2FBJH

Refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
220
Chain Sequence
EVKLLESGGGLVQPGGSLKLSCAASGFDFSKYWMSWVRQAPGKGLEWIGEIHPDSGTINYTPSLKDKFIISRDNAKNSLYLQMSKVRSEDTALYYCARLHYYGYNAYWGQGTLVTVSAESARNPTIYPLTLPPALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPVQELDVNCSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Crystal Structure of the Galactan-Binding Immunoglobulin Fab J539 at 1.95-Angstroms Resolution
rcsb
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA J539 FAB (LIGHT CHAIN)
total genus 37
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1989-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fbjH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fbjH02
4FOMA 5AUMB 4ONGL 4P23B 5CINH 4MNQE 1HHKA 3G5XB 3WNOA 3ESVF 1ETZB 3HE7B 3P40A 2K9UA 3QUYD 3TZVC 3TZVD 4OCLC 3V0VA 2NW2A 1NMCC 3TYFB 2R1YA 2QSCL 4JVUA 5HHOB 2Y5TB 3RWGA 1CT8B 1F11B 2EIBA 4YDIH 5HHOE 5EZIL 1ZGLM 4PB0H 3D3VE 1PVHA 3OAYK 1SEBB 2EH8H 3I9GH 1KNOA 4U1LB 4KKAD 4OZFA 5DRNA 3BZDA 1NMBH 1KJ3H 2DDQH 3GMOB 3CVHH 3QDGA 3FFCA 3FRPG 3G08A 5FO9A 4BH7B 2UVFA 4RDQF 1QBBA 1E0OB 4JQIL 1CD1B 5E1AB 5TGBB 3B6SB 4XVUC 4K71B 1B3JA 3HTLX 1ZLUH 3L1OH 1N3NB 3IDYB 4JREB 4MAYD 3M8OL 4QHLB 1UXWB 4PGDA 3EYFA 4I5BB 3UJJL 3MRCA 1FH5H 3L3HA 4YEEA 1CYGA 5J3HC 3BZFB 3GO1H 2NY5C 2VISB 1MCWM 5GS0D 4U3XA 3R8BB 5AZEL 1F4HA 4JN1L 3AY4A 1CG9B 5CILH 3KYKL 3JWOC 4RZCA 2PR4L 5I8KL 1WAAF 1IGYB 3VCLB 4M1GL 5C0GB 4KMLB 5D70L 5TQ2L 3BUYA 4P3WA 3VXSE 4UTAL 3SDAA 4K7PY 4XPFL 1CLYH 4KKNA 3WIIH 1WWWX 4HAFA 2YR3A 4KDVA 4EBQL 3V4VL 1CIUA 1ED3B 3F5WA 1KIQA 4JAMB 4U6VH 4KDTC 1N64L 1CE6A 1KLFA 2P48B 2K3TA 5T1LA 5IR1A 1FORH 4KAQH 5D2NA 1OF2A 3ARYA 3SE8L 3D25A 3TEUA 3PHQA 3OKDA 4M6AA 3VXQA 2CRMA 4N0CC 2O5ZL 5EU3A 1E4XL 1LD9B 2ICES 4OLXH 4KHXL 5J1AA 1QA9A 2LTQB 1P1ZB 4AIOA 3LQZB 1P7QA 3BZEB 2DQIL 3FQWA 3ULVH 4JDTH 4K8RD 4E41D 3QXVA 1P84J 2NY1D 1EX0A 1KGCD 2NY2B 4WV1B 