HKJB 3BH9B 5C0JB 3VWJB 1OQOA 3N1QC 2ARWA 4F7EB 1C5CL 5IBTL 1OL0A 3TYFB 3KPQA 5HYSB 5I1KH 1WWWX 4WW1A 1QLRB 4HUUA 4M03A 3IAGC 3HNSL 4X5XB 1MQKL 4N1EA 5D1XD 1GAFL 3UTTA 1UQSB 4PGCA 2BRRH 4ONGL 3MCLL 4TNVK 3QUYC 2VXUL 3MYJA 3VXSB 4DUWA 5EZLB 4OF6A 4M48L 4MJ5A 1OB1A 4HDIB 5DUPH 3GK8L 2H2SD 1GL4B 4Y4HD 1IKFL 5ADPL 1G7LA 2AXFB 2BC4B 4OCXL 5C2BH 1OTTD 4Z7QE 4KV5E 4LAJH 3RGVA 3V7AG 3GB7A 4RBPH 2O5XL 1OCWL 1FZOA 1LDSA 4KQ3L 1U8MA 5HJ3B 2P5EA 4CVWA 1MRCL 2WBJD 1CFTB 4FQXA 1R3HA 4FG6D 1ZKAA 3BPOC 4DAGH 2XZZA 1S9XA 1KB5L 3CK0H 3F12A 3SDAD 4K3DH 2NXYB 3C5ZC 3FRPA 2XPGA 3KPTA 4H25A 5HYIA 3KJ4B 2EH8H 1AR2A 1T22A 5I9QB 5MEND 6CGTA 5EIIA 3U0PB 3GMQA 1ES0A 1GGIH 4WEBL 4NRXA 4JN2B 4GG6E 3G5ZA 4RMSA 2YKLL 3O6FD 4WHCA 4S1SL 5F71A 2EDFA 2D7QA 3WHE0 1ZSDA 4V1DA 1RZFL 4OFYD 4FQLH 3GRWH 4RMRA 1NC2D 1X44A 1QFWL 1EPFA 3DTXB 4KKAD 2AK1L 1BX2A 3TBTA 1CD1A 2RIKA 3O4LB 4WO4A 5LXGL 5L7XL 3MCLH 1CXLA 2BOBB 4JY4A 5I8KL 1F02I 5F7DA 4JB9L 4PRAB 5EOCL 4KRPB 5FGCE 4CNIB 3NZHH 3WNOA 2JKXA 5DZLA 4NUJB 4IMLB 4ONHA 3VFUA 5FECB 1MFDH 3L6FB 4ZOBA 5ADPH 2OLDA 4OF0A 3UZVB 4HIEA 4HZLB 5EU3B 5JOFA 1KJ2A 5EOQL 3X12A 4NJ9H 2UVFA 3QUYA 2RFXA 5GIRA 4DUXA 1X5HA 5C8JB 4R4ND 5E0QA 1QA9A 4OZIA 4JREB 4BSJA 4NZTH 3AFLA 3R06B 3T04D 2FJFB 1RUKL 1WLHA 2V5TA 3VGAC 1OD7A 4EDWH 5T3XE 2ERJB 4KPHH 2EZ0D 3SE3C 1BQHA 4MDIA 4O02H 1E4WH 3FFDA 3GSNH 1MCCA 4A6YA 4ZAKA 1YUHA 4PBVC 4X4MA 3LIZH 4LCCB 5BS0D 4W4NA 5FYJU 1NGWA 5EUOE 3MLXH 3MUJA 4ODWA 1BVKA 2CO7B 4PB0L 2JJSA 4QHNA 4YUEH 1X7QB 5INCA 4LCYA 3DJ9A 3A6CL 4R90H 2AJ3B 3S34H 5L0QC 4UQ3A 4HC1H 3GMOA 1U2CA 4NZRH 5JZ7C 4PV8B 1YPZB 5D7IA 2OS7A 1EFXB 1CG9A 5LGJB 2X4UA 5HHNB 4KROC 2CLZB 3PG2A 5KS9F 5BCAA 2XNAA 5F7YC 2QR0A 3DYPA 3CUPA 3HHRB 1S7UA 3RNKB 3QT2A 3BHBA 5HVGB 5FGBA 4OZHB 5DS8A 5DHYA 4WWKA 3O6FC 1WVZA 3IU3B 4WCYH 3DSFH 4DFHA 3O41B 4QRTB 2VC2L 3SGKC 4ZDHA 5K9KB 3FQUB 1U95A 1CDJA 1ZHKA 3HPJB 8FABB 2QQNH 1W0YT 1JZ2A 4HT1L 1LE5B 2ED8A 3DV4B 2DTSA 4Y4KA 5JXEA 1WCBB 4RRPA 4NHCH 3WHXA 3ARDA 5JR1H 1E28B 4PJEB 1B0WA 1SBSH 4HKBA 4Z7UE 4UINL 4Y4FD 2YD2A 2R0KL 2VDRH 3HZKB 4Z8FL 4LVNC 4WFED 1FRGL 2MTPA 2CKBH 4RAUB 5HHOA 4RZCA 1NAKH 4LKCA 1C16B 3VDCA 4MNGE 3GSNB 1CLCA 1FDLH 4OZFG 1C5CH 4JQXC 5DGQA 1S7WB 4HWZB 2EDNA 3NA9H 2XFXB 3LMJH 1R24B 3SDCD 4QT5B 2MMXA 3QIWC 3GIVB 5L2KA 4X5WB 1DBMH 3BRGC 1QRNB 2OJZL 4JVPA 3VG9C 5I17B 2Q8BH 1GZPB 4OM0H 3BZFA 3MRPA 3EOTL 1DTUA 4LIQH 4YZFF 3O2WH 2X89A 3FN0H 4Q9CA 4JEGB 1CFQB 