2XIDA 4OFPA 3S37X 3BI9X 2XPGA 1HHGA 2VWEC 2X1QA 1AGFB 2EKSA 4NPYA 4QOKE 4XB7A 1KCKA 2FB4H 1VFAB 5DR5H 1OLLA 3AREA 2F74B 4I2XA 4LCWE 1HILA 1KNOB 3BGFC 3OHXB 1ZHNA 5CMAB 2H32B 2P7TB 4MQSB 3L5WA 3D39A 4OLYL 1P53A 5KSBE 5I1JL 3FFCB 5FO9B 4L4VD 3STLA 5EZJB 4URTB 2X1OA 4R2GD 1DP0A 2C4FU 2ESVE 1KPRA 1T1XB 3B83A 3BKML 4AIZB 1DEDA 4FFZL 4I0PB 1PLGL 4H1LB 1UXWA 1NEZA 1U58B 7FABH 2XN9E 3EJZD 5KANG 2JCCF 2HLFD 1U8MB 2XN9B 3RHWF 3FTGB 2W0PA 2VR9A 3RDTA 3SY0A 3EJYD 5C0AD 4R2GB 4ALAL 5EU7E 3VXNA 3S34L 5GPRA 1MELA 4JPVL 4OZHF 1NFDB 3CUPB 2FBOJ 1RZIA 2V9TA 1RJYA 3MACH 4XI5D 3EOYG 1TTGA 4NRXB 3V0AC 4OIIL 5DD3L 4O58H 5GS0C 4JFHD 3BRFA 1M05B 4FP8L 3HR6A 2UYLB 4LSVL 3GJEB 1NGZB 5C0AB 4DW2H 2C3GA 4J4PD 1DBBH 1MAML 2BSSB 5CBAB 2DQEH 2HTLD 2X70A 3H7BA 2QHRH 3PWVA 4FHBD 1OM3H 5FOBB 4RMTA 2ZNWA 3ZHKA 4S1SH 3MRPA 2DQTL 3FQTA 1RU9L 5FO7B 4UOW1 1QSFD 4KI5E 2ICWI 3PWJA 1AKJD 4HWNA 2HAZA 4M8QB 4YJZL 4K07A 5D5ME 4JFEA 4YBQC 2Q20A 3DUSA 2GK0B 1A7NL 1K4DB 4UDTA 5ESQA 4EUPG 1IC4H 5BO1L 2QSTA 3MBEA 1DBMH 1CDIA 2O5ZH 5HPOA 4EVNB 4HH9A 3MX0A 4F57H 1T1ZA 4IOFC 2K7PA 4XAKE 1NUDA 3X11A 2OL3A 3MV8D 4L4JA 1O5DT 2Y23A 2EKJA 2DYPB 1FZMA 5FGRA 1OGTA 1WAAE 2YPVL 5IB4A 3UTTB 3RX7A 5EOCJ 4I3RH 4ZFGH 5H37G 2C3HA 3BHBA 4G6AD 2GUOA 5D7LE 1L6ZA 3QUZC 5JA9A 4ELMA 3SO3C 1AGEB 1F02I 4RX4D 4EI5D 3P0YL 4KRNA 1QVOB 5JTWA 2ZCLL 1IBGH 5F88B 5T1MA 2FATL 1HYRC 1BFOA 5DURD 5IMOB 2VXUL 3EDEA 3JSSA 4JQIH 3SDDD 4OZGE 3WHE1 5KANI 4LLDB 1DBJL 3K2MC 5J12C 4R3SA 4PRHE 5LJYH 3KPTA 2HJLA 2UZIH 1A7BA 5F1IB 4OLWH 1KLUA 2ZNXA 3I6KB 3KR3L 2P4AB 3EW3B 3SO5A 1E28A 3HNTL 2EE6A 2QR0B 1Y0LB 4JO1L 4PGEA 4PLKD 3KLDA 4WUUB 1FGNL 2RGSA 5ISZA 1HOCA 4LASL 5KSAA 4MD4A 5JMOC 1B4JL 3SGDH 5I1DA 2ZSVA 2BFVL 4GAFB 1SM3H 5IB1B 3ZSTA 4PY8I 2K7QA 3D85B 4GBXC 2WM0A 4XXDB 4UIKL 1H0DA 4KKBC 4L4VE 1JI1A 4S2SA 2AK4A 3MLUH 4YHOH 4UNVA 2FLBT 4S1SL 5FA4B 3D69B 1UWXH 1VPOL 1T3FB 4J1UA 2BCKB 4IRJA 4LPYA 5LQBL 1N6QL 1T0NA 2DBLL 1G9NH 4RGOH 1AJ7H 3K2UH 8FABB 3PV6B 5IBTL 4TNVF 3QCTH 4GAYA 5JW4R 2PR4H 1RK1B 3IF1A 4CRPA 2JJWA 2YS4A 4KHTL 1F6LL 2FEEL 1U8OA 3LZFL 1I7UB 4YWGL 4OLYH 1UM5H 4P4KB 4UTAH 2DQFA 4ONFH 4EI5C 1FVDA 2FYYA 1TENA 1KTLB 4H5SA 5CBEB 4F7EA 3ZKXB 4FFZH 4Y5YA 5D7LB 1JPFB 5C8JB 3FT2B 1ETZA 3HE7A 1OPGH 4Q2ZB 1GOHA 1LK2A 4XC1L 2ZKHL 4KAQL 1YQVH 3QG6A 4KPHL 5E00B 4RMSA 3EYSH 3LQMA 3E6FA 4J3XA 5KSAD 3V79C 1X44A 5E2TH 4U3HA 3QUMA 2D9QB 5IVXF 3BKMH 2J88H 5K9KA 3I6KA 3B2UC 4NC2B 3N1GC 1C8PA 1AE6L 4BSWA 1H15B 3O41B 1NCCH 2FRGP 5DD1H 1ZVSA 4AZ8A 1XF4B 5TPWH 4XXCA 2DTML 4PG9B 5DDHB 4ZD3H 4HWZA 1J11A 4OCWL 2X4SA 1MJ8H 3BP5A 5E2VL 1FL5B 2FGZA 3MGTB 3MV9A 4PJ8B 3IDUA 4I5BA 3I85A 4L4TA 5FKPA 3T08A 3JWDH 3O3BA 3G5ZA 5DJ0A 4CUCA 1V3MA 4LRNH 1EXUA 3KPSA 5B21A 1U2HA 3TIEB 2DMBA 3VFVB 4KROB 2VDNH 3ULSB 4GRMB 1YN7A 5SWZD 1IGCL 4NHCL 2XN9D 1IZKA 3HPJA 1VACA 1IJ9A 1X4YA 2R29L 2X1WL 5DXWA 1ZWIB 3HUJB 3WJLA 1JF1B 4LOUC 5TDPA 2O5XL 4M1DH 4MA1C 1UXSB 4Y0GA 2C4XA 3GJFA 3HMXA 5I16B 2BXZA 4HIEB 3B2VH 1RQ5A 4O2EB 4LF3A 4FG6D 4OZ4A 3HI6L 4M1CC 3PHQB 1JRHL 2DAVA 4LLVA 3VXMD 4BFIA 5E5MB 4HKZA 4Y4FD 4Y2DB 4QRUB 3QP3A 3H9HA 1A14L 2XWTB 4B41A 4B7LA 1JPFA 3MNZA 1JNLH 1SEQL 3G6DL 3PDOB 1YN6A 1FZJA 1AO7D 3MRNA 5I15H 4H26A 4TVSa 4WO4C 3PG2A 4OZIA 1HHJB 2WBJB 5ERWB 1KOAA 2G75A 3W5MA 3WV0A 5I71B 1VGEH 2JJTA 3WS3A 4NZRL 2NXZD 3SBWC 3D2UB 3OG4B 1A21A 5EPMB 3B43A 4Z8FL 4OQTL 2OZ4A 3SOBL 1B0GA 1AFVH 3TBYA 3A6CH 2C7UA 4KV5F 3UTZB 4EI6B 3L5WB 1H3PL 3O41A 3QCUL 2B0SL 1SVZA 4P5TD 4X6DB 1MJJA 2ICWA 3QDJE 4OBRA 3GSWA 2R56L 3EAKA 5JXEA 4YQXL 1D5MB 1M4KA 3T0BA 4X9IA 3TJEH 1U6AL 3MBXL 2WBKA 2Y25A 3NFNA 4ZO7A 4ZPVB 32C2B 5DD1L 2B20A 5IFHH 3FQRB 1ZAGA 5A40E 1D7FA 5DRZB 2I25N 3TVMB 1S9YB 3LSOB 1OL0A 3RTQC 2SEBA 1MFCH 4PTTB 2C9AA 5EG6C 1MVFA 5D1QC 1QSEA 1Q9LA 3HC0A 4P5KA 2EEBA 3VFGL 3TYGL 5IFAL 1CFNA 4YNYA 1HXYA 4Y4FC 2V2TB 3TCLB 4ELKB 1KIPB 1CQYA 5HHNA 5I18H 3P9LB 1G9NC 1MOEA 