4C83B 5EFIA 3ULUH 2AKRB 3H2WA 5HGDB 2FB4L 1UZ6E 1HOCA 4IEFB 3GUTB 2X44D 1DQMH 5KSBE 3BH8B 3B2UC 4UTAH 4K9EH 2MCG1 3K74B 3IKCB 3TN0B 4JFQB 3GKWH 2B1AH 5E03A 1O7VA 2HKHL 2ZCLH 1N5AA 2R1YA 1BD2D 4PY7A 4LHQB 5C0GB 5IW6B 1BJ1H 4V2BA 2JCCB 1BJ1J 2VDQH 4IMKC 3WXVL 1X5ZA 4J3UA 4KMQA 2DF3A 1S9WA 5IHZB 2ATKB 3LEVL 1CVSC 3QFJE 3HAEH 3HMXL 3TIEB 2FBOJ 3W0WE 3MRFB 3BKYH 4PRIB 1DN0B 3QXWA 2M1KA 2BVQB 2CUMA 2I9LA 3HAEB 5FO9B 1KEMH 3NABH 5FUZL 1AFVH 3MRRA 5DJ8B 5DRWA 3VXPA 2FR4A 4P5MB 3BH9A 4WI8A 1RZFH 2FD6L 1VPOH 2VSCA 15C8H 1H3WM 1HHGB 1NLBL 3P4NA 1OP9A 1ZA6A 3QUZD 5KSAD 5LXGH 3DX7A 5TPWL 3BKCL 3MYJB 4ZTPL 4KXZI 5IVXF 4JM2F 4LLVB 1EEQA 1U36A 1F2QA 3UO1H 3E0GA 5IK3B 5CSGA 4P57A 5D7JC 3L5HA 4LCWA 4O2CA 5CSZA 3WO4C 3P0GB 1VHPA 4P2QA 3QIWA 1E0OB 1RJZB 4UTBH 3BXNA 5A2JH 4RISH 4GAJH 2NXZD 1CK0L 2HKFH 2V5MA 3B9KD 1ZHNB 3TNNB 3HN3A 2J5LC 1NFDF 4YHKH 3U82B 4GG8A 1K8IB 4LVNB 5KOVC 2VZSA 2D31B 1FIGL 4HZAA 4C56E 3FMGL 1Z6JT 2ZUSA 3O4LD 4L29A 5DA0B 1P6AB 2RCSL 4WFGD 2Q7YB 3T8XB 4ACPA 3O3DB 1S9XB 1UFUA 4NM4H 5DDHB 1NGPH 5E08L 4YC2C 4NO0A 1XGQB 3W11D 1T22B 4M6AA 1X4YA 3BO8A 3MJ8B 4G8GE 1EK3A 1I1CA 2QTEA 1A2YA 4G8IA 1KENL 2F5AL 4I48A 3TLRA 3WEXB 4PUBH 1UWEH 4EI6B 1VKXB 1TJHH 2RB8A 4K3EL 3W39B 3SGKA 1FFPA 5D2NB 2DQTH 5CILL 2NMSA 4G7YH 3V6OE 4FXGB 4LSQH 5DEGA 2GJZB 1CL7I 5FUOH 2HG5B 2K9UA 4LFHD 2Y06H 4QHKJ 1X5YA 1I8MB 5HHXH 5F7EL 3IDYC 4HIIA 4ZYKA 1QUNA 4HCRA 4I3SH 5TPWH 4BSVB 7FABH 3RIFF 2OTUB 3ZKQD 4QGTA 3UTZB 4GRLB 3RVUC 5D93C 3MLZH 4FFYH 1IEAA 5IQ7H 4BH8B 2XZAH 3WDIA 1QFUL 2NY3D 3ZKNC 4GOSA 4I2XB 4YNYA 1JYNA 5FM4A 3P3YA 5B39B 3TO4D 3RWJA 3RZCA 3MNVA 5LKNA 3NAAL 3F8UB 4WI2A 3S5LG 3CFKA 3QRFM 5KVDH 5I1AA 4PJIA 1BJ8A 2DICA 1FL6A 5IB5B 2BSSA 5DR5H 3K2UL 3U46B 4GRWH 2CDEB 2GJJA 5E9DE 1HXYA 3RY5A 1FZKB 4E5XA 1YNLL 4UU9A 3ZHLA 4M02A 3I02B 4NFBA 1MCHA 1DN2A 2H6PA 4M6NH 5DRZA 3FFDB 2BERA 3I6GB 5L8LB 1OAQH 3V4VL 3ECBB 3P40A 3P9MB 5D5MA 5MI0B 2W1NA 4POUB 4RDQG 4KAQL 3ZKXB 4JN2A 1TJIL 2OL3A 2F5AH 2Z91B 4OCXH 5GGVY 4J3XA 3TESA 1KTKE 3DX6A 3V8OA 2UY6A 3HR6A 3QUXD 1UVQB 4RMQA 2XA3A 4KJYA 5JLZA 4U1LA 1SEQH 5HDQH 3D0VB 2OXGA 4BH7B 1OWWA 4OM0L 2X4UB 4LSUL 2E7MA 5EWIH 1KB5H 5GS0H 1G0YR 1XF5B 4X6DE 1LEKB 4RMTA 3BQUA 4NN7B 5C09E 4NC1C 3L6FA 3B2VH 5DQ9A 4Y5XC 4HUXA 4L3CB 1KLUB 1DVFB 5D1ZB 5TQ0L 4L8BB 2X4RB 4XAWH 3WIIH 2ZG2A 2DM4A 4BZYA 5DURD 3IS1X 3QXDA 4UV7H 3SDCB 4DZ8A 5E7FA 2CUIA 4CMMB 3MRMB 3GZKA 4NDMA 3ETBF 3T09A 1FLTX 4ZUVB 3QDGD 