4RGOL 3HZYB 5D7KD 1T21A 1T2QL 5GRWA 3P4LA 4WIQA 1EERB 2D7TH 3MLZH 4GS7C 4MAUL 5K33A 4KU1A 3KS0H 3K3QA 5GS0L 2X70B 1GOFA 1SYVA 5TFSL 3L3KA 2CIIA 2F19L 5IOPB 1AJ7L 2UUDH 3CFKA 3VWKB 2FBJH 1B90A 4HX1B 1FZKA 1P9MA 1TZGH 1U3ZA 4UI2A 3ZYIA 5JPMA 3D87B 5IHUL 5CLTA 3DGCR 3VH8A 4JFDA 4NBXB 1V05A 3FCTB 5MENA 3C87A 3C6SB 5HGAB 2BC4A 3D0LA 12E8H 4HK3J 1ROWA 4KGJA 5GGUB 1MLCA 3D18B 4LSTH 1NC2B 4R7DA 4LPUA 5IHZB 2PYED 1G9MC 2CDGB 1F3DH 2XOTA 1I4FA 4HWEH 3RNQA 4HEPG 1KJVA 3PNWA 1QBML 5L2KD 2D7NA 3IFPB 4EOWH 4JHAL 4U1IA 1AO7B 2HVKB 1PKQE 4EDWL 1T03H 5C0BD 2E7LC 2APWA 2IAMD 3BH9A 4X6DA 4U2YA 3N1FC 2NTSP 4ZFZA 5C0AE 5E08L 3RPKA 3QXAB 1MQKH 4P9HC 3DUUB 4JDVB 3QCTL 2EDYA 1NMBL 1WWBX 5C6WH 4JKWA 4R7NB 3WXWL 2X4RB 3B9DA 3CFDB 4WGVB 1IVLA 4YE4L 3L5JA 5HD8D 1FFRA 1NCCL 4PV9A 1TLKA 2H32H 1A6VL 5ETUB 4NQCE 3FAXA 5E8OB 3O3EA 4R9HA 1IKNA 2AEPH 4FXGB 4HJ0C 2ZP0T 3HAEB 4X5WA 1CD8A 4PJDA 4JZOB 3Q1SL 1NBYA 1YDPA 4XC3L 3JZ7A 1BEYL 3UPRB 3RQ3A 3QUYC 4AQOA 3P30H 5ADOH 3LKOB 1CGTA 1HOCB 2XTLA 3NCMA 3ZYOA 5FUCE 3DETC 1BQLL 5D7JD 3L3KB 4KJWC 5C08E 5IMMB 2GCYB 4GAJH 3C60D 5A2JH 1N3NA 4L8DB 3BT2L 3PWNB 5J0BA 2FZ3B 4LVHC 4I18C 4ONGH 1A4KA 1GHFH 4ZO8A 2ZUYA 1WC7A 2HT2D 2R1WA 2WUCL 5SWSB 2WIMA 3D18A 4R7DB 5HGHA 4RZCB 5DVOA 1Q9OA 3BVNB 1EEYB 4OF8A 4YFEA 5FYLE 2WQ8A 3SQOL 3B5HA 2EDBA 1XGTB 1YZZA 3OKOA 3JVGC 3T1WA 3W0WD 3H3PH 4NZDA 4NM4L 3U79A 2P5WE 2DLTA 2FR4B 3W9DB 5IM7B 1PBYA 1ZHKB 3SOBH 3NCYP 4XCYB 4TTDD 2DM4A 5FAAA 3CZJA 3BH9B 1CXHA 4N0FB 1CL7L 3BIKA 3ZTJH 3PWPA 4F9LA 3QIBD 1UM6H 3MBED 4PP2A 4WEMB 5D2NB 1XIWB 4N1CA 2B4CL 4ONOA 2YPKB 3EDJA 3NZ8B 3VFWA 4GKSA 4ZSOA 4G8GA 3EFFB 5HYJB 3VWJB 3SKOB 2IPUG 4G6JH 4FQPA 4JO4L 2DMCA 5M95B 1NCAL 3PQYA 3TBWB 1G1CA 2Z31B 4CMMA 3MLVL 5HHQB 2R8SL 1VB9A 1NANI 5CINL 3HG1A 1A1OA 4H8WH 5EWIH 3ZDXE 4HXAH 2D4DA 3NIFF 1CFVL 4Z7WF 2LU4A 5I15L 1OCWH 2DLEA 4F7TB 1ZHNB 4J6RH 4NNPH 4RMWA 1KCSL 4MA7H 4XP1H 2O5YL 4PLJC 3RBGA 3OL2A 5EULV 