3T3MF 4GRLD 4QRPA 1WITA 3ARDB 3FN3A 3T0AA 5JW5B 3BEWB 2NX5A 4HEME 1A3RL 2XTJD 5IWLA 4P46A 4FZEL 3U9UB 3FO0H 4PJ5B 1W72B 2YK1L 4ZAKB 1MSPA 1EEUA 4HFUL 4P9MH 3JUZA 4HWNA 3OGCB 2RQ8A 3BDBA 5D7KE 5D71L 5GGRY 4BELD 5FO8A 4UNTA 3LD8B 3MA7B 3QEUA 4ORGA 3ZE0F 4XVUD 2C3VB 3OKMA 2X4NB 1MCPL 1RK1B 1S9KC 3T4YA 3QWRA 3EDJA 4F9LA 3VFTB 5C0AB 5DWUL 4JR9H 1KBGL 2VLLB 3SKMB 1MWAB 1BAFH 1NANI 5BW7C 1AXTL 4UDUA 2F74B 4X0KA 3OKOA 3FB6A 3SE9L 3HR5B 4Z0BH 3HI1B 4WU5B 3DV6A 3OF6A 4BFIB 3DO7B 4O9HH 3PDDA 4XP5H 4GG6F 2DRUA 4RX4D 3DNKA 1PYWA 4LF3A 4U1JA 4OB5H 3MYZA 5FYJE 5TDOA 1EIBA 1K2DB 4KDWA 5TH2A 1N8ZA 4ZQKB 4NRZA 2R0WL 3FOMB 3SGEH 4KHTH 3FQRA 1IC7L 2YPLA 5GRUL 5ID0A 1WZKA 3NGBC 1MIML 2BHUA 3MLUL 2WUCH 2RCSH 4Z7WE 1VFMA 2VXQH 1PKOA 4Z7UB 3CK0L 1G7JB 4P2RA 3VXSE 2BX5A 2VZ1A 3ULVD 1KPRA 4A2LA 2HAZA 5AWNL 5LCVH 3OR7A 3SBWC 2DJSA 3TPUA 3LD8C 1HN1A 3FQTA 3MBEA 1H9VA 1LILA 1JK8B 5DURB 5L2KD 2UZIH 4CVXA 5E8DL 3VMOA 2HWZH 3LQZA 4OF7A 1H0DA 3ZYZA 1VADA 1QACA 2ATPB 1OAYH 2P43B 2VXTH 2OTPA 4ZS7H 4HBCL 1OAZH 2JIXD 9CGTA 1PG7W 2A6DB 4UOW0 4JDZA 5T1KB 5L7XH 4KROB 1H8OA 5F9AC 4DGIL 5I8KH 2XY1A 4I8DA 1T2XA 1RZKC 4M8QA 5IBUG 1J87A 3PABA 4KRNA 2IADB 4HIXL 4XC3H 4U6XB 4GAGL 5L88L 4FQHB 5EZOL 3D69A 1B2WL 4OD1H 3S4SG 1LK3L 4QLRA 3B8YA 1BOGB 2R15A 4LQFL 1TETL 2R0ZL 4NWUH 4PJ7E 4NNPL 4GAFB 1PBYA 5CGMA 2JCCF 3WO3B 5EUOB 4AYFA 2IALB 4M7KH 5ICXA 5IVXE 4MJ5B 3OZ9L 1R0AL 2BOCA 3MRQB 4MSWA 2NY6B 4YX2H 4MXVE 2A6IA 4YXKH 5IIEA 3VGHA 3D39D 1K5NB 2VDNL 3WXWH 3QZWA 1U8LB 1CLOH 4EBQL 4PGCB 4NO5B 5B3JE 2AK4D 1I3RB 4FFWC 5HI5D 2ICWI 4XMLL 2D2OA 1C5DB 2AV7A 2CMRL 3U30B 2HTKD 1FZMB 1QLEL 1N0XL 2B20A 4I48B 5GRWA 3HE6A 1AI1H 3KXFB 1GH7A 4LOUD 5E2WH 3MLYL 1X4XA 2IBGA 1NL0L 3G6AB 4HV8B 5GGVL 4YBQD 2A9ML 4P5KA 1YQ2A 5TE4L 3RX8A 2DN7A 1OTUC 2BHYA 4D0DB 2Y5TB 3S34L 2VAAB 3C9NB 4OLUH 3NVQA 4IOFC 1GRWA 1DBKH 4U1KA 5GJTL 4KUCD 4LASL 2V2XA 3L5JA 2FEDD 3RL2A 5I1GL 2VL5B 4R6UA 1ZLUH 4ODWB 5HY9B 1DQDH 5F1IB 4I4WA 2FECL 4ODVL 2H3NB 3TFKD 4JQIL 4Y4HC 3S37H 5KAQG 3LQMA 1RJZA 1GHFH 4IM8A 2R4SH 2ADIA 4OD1L 4Z76A 4C56D 2AK4A 4H25B 4JRXE 2P8LA 5J0BA 4H26A 5D93B 4HAFA 3PE9A 4FQ1L 1K8IA 1A3LL 5T3ZL 3O9WB 3ZE1F 1JPTL 2R0LH 5B8CB 1BOYA 4ZXBB 2RR3A 3C5ZB 1CBVH 1YEGL 3LKPB 3G08B 1F13A 1XGTA 5SWSB 4Y88A 3ZKSD 1F00I 4HS8H 1JNHA 1J11A 1JTOA 4OZ4A 5DUML 3BVNB 2CRIA 2DWEB 2B1HL 1F6FB 3OGOE 4YHML 1DVFD 1U95B 1ZHKB 1NFDE 2Q86B 4Q2ZA 4PIRF 3D48R 2UWEE 4WFFD 4M9OA 4Y5VC 4QOKA 4EI6A 1VKXA 1J1XH 2NY4D 4OKVB 4JY6A 3OKEA 4GMTH 5GGVH 3TA3B 1G7MB 1GYAA 1OAKL 2YBRA 2X70B 1J8HA 4LPCA 5F96L 3Q6FA 1NCAH 3TH4T 4KH2A 2VZOA 3ARDD 4WV1C 1T7ZA 1AXTH 3X12B 2JB6B 3O3AA 4JRYE 1PFCA 5D1QA 4RZCB 5HHME 4LLYA 1PEWA 3K4ZA 5SWZB 3BI9X 3U1SL 1RIVH 1U93B 4GH7B 2HT4D 1UM4H 1MAML 1RZJH 4I0KA 2EDBA 4OCNC 1F2XK 4K3GA 5E1AB 1I1AC 1ZGLA 3MBED 1EHLL 1ITCA 1P4LA 1S9YA 4LDLB 1T66C 1MFEL 4JM4L 5DT1H 2GTWA 4X98A 3KPSE 5EBWB 1DVFC 4F37K 2DQTL 1MCOL 5C0BB 1JHKL 5EFIB 4RX4A 3U46A 4LSVH 1DFBH 4I3GA 1VFOA 4MCZB 3TYGL 1A7QH 4RCAA 5E6IA 3WFCH 3QH3A 1WTGT 5TFSH 3TZVA 4E42B 4HKXA 4Y19A 4XCNA 4Y19E 5CKGA 4TVPD 5DJYB 1J18A 5EU7C 3KYNB 4HQQH 4HXAL 1F4XL 3CFCH 2PTTA 3EUUA 3NCCB 5HGAA 3X3FL 4Z7WB 4OT1H 4JPKH 3BT2L 2W0FB 1PVHA 5F7WC 1BJMA 4CADA 1P9MA 5FAAA 1U9KA 3P11L 2HWZL 5F9OH 1A6VL 4LBEB 4X8JB 1QBBA 4GLRI 3BHBB 3QPQC 2ZUYA 4L9LC 5E95B 3MROA 4V2CB 3H8NA 3S36L 1NMAH 5F1SA 4WWKD 4XX1E 1QRKA 4X6CF 1IFHL 3MV8E 4HH9A 1RZIA 4RSVA 3ULUC 3O6LL 1RZGB 3DX9A 1U0QA 3IXAB 5DHXB 3LZFL 2FR4B 2BNRA 4MNHA 3SKNA 5IEHA 4FFVD 4P2RD 3U0TA 4C56B 2AXJA 1INDH 1RULL 3FKUS 4Z95L 3V6ZA 3ESVF 2NW3B 5I18L 1U8HA 4AH2A 5C2BL 2IMNA 4NWUL 1ODAA 3RY6C 1XGPB 5IOPB 4KK8D 4QOKE 3Q5TA 1IAIM 2Y7QA 2P5EB 3ZTJH 4LKCB 1JRHL 3QHFH 4NDMB 3I85A 2VWEE 1QSFB 1IAII 3CDFA 5MHSD 4FNLL 5AAMA 5SWZD 5HDQL 3MRKB 5EZJA 4AIZB 1UJ3C 4P2QB 3BH8A 1KLFA 1X5LA 3P0VL 2O93L 2BSTA 4FQCH 1KPRB 2DQEH 5B21A 3HB3C 2XFXA 4OCSH 4U1SB 1UB5B 4Y4FC 1RU9H 5DJDB 4NQCA 3HRPA 1AXIB 1X6NA 2Z8VC 1S7SA 1JWUA 1CDGA 4DVRH 4IRSD 3QWRD 4X6EA 3WIFB 3WIHL 4JFEA 4P3DB 4W81A 4W4OC 4K3EH 1JGEB 4UQ2B 4QO1A 4PJGB 5TE4H 1U8JB 5HGGS 4F7EA 1OT2A 3C08H 1ZVSB 5AZEL 5CINH 3ARFB 3K7UA 1P4BL 3L3HA 1J5OH 2KL6A 3GJFH 1KC5L 2YD8A 2CXKA 5I8EA 4KK8C 1EZVX 3HS0B 1T89A 4ELME 3GM0A 2YPVL 2C26A 1BFOA 3EDDA 1ZEAL 4OZFB 3K46A 1A6AB 2JCCE 1BD2E 2JLLA 1UT9A 1CGYA 3LKNA 1JPSL 4Q9BA 3VCLB 3WFEL 1UH2A 1DUYB 2H1PH 3IJSB 3TT3H 5EDXA 3WSQL 2E9WA 1U3ZA 2XV6B 1FL5B 4HWEH 4K94H 4M8VA 3TVMB 5FYJD 5IW1A 5J13C 5E2VL 2ZSWA 3KJ6H 2QQKH 1TMCB 4LRNL 4EOWL 5DD3H 5JMOC 2EZ0C 4N9GB 3OXSB 2YUVA 4FQIH 3O2VL 5DJ2A 1A7PH 1YECH 1GGCL 4GSDH 1JGLL 4BQCA 4PG2C 2PCPB 4ZOCA 1G7JA 4P2RB 4UT9H 3WS3A 5TF0A 3DARA 4HK3N 2FWOB 4RNRA 4HXBH 3O2WL 1MREL 2KQMA 3SJVD 1I7TA 4KTDL 3MV8B 1ZA6B 1RU9L 3NN8A 4PJ8B 3BZ4A 1TJIH 3D3VA 1CCZA 3PWPD 3AGVA 4OCYL 3L3JB 1T4KB 4M1CD 3CFJA 4P5KB 5IV2B 4WFEE 3I02A 3U7WL 4DUVA 2ZCLL 5BMFH 5CEXB 1NEUA 1GGBL 3RGVD 2D03H 