1HZHH 3EOAB 3WFEH 2ADGA 1B9ZA 3E2HB 1KPVA 4X7DC 3MACL 3WNMA 4Y1AA 4J23A 4KTEH 4LEOA 4Y1AE 5DJZB 2GCYA 5FKAB 4HCRH 5I1IL 1DQTA 1LMKA 5C2UB 3HKFA 5GS2D 1JWMB 4NKMA 2DI8A 3DX9A 3ET9F 3LRHA 4HH8A 1T22A 4ZQKB 4PB9L 4X8JB 1Z0NA 4JM2C 3KPSB 2FLRT 3QI9B 2CUIA 4LKXB 5F7NC 4HS3B 3T0EA 1LNUA 4FN0A 1FFOB 4KXZH 4LCUB 1R3HA 2GJ6E 1QRNB 1IFHH 3C8DA 5AD0B 4AJ0A 2WIIB 4JM2A 3CAFA 3QJFB 3ARRA 3R06B 3GIZL 1G9MH 4Z95H 2GTWB 3QIBC 3ZMRA 3QWQB 5CUSH 1K4CB 4OBSA 2I9TA 1RVFL 2JB5H 3O6FB 1MCLA 5L2JA 4XGZB 3M07A 1ERNA 2IMNA 1HSAB 3O6LL 1QFUL 2X1XR 1G7MA 4TSAL 1S9VA 1KTDA 3ELAT 3EO1A 4YIQB 3DYPA 3U6RA 4IRSB 5F1KC 2XWTA 5I71C 5C9KA 2ZUSA 5FYJH 4P4RA 4P59H 5CS7A 3QRGH 3VRLE 3RKDC 5DZOA 5AYUH 3K8KA 1A6AB 1CR9H 2RR3A 3U9PH 4O2FA 1IC7H 4XB8A 3G6JE 1DVFC 5JXEC 3RUGF 1CFSA 3NA9L 5GZND 1WUNT 5ID1A 4QY8A 5MERB 3T65A 4K8RL 4OFIA 3LS5L 3O6FC 5DEFB 1J5OH 5LXGL 4X6EB 1BFVH 4JDTL 5D7JB 3TPKA 4N5EC 3IDNA 4M3JA 2GT9B 4DFHA 5HTSA 3GIVB 1T1ZB 1Q0YL 3FO1B 4F7TA 4KDTA 5C0CD 1KLGA 4GJTB 1XGUA 3MRDB 1U8JB 3L3IB 5D9SA 4YEFA 4JM2D 1WWAX 5EZLA 4DW2L 3TN0B 3SJVE 3LN9A 3TVMC 1B6DA 3TVMD 5I1GH 3IDMB 2EXWD 2HN7A 3KPLB 5FKAA 5EORH 5JUEH 2KBGA 3RL1A 1MAKA 5KVDL 1Q94A 1EJOH 1MFNA 1QR4A 3LKRB 5CZKA 2RQ8A 2GAZA 4JR9L 4RGNB 5FM4A 3WJLC 2YD6A 1EFXA 2H2SD 3O4LB 3KHOA 4D8PA 2AXJA 3AB0B 2XZQH 4LDEB 3MNVB 4IDLA 2Q1EA 3QDGD 4NO0D 5EB9A 3V95A 3BQUA 2VLKA 5C92A 5BZWB 5EBMA 4TTDC 4HUVB 5LGKA 5F9WC 2ERJB 4NWTH 4NUJA 1A5FH 4ETQA 4MA1B 2FX9H 1Z9LA 4DK3A 3CD4A 4GRLD 4LVNC 3I75B 3IFOB 1K4CA 3DVGB 4JQXA 3T4YB 2D0GA 1A6VH 2CR6A 3P4OA 5IJKC 2QHRL 1Z9OA 3KPRA 3TH3T 4U1NA 1WZMA 4I9WE 3CIQA 4FQ1H 2P44B 2WAHA 4JZNB 1ZLSH 3AB0C 5H94B 1U8HB 4IIQC 1ND0B 1AR2A 2DLFL 4J8RA 2ZSVB 1KEMH 3TT3H 3HB3C 3QCVL 1DBKL 2DMKA 3SBWA 5C2BL 1FBIL 2EIEA 2L7UA 4XVSL 3MRRB 4WO4B 4M1GH 5FO8B 4Z76B 3QPXH 2PYFB 2YUVA 4WU7B 5C0CA 2FH6A 3RGVB 1GAFL 4F9PA 2BMKB 1MWAB 5ITFB 2NY5L 3MV7A 5I74B 4QRPD 1I8LC 2UY6A 2H1PH 1EUUA 