4M7ZC 5BZWA 3S35L 4YHNB 1UENA 3RDTA 4PV8A 2HT4C 5F1OB 4PJEE 2GTZA 4XP1H 1FAKT 1A2YB 2C3XA 1LP9B 2OR9H 4PLOB 3KPRB 3WEXA 1G6RA 4KJQD 4IRJB 4LHUB 2Z35A 1IT9L 4XCCH 1PKQB 1TQCB 1GGTA 4LARL 5IJVA 1M71A 1DR9A 4DEPC 3WIIL 2XA8H 3TA3D 4BFGA 4A2MA 1EXUA 2NZ9D 3W0WD 4BSVA 1OWRM 4OFIA 4ZAKD 2VDPH 3OJVC 4L4TA 5HHVL 3F5WA 4HT1H 5EULV 3P4MB 1Q0YH 4ZS7L 1P5VA 4UOJA 3FT2A 1OAZL 5D7IE 1SYSB 4NHCL 4U49A 1IC4L 5DVKA 1AJ7L 2PYEA 4KK5C 3BKML 1AGFA 1J12A 2GJZA 2P5WA 3BSZH 1PDKA 4ZO6A 1R3KA 3GHEL 3L3GA 1Y6NR 4KFZC 1RUQH 2XWTB 3OWEA 3TO2A 1OGAD 4DZ8B 4Z6AT 1DLHB 3TH2T 4CKVX 4NKIL 1DEDA 4NP4L 2QADC 3QDGE 1A1MA 1BBJA 4LCWD 4IJ3B 1CK0H 2HKFL 3VGGA 1FZKA 2IANA 4AK1A 1KB9J 4G6AC 4ZS6D 4Q6IA 5IHBA 4J3WA 2DQGH 4GBXA 5I1EH 4ZPVA 2GITB 4PS4H 5I71B 3MNVB 2A6JB 1EGJH 2CQVA 4M43H 5SWSE 2NXZC 4JY5L 5DEFB 4PJ8D 4C83A 1WAAA 4MD5A 5DHVH 3AUVA 1AD0A 2VDNH 4Z9KB 4CW1B 5LWYH 4OI7A 1I9IL 4WI3A 3H7BB 2J7LA 2J4WL 4U6HB 4HPOH 5IROC 4KV5F 3O41A 4QRTA 3ZMRA 3ECBA 5EBWA 1LO3H 5ITFB 2AEIT 4O51A 2GSIB 4LEXH 4KMLB 3T0WA 3D39A 2MNUA 5DEZA 4QWWD 3WN5C 3IAPA 4AQOA 5C0FB 3TF7C 3SCMA 3LEVH 3C6LD 3O3EB 5CCKH 5I1DB 1ITBB 1E28A 4PJEA 1IBGL 1NH6A 2JJVA 2NX5D 1DANT 2FHBA 4P49A 2JIXB 2RHEA 1CXIA 3JV6A 5F9WC 4F7CA 3UC0H 4CMMA 1OHQA 4YO0A 3VRLF 1RJYB 4PY8I 5EB9A 4X4ME 2QHRL 3TO4C 4QOKB 5C0DB 3W81A 1D5BB 1A8JH 4R3SA 4OQTH 4Z7NE 4LCCC 2WINA 3E6HA 3VDAA 4AIXA 1TQCC 2F8OA 4MA1B 3OX8A 5EOCJ 3EOAA 1IRAY 1MEXL 4JGJA 5I1CL 3C8KA 3TC9A 1CFNB 4H0GA 5IMMA 4ZNCD 2WIMA 5GRZA 5BZDB 4X9HA 3V52L 2D7TH 3BDYH 4EKXA 4JDVA 4OZFH 3QDJA 43CAB 3IKCA 1KN4L 4KI1A 3TN0A 3SKOA 4JDZB 5T1KA 5FYLH 4X98B 2Q8AH 4K9EC 4ZS6C 1MPAL 3ARFD 2YWZA 3UZEA 4OLZL 3ZYIA 4LEXL 3S36X 4ONFH 5LGKA 1TQBB 4FTVA 3KPPB 5CBAB 4TVSa 1SEQL 4L29B 4NZRL 4ZFOL 5FDWA 4L1HA 4N0YH 2WWKO 3O3DA 3WO4B 2MWCA 1MRDL 4Y19B 4QTHA 4YHZH 4G6FB 4HMDA 2ATKA 4CU7A 3O11B 2APFA 4PJAA 1UCBL 3IKKA 2EDOA 3ARBC 5DMGC 4J4PA 2W0FA 3FB6B 3OKOB 1I1AA 1ND0A 2W65B 1SM3H 4L8SA 3IDGB 2R8SH 1SYVB 5TQ0H 1UWEL 3DIFB 4JFEB 3KPSB 4P3DA 4X8JA 2OZ4L 1NL0H 4BFBD 3LRGA 2VC2H 5CS7A 1U8NA 4ZD3L 1OGAE 4U1JB 2PTUA 3QIUC 1PY4A 5FV2A 5KSBF 2OL3H 5B4MD 4YK4C 4GQ9H 4K3JH 1O0VA 4P2OA 4DZBB 3WFCL 3VXOA 3OAUH 4XWOC 3VFGH 5C0EA 4GQPH 1XF2A 4G8EA 1PQZA 2HT3D 2X1XR 3IJYA 5EC2A 2OTUA 3N85L 1CGWA 3SY0A 1NEZA 3ZKMD 3AY4A 5JPNA 2XZAL 1MVUA 2CDGA 4OT1L 5KVMC 3S88H 2EIZB 3EGSA 1L0XA 3THMH 4I18B 3R1GL 2GK0A 1AQKH 5SWSD 3SDYH 1TITA 1CE6B 3QJHA 2B4CL 4OCWH 1U3YA 