3TFKC 1Z5LA 4HIXH 3NA4A 4X80H 5JHDB 3BP7A 4H8WC 4DCQB 3DJ9A 1VFBB 1EGJA 1FORL 2HVKA 1KCRH 5IVZB 8FABA 4RFOL 4KMTH 4M4RA 2BRRL 3VFPB 5JW4M 4O2CA 1OSZB 1I85C 2EDJA 4OKVB 3TBVA 2A6DA 5T3XH 2AV1B 2BVTA 4RRPG 5LWYL 2CKBB 5IGXL 2EIDA 4OCRH 5BZDA 4GRLA 3H3PL 5L2KE 1NL0H 1HHIB 1AO7E 2BFVH 3OKDB 1EHLL 3MNWB 1I85A 3P0YH 4YC2C 5I1HL 4ZXBA 4K7PH 1JGDA 3CFDA 1LHZA 5HYSA 3GJFH 3HMXH 2A83B 2HKHH 3RTQB 5JOPE 2DRUA 1CD0A 3ARBA 3G9AB 3U4BL 5D6DA 3VI4E 4NRZA 2B2XL 1NAMB 2OZ4L 4XCEA 5E2VH 4NDMB 1RZKC 1HYSC 1JK8A 1O7SA 4POUB 4LARH 5BVJB 5I8CB 5DVKA 5KSBF 1LEGB 3MV9D 4OT1H 5FGCE 4FZEH 3BN9D 1IEAA 4GQ9L 5IVXE 5GRJH 3U2SA 4I2XB 1PEWA 2ATPB 3RRQA 4OM1H 5CJOH 3IJHA 1ZVHA 5HHPA 3ZKQD 2DQGL 1H15A 1BAFL 2D0FA 5KSBB 4L4TE 5DZNA 2V5YA 1WFNA 4XP4L 4MLSA 1C08A 1Y6KR 5GGTH 2F15A 2GQHA 1MCDA 4ZDHA 2X4TA 4Z95L 5HSFA 4AYFA 5K59F 4Z7UB 2D4FA 4WFED 4UQ3A 1OW0A 4M03A 4G43B 3U82B 3NCFB 4G9FE 3ZE1F 5DQJA 5CAYB 1CFQB 2FHCA 4PPTA 4H88L 1J1XL 2R4RH 3EYOA 2R2BB 4JE4B 2V9QA 4HIJA 5L8JB 4NC1E 2NY3D 1LEKB 1NBVL 5F3HA 2HFEA 2GW5A 4M61B 3WIHH 4LLUA 3VFTB 4ZPTA 4MA3B 3VA6A 5HHME 3TT3L 3O6LH 5HHMB 1CFTB 4YGAB 1JGEB 3OKOB 5EZOH 4QHMB 1GSMA 4P2RD 5HYFA 1JHKL 5E8DL 3FB8B 2NX5E 2X9WA 4QHKI 4BELD 1AD9B 2ESVB 5DFVC 3RUGA 3N50A 5MP6L 3W81A 3CDGA 4MZ3A 1LO2H 2DL2A 1U3HD 4LLWB 1XF5A 3D39D 4RAHA 4XCCL 3PE9A 4PJDE 4M7LH 4BQBA 2GSGA 4GAGL 3MV8E 4FMKA 2CJUL 4NO5B 4G8GB 5HYJA 1YQVL 4XPAH 3IVKA 4HV8A 1DVFA 5HYSB 4KI5C 1MCQA 5LGHL 3MREA 4PRAB 5C0FA 3MXVH 5DMKA 3UC0L 2V9RA 4K94C 1P5VA 2B4CC 1LP9B 2NNAB 1NFDE 2WANA 3MFFB 1SJHB 5HHXL 2J88L 1NJ9B 4D0CB 2ZCKH 1DFBH 4KKAC 1OY3B 1NAKH 1OAZH 1AGCA 2YPLB 35C8H 4NOFA 4M6ML 5J12B 3QRFM 1RHHA 4ZS7H 4KI5D 5CJQH 1JGVH 3DUHA 3G08B 4BH7A 3OKLB 2OQJB 5FYJD 3QI9C 3MXWL 5D1XB 1R3LB 4PJ7F 3QXDA 1TPXB 2ED7A 2N4IA 4HK0A 4J3OC 3E8UL 5I30H 2F8OA 5DJCB 4HLZG 1QLEL 4NWTL 1C5CL 1KJ2L 2J8UF 4HUWA 1ZT1A 3ROLB 2GUOB 2X44D 2OK0L 4P5TC 3UTPD 1LK3L 3PV7A 1G7HB 2JJVA 4JB9H 3ARFA 1MRDH 1WBYB 3QR2A 1PQZB 4M6OH 4OSUL 1QPXA 1OD9A 3TNMA 2NY6C 3C60B 3MRBA 1YPZA 4JFYA 5IMOA 1JTPA 3ARGC 4XVSH 1RUQH 4AENB 1TZHB 3RY4A 5GJSL 3QUXD 4LPTA 5FECA 4KV5E 1FFQA 3QHFL 1FO0A 3B2VL 5J6HB 4Y8DC 5KZCD 1OW0C 2OBGA 1J0YA 2I9TB 4BQ6A 1N4XH 4LHUB 4OLEA 4PGCB 3I02B 3KPNA 4R90L 3HAEG 4GRWH 4IIQA 4UAOB 3DO7B 3H42L 1KC5H 5KSAB 2FIRT 4Q6YA 1A0QL 2VL5A 2Z0BA 1QFWI 3NFPB 3LHPL 1M71A 1QBLH 3LQAH 3FQXA 1WAAA 4X6FB 1CVRA 1EDQA 4UV7L 3IDIA 1BMGA 2IFGA 1LWRA 1I3GH 3ZKXC 5EIIA 4NYLB 2R39A 1FRGL 4RFOH 4Y8AA 3K8LA 1DLHB 3FT3A 3GGWB 1IGYA 3MJ7B 1LE5B 4BJLA 4KK6D 1IM9A 1I3RA 3BUYB 2XQYK 1GJIA 3SDAB 4E0RA 3T0ED 2OL3H 1T0NB 1P7QD 5E6YA 1BM3L 2AJ3A 1S9KC 1W8OA 4Q9QH 1XGUB 3UC0H 3TGXA 5GRZA 4K7PL 3IF1B 1AGBB 3P77B 5EZLB 5EN2A 4Z7NF 4RGNC 5C09B 4JAMA 4KJQC 2AEPL 3UJJH 1BOGA 5ICZA 2BJML 2YRLA 3CFEA 1XEDA 3FN3A 2VZVA 1JZ4A 4XP4H 4JZJA 5HXMA 4GW4A 1FSKB 3S5LG 4X6CF 3MJ8A 4MXQD 1IZJA 3S88L 3QAZC 5C0CE 2IPUK 4PV8A 2P5EA 2GAZB 4KZDH 1CGVA 5T3XL 3CU1A 1F2QA 2CH8A 1GZQB 3F65A 4FQ2L 3T8XB 4W6WB 4DGVH 3WIFA 2FO1A 2ESVD 3QUZD 5GISH 3DXAA 5EBMB 2BVOA 3V4PH 1NBVH 5E8EB 4LVOC 4PJGE 3CUPA 1NFDA 2R0LH 2IAMB 2EDOA 4M8VA 5I18L 1DQDL 3GI9L 1XR9A 3OWEA 4MSWA 5KG9A 3QDMD 5J6HA 1NUNB 2DTMH 5CMAA 1NBYB 4R8WL 3SDXA 3UAJD 2VH5L 3D39B 4TNWK 2ITCA 4JHAH 4YGVA 1I9IH 2X4PA 2VXTH 4L9LB 5JHLL 5KW9L 3VMNA 1XF4A 3FHAA 4P3CL 1N5AA 4Z7NE 2EDRA 3UMTA 4JFZL 3ZTNL 2XG5A 5FOBA 1BJMA 4XPHL 3P11L 3QT2A 1PD6A 3NGBB 3RKDD 2NLJA 1YC7A 4L8DA 2Q87A 4QHUB 3RWFA 3VRIA 3O8XA 4MJ5B 3CVIL 1A7RL 4LLMA 3ULUD 2EDFA 4R90H 3D9AL 3SY0B 2APVA 5FYKH 5HYIA 2W38A 5CZXD 3MV7B 4XPTL 4UV4L 1NCTA 4K94H 1RUAH 2YWZA 4U0QB 1EFQA 5I1LB 2AXFA 5JMRA 4CDHA 1MWAL 4JG1L 2FEDD 4U6VL 4ZS6D 2AKRA 4FRWA 2W65A 4JJHA 4MNGA 4O02H 4ZTPL 2HLFC 3GMMB 2AXHA 3KXFA 5IFJA 3VE0B 4OV6F 4QXTB 4OLXL 5JZ7D 3X12A 3QDMA 4P2RB 3ZE1E 3V9FA 1OCWL 1YEGH 3CXHJ 4W68A 4BUGA 5JQ6H 4X99A 4XMLH 2MCG1 4A2LA 5I1AA 4G42B 3ZE2F 