5K33A 1CXFA 1T6WA 5CIPB 3D18B 2DL2A 3QQ4A 2C3GA 1NPUA 2GAZB 2VXVL 4NWTH 4OV6F 2BSSB 4ONFL 3OAZK 1CICC 1TIUA 3UTTE 2W9EL 1H0DB 1OTUD 3AC0A 1OP5K 1VENA 1S7QB 1E27A 2Q8BL 2YC1A 2F15A 1LEIB 4LPYA 3BSZL 5ERWA 4MA8H 1AGBB 4NM8H 1XF3B 4ELMF 4PJHB 4OTXL 3ISWA 4NKIH 3PWPE 2CR6A 4MX7B 2IH1A 1DBJL 3WIFA 3HG1A 5H37G 3MV7A 1D7FA 3MREB 3MRQA 4LNRB 4P9HH 1S5IL 5CJXC 2PUQT 1OLLA 1XGTB 4JFXB 1BIHA 4I77L 2HLFD 1RV6X 35C8H 2ZUUA 3L5XH 3H9ZA 2E3VA 3RZCC 1WZ1H 2OMNA 1U8IB 1M1SA 4QF1B 4JFPB 1LP9A 4UUJB 4PTTB 4YBLC 3KXFA 1S9VB 5GGSA 5AWNH 4FMFA 1A6WL 1NBZA 3NIFF 2P48B 1HH9A 5C07E 1IARB 4HWBL 1R3JB 1AFVL 1OTTC 1OSZA 5JTWA 5D7SL 2VRAA 4U1NB 4G5ZH 1U8LA 4OFVA 5EA0L 4ISVA 2FH8A 3QXDB 5ICZB 2NNAB 3NFPA 3BAEH 5I1IL 3SQOH 2QSCL 4JFFE 3DVGB 3LB6D 4U7KA 2HJLB 4PJHE 4I4WB 2GJ6D 2X4OB 4XPFH 5IB1B 3U6RB 5F9JB 2CGRH 4U0RC 2IFGA 4WI9A 1FGVL 1CR9L 2YN5A 2FWOA 4PBXA 4DOHB 5IFHL 5I73B 5E1AA 2RJMA 1QNZH 4P2OD 3NCYP 4ZPTA 2JJSC 4FZEH 5JW4N 4S1QH 2NW2A 2WBKA 3WFEH 1ACZA 5ID1A 3U9UA 3O2DH 1AO7E 4HEPG 2W9DH 2G75B 2GY5A 1DQQA 3C87A 1FYTB 3RL2B 4OLEA 4G9DA 1RIHH 3A6OA 5FM8A 4Q6YA 1DBJH 1I1RA 1NBQA 5F6HI 3RI5F 3I6LE 3H9HA 2DQIL 1XR8A 2C3VA 5HHOE 5F3HB 5DRXA 1KT2A 3P30H 2RBLA 4DW2L 3RKDC 4KJYB 3DXAA 3S97C 4NQEE 2VLLA 3D0VA 4ZUSA 1YMME 2G60H 4CDHA 4Y2DB 5KVEH 4PJ9C 4Y4HB 3KLHD 1S7VB 3KLDA 3X17A 3V5DA 4BFIA 3BQUB 2NYYD 3REVA 4X80L 4G43A 2GQHA 1CLOL 1BLNA 2DM2A 1YYLH 2Z4QA 1PYWB 3OKLA 4JQVC 1JNHB 5KVGH 5ENWA 2X4RA 4F33B 2R0WH 1JF6A 2IQ9L 1HK6A 4QKXB 4WUUB 1MCQA 5A40E 3D85A 5GRUH 3MGTA 1I85C 1FJ1A 5IG7B 5EU6B 3C60C 4MXQD 2HLFC 2GUOB 3JWDC 4BK5A 3GI8L 4ZUVA 2DLHA 1CFVL 4PRNB 5GJTH 2AEQL 3H7LA 3ILPB 3C6SB 1U8HB 3T2OA 2IAMA 5I1GH 4KJPD 2WK2A 1JF1A 1K4DA 1RQ5A 7FABL 4FQQB 3RX5A 5EOCH 4B7IA 3LN5B 3GBNL 1IT9H 3MGOB 3VXRB 1ZV5A 3F58L 2FSEB 3D6GA 4UAOC 2V9TA 3WFHA 1KJVA 5DD6B 1WCQA 4JFDA 2IANB 2ZOLA 1T66D 2Q76B 1YN7A 2RAMA 1I1AD 4GQ9L 4K3JL 1CU4H 2R0LL 5I0DA 5HGBA 1P4LB 1RUAL 3Q6GH 1F90H 3PWUA 1RFDH 1M6OB 1I3UA 4MD5B 3KJ4C 2ZOKB 1KULA 3G6JA 4K2UH 4U6VH 3B2UD 2ICEB 3CU7A 2JELH 1D5XA 4H5SB 1ZVSA 3SKJH 3T0EE 1RURL 2V9QA 4E42A 5TDOB 4NNPH 4P4KD 2R39A 1EV2E 5K9QI 1D5MA 3WN5A 3MV8D 5MERA 2NY5H 1KLGA 2XRAL 3GBLA 4ZO7A 1N0LA 4CADB 1EEZB 3DURB 3MRBB 5J9PB 3GMPB 1IC5H 1IGFL 1X5KA 5BO1L 4L3EB 2F19H 4PS4L 3VXSD 3MO1B 3AREC 1A7NL 4QTHB 3CDGA 1DL7H 5BRZA 5DMYA 4PY8J 2KH2B 1IEBA 1HZHL 1B3JA 3VXUA 2ZSWB 1RIVL 4R4BB 2NX5E 4YBQC 3LSOB 4BFEA 5JQ6L 6FABL 1I1YB 5ANMA 4H8WH 4GS7B 3BEVB 2GFBA 4AL8H 1MVFA 1N5YL 1TLKA 4OLWH 1JUFA 2XKUA 3KYOA 5HDBE 1I7RB 3NIDE 3ZZ1A 4PJBE 3W2DH 2QQNL 3MXVL 2IFFH 4YFEA 4JKLA 2ARJA 5BQ7A 1WBYB 4JQVA 5ICYA 5FHAL 3STLA 3SCMC 1IMHC 1RFDL 5J1SC 2IBZX 5EUKA 3ZHKA 4R26L 3ULVC 4HSQA 2AABH 3H9SD 2R4SL 1WICA 1E6OL 3LPWA 4JDVB 1J8HE 3AMLA 4LIQE 1TCRA 3HB3D 5J1AB 2PYFA 2YMXL 5C6PB 5CD5C 4U1HA 5DJDA 2F54E 3FONA 4PGJA 2APXA 1NMBL 5C0IB 5L9DL 2FGWH 2E6PA 2FCBA 4YFLI 3O9WA 5FM5M 1FVEA 5CBAA 5B8CA 2BXYA 2FJGB 3V6FB 1TZGH 3ELAT 3LKPA 2NXYD 2I24N 2V7HA 1NGXB 2CUHA 1RZKH 3SE9H 2R1XA 3HC3H 2R29H 4J8RB 5I0ZA 3ZYJA 3QUXC 3FOLA 4OZIF 5L2JA 4PJDF 5C9JA 1INDL 2GKIA 4KMTH 2J8UB 5IB4B 4JO2L 4NJAH 4L4TB 4GBXD 2QQLL 4A6YH 3LKNB 3AREA 5IMOB 4M1GH 4L3ED 4IJ3C 4OAWA 4NNYA 5HYJA 2D9QB 1XH3B 3KYKL 3EDEA 2LAAA 2BNUA 1K3ZA 1HWHB 3DVIA 3FO2B 3MLUH 3MOBL 2NYYC 2V2XB 2PO6A 4HMCA 4X9IA 1JL8A 1CD0A 1A1MB 1AP2A 1HSAB 3OAYK 5DI8A 1NAMB 4LVHC 3X13B 5KVFL 5BVJA 3RBGA 4XMPH 3MMEB 1KJ2H 4CJ1A 3BKJL 3GHBL 2EIZA 1WFOA 2NY2D 4MJIB 3QHZL 4Z76B 3D5OF 5JIPA 3MV8A 4G42A 4PYHA 3D25B 1EDQA 2B8OT 4J2XA 1Z9LA 5EN2B 3GBML 3JXAA 3KPRA 3HZYB 5FF6B 5C0BA 4HBCH 4G6AD 3DVNA 5ACMA 5L6YL 4ZMAT 1EERB 3QRGH 4S1DD 2UVEA 2YPVH 1MNUL 1F4XH 4HQQL 5DJYA 1SQ2N 2NCMA 1KNOA 1M05B 1JWSB 3IF1B 4XVUC 1K4CA 4PLKD 2GSIA 5IQ9A 3U48A 4JN1H 5FO7B 3FZUD 4H0HB 3EYQC 3R1GH 4Z7WF 1MRFL 1G1YA 4XPGL 3SE8L 4QRRD 3MRGB 3ULSB 2YD7A 3GNMH 2HFEA 3DXAD 4R2GD 1NC4B 1YNTA 3QUZB 5TE7L 3MV01 4JG1H 1YEKL 3FHQA 3M8OL 4KKBD 1U3HA 2MSPA 5HDLA 4HWUA 2VISA 4FOMA 4PPTA 5FA4B 4M6MH 3FMGH 2ENSA 1A7PL 1YECL 4GSDL 4PRBA 1XIWB 5DXWA 3FQWB 3V4PH 4C54A 3QDGA 4Y2DA 3KYMB 1JZ7A 3UJTH 4NO0D 4JANA 1LVEA 1S9VA 1ZT7A 1L7TL 1S7VA 4HXBL 4ODTH 4DN3H 5SWZA 3SDXB 3GSQA 3HG1E 2NLJB 3MV7E 3U0TB 3VI4E 4ZODA 5CZXD 1MLBB 3OKLB 4JKMA 1CE1L 3OX8B 1XGYL 2GJ6A 2BXZA 5EU3A 1UM6H 3F6LA 4JRXB 2JF1A 4OCYH 3T0DA 4BQBA 3O6KH 4MZ2A 4Z5RB 2EDLA 5C6TL 1T03L 1BQSA 2F54D 3U4BL 5F44A 4LFHG 1K85A 2BVOA 2YXFA 2WMPA 5C0RL 3ILPA 4KK5D 5GSVB 1JPGB 1DL7L 4M61B 2AQ3A 1EMTH 2BSTB 4HKXB 3O4LE 3QIBC 2OJEA 3B9AA 2DWDB 2FDBP 4GBXB 3WHE1 3VXRA 4D9LH 1KB9K 4Q9RL 4DKAA 3K3QA 4JQIH 1A6ZA 1MCNA 1UXSA 3O45A 4RFNB 5GZOD 4ZNEA 4G9DB 1QFUH 4ODUB 4ETQA 5D2LF 4RIRB 3WIHH 4RBPK 3MX0A 1A1OB 2XWBA 2ZOLB 3MJ9H 2BY3A 4APQD 1AKJB 5INCB 1JI2A 3B6SA 4PRHE 4IS6A 3STZB 4HPYH 3TWCL 1JVKA 1Y0LA 3MROB 4LDOB 1NQBA 1WF5A 1NGYB 5DR5L 1KUMA 2VQUA 3AVEA 4Y4FA 3L5IA 3OAUL 3HCVB 2YEZB 1F58H 1CG9B 4RGNE 3VFGL 3ZKMC 1VGKA 2L0DA 4PRPB 4U1IA 2WNGA 3ARSA 2JB5H 3D3VE 2CLZA 5CLWA 1I7UA 3NCMA 4HS8L 1FNLA 2A74B 2NY3B 3MGAA 4TYUA 5C0DA 5GQBA 3PQYA 4YAQB 1Z9SA 4NQCE 2O26U 4HKZA 4R3SB 3U0WH 4U6TA 5D1XB 3V5HA 1NC4D 4HUUB 1KIUA 4KAQH 3FTGB 1J8KA 3GMRB 3M1BA 4NP4H 3V5KB 2VDLH 5DVMA 5ADOL 2E7CA 5K9KA 3VXOB 3NIFE 1JTTA 1D9KC 3G5VB 4N90E 3O6KL 4F7CB 5DJ0B 3ALPA 3MRHB 1CGUA 4HC1A 2DTMH 2LU4A 4N0UA 4AT6B 1TZGL 1EUUA 1VERA 1FVDA 5JXEC 2WWMC 2DQDH 3C5SA 3WS3B 4KUCF 4NO2A 4XH2A 2GK0B 3MLWL 2YD9A 1IEBB 2VL4A 5E99H 2BVTA 5FGRA 5TF1L 4KMTL 3D18A 4GW4A 4OQTA 3A6BH 4D8PA 3BRFA 3LKOB 4M7LH 4ZUUA 4G9FB 1EHLH 3MACL 1JYXA 5K59F 1JUFB 5MENB 1JHLH 3DYMA 4OM1L 2X10A 2WUBL 1CIUA 3QDMB 5GGQH 4Y7MA 3TBYA 5J6HA 3DRTB 2ZSVB 5FYLE 3QEGH 5I17A 2Q7NA 2DLGA 4XP1L 2GTZB 3ARFC 4KHXL 1PX4A 2CIIB 3MBEC 5I2IB 1E4XH 1B4JL 5CJBA 4XBEH 4JRYB 5HGDA 3MV7B 4OZFA 4MS8C 5J11B 1MJ7L 2BDNL 3UPRA 4R4FL 1DUYA 4JRXD 4M62L 1UH4A 3EYFA 4ZO8A 1UEMA 1UZ8A 2QHRH 3TNMA 4P2OB 3VRJB 1T3FB 1S7TA 3DLQR 1NJ9A 5E5MA 1B88A 3DGCR 2EECA 4I5BB 3S36H 1IFHH 1CR9H 3QRGL 4WHTB 4MAYD 4PLKC 3CDGB 3BP4A 5DVOA 1D6EB 4HZLA 4NZDA 3ARGB 3TIEA 5DFTA 3QJHB 3VWJD 4MB3A 4IHOB 1P7QA 1QBAA 4RMUA 1P7QD 3DYOA 2BNRE 1BZ7A 3VH8G 3IGAA 5EU4B 3WLBB 4FXKA 3BEVA 4U7SA 2A83B 4ZFOA 2GSGA 5CJOL 4HDIA 5C0AD 5J3HD 4XB7A 4BKLA 5E70A 5KSVB 2EC9U 3F12B 4KI5F 3CCHB 3OJDB 1F4YL 4HFWA 4TTGA 4Y1AD 1ORSB 5IR1A 3CGTA 2R56H 4WY7L 4PJGF 4RQQB 5EIIB 4Q97A 3EOYG 2PO6B 1YEHL 3PL6B 1ED3A 4YHZL 5DMKA 4DN3L 3G5ZB 2PW1A 3CZFB 1PD6A 3MREA 5A3ID 4P57B 2X1WL 5E94A 4TOYL 5GJSH 1IAIL 4OLVL 2E6JA 5CGYD 3DXAB 4MNQE 5CEZL 2FZ3A 5E2UH 1KIPA 3T1WA 1CIDA 3KXFE 2ORBL 1FO0L 4PTTA 4Y4HA 3MZTA 2VDMH 3DSNA 3I3EA 3KYAA 1J5OL 4HG4J 1CL7H 3ES6B 4OIBA 5EOTA 5EPMA 2ITDB 3PP3H 3KPLA 1IGJB 1EMTL 4LVOB 4O4YH 3BIAX 3SO3C 4WWKB 5AEAA 4XNMA 2A2QT 2J8UF 1A6PA 1ZLSL 2RFXB 1JPSH 3F58H 3TJEL 2DYPA 4I1NB 5EU6A 2X9XA 2X4SB 1U8IA 2NY4C 3RHWK 2HJLA 4QRPE 4HWEL 4Y5YC 1AQKL 1IGML 3AREB 2IPTL 1TETH 2R0ZH 2NPLX 3PHQB 3MV9A 4PRNA 4QCIB 5L2KE 3ZT5A 3QPXH 1K4DB 4ZOAA 1A7OH 1MFCL 2EC9T 2W59A 3MJ6A 1JV5A 5FA4A 3GFUA 1RUAH 3G9AB 1FAIL 3GI9L 2AJXL 2W9EH 4GW5A 1FYTA 4CDGC 2OK0L 5JXED 2UY7A 5JO5B 4YXKL 3SDAA 4M7ZB 1HILB 2EE2A 4OGXH 1HDMA 1AD0B 4TVPL 4NKMA 1RURH 2IQAA 5DRXB 1AE6L 1BF8A 5GJSL 1OOAA 3OBAA 3RWJB 2PF6A 2O5ZL 5E2WL 4K94C 5HHQA 4K8RD 3BZFB 4O5LL 2NY6D 1YQVL 5IB5A 4G3YH 4HJGB 4MAUH 1OARH 5FIEA 1RSFA 1I1FB 3R8QA 1MRDH 4D9QE 3GJEA 4EUPB 3L3OA