1T20A 2YK1L 1J12A 4NNXA 4A6YH 5B22A 4Z8FH 2EH8L 4AK1A 4GKZA 5IEKA 4IJ3C 4FS0A 1QVOA 3C08H 4IMLB 4WDIB 1MAJA 2J1KA 1X3DA 3C2AL 1A7PH 2DLHA 2CK0H 4FP8H 1BQUA 1WWCA 2G2RB 4XBGB 1OHQA 3RY5A 1NDGB 4AEHH 1KB5A 2QLVB 4ORGB 1UJ3A 4QWWC 4NM8L 4Y16D 3GJFK 3F7YA 5SWZA 4BFEA 1MJUL 4U1LA 2IJ0C 3MR9A 2R56H 4WI7A 5EC2B 1Y0LA 5E1HB 1WFOA 4X9GA 4L9LA 5CGYC 3L6FB 2DYPA 3KG5A 2BVPB 2YD7A 4WTXA 3NCJL 4HFWB 1PX4A 4NBYB 5ADOL 1JPSL 5LBSL 1M1SA 3DV6A 1YEIH 2GJ6A 1U8NA 2NY0C 3DRTB 4LP4A 4K3GA 1U8KA 2AGJL 1PG7W 3LIZH 3LQAC 1MFCL 5JW5B 5DRXB 4OGAD 2UWEF 4JKPH 2JB5L 1DBML 2FEDC 3MPCA 4Z78B 1W0WB 4O5LL 1RFDH 4PJEE 5I1CL 5CLWA 4F8TA 4DAGL 5FA3A 3MV7E 5E0QA 4HKBA 1BFOB 4X7EC 2PTVA 5FFLA 1BJ8A 1DN0A 3FO0H 5I76B 3RNKB 4MAYA 1C5DA 4Z0XA 2KDGA 5IK3A 2AQ3A 3EOTH 4LFHD 4UUJB 4ELMF 3ULUC 3HZVA 1CLZL 4OF7A 1INQA 5DS8A 1T80A 4MD5B 4ELKA 3GMMA 1D6VH 4K71C 2HYMA 4YBLC 5DLMH 4MAYC 4Y5XA 3OKMB 3QH3A 4JQVA 4P4KA 2VRAA 1PYWA 4KUCF 1UGNA 2Q7YA 1R0AH 2A6KB 3CSPA 3GMRA 3FQUA 3MLRH 3IFLL 4YHLH 2NY2C 2E5EA 2Z8WC 3U6RB 2OR9L 3QNYA 2AJSH 3FQNA 2D7QA 5J1AB 3OX8B 3QQ3A 4XXDA 3FQWB 3VGHA 2OJZL 4HUXA 2E8ZA 5KSUB 2F5BL 3A0OA 3BKJH 3MUHL 3VFSA 3E6HB 4HT1L 1V8HA 5D1XD 1NJ9A 1G9EA 4XCNB 1HYSD 2VAJA 4WFHE 3VMPA 5CGYD 3G5YA 1QSFB 1TCMA 1T7YA 3RNQB 1R3KA 1IAIH 3PNWB 1AXTH 5BCAA 4L3EB 8CGTA 5E08H 4ZXBD 4PRDB 3V4UL 1CLCA 5EC2A 5JORA 7CGTA 5EUKA 1AO7A 3HC4L 3VXPA 1F00I 1ZGLP 1CDHA 4U33A 3EZ8A 1YEEH 3EO9L 3RWCB 2XZZA 3MJ9H 4NQDA 4OD2B 3HNSL 1U8NB 1E4XI 5T1KB 2NY6B 3T2QA 1QSED 4H20L 4XNZB 4HMCA 3C5SA 5JOFB 1JNJA 4GG8B 4PY7A 3QRGL 1HH6B 2DJSA 3O8XC 4QRSA 4KTEL 5DEZA 4Q2ZA 1KCLA 3GHBH 3MV8B 4LVHB 1RZ8B 2FWOA 1TJIH 1OGAE 3WE6A 1A7RH 4U1GC 1JTOA 1YPZB 1A6ZB 1KEML 5D5MA 2DQHL 4CVUA 1WCBA 2QQQA 3KNBB 1Y18A 4AENA 5F6IB 3BO8A 3N9GL 2F53D 3SCMD 4N5UA 3EYQD 1CLOL 3MQIA 4NWUL 1U3HA 4L8BA 3LY6A 3WHE0 5ACMA 2WWMD 4KK9D 5IMKA 4Z7UF 4RNRA 1RK0B 3CFCL 4FFWC 1UA6H 2DKUA 1CICC 1EO7A 2Q86B 1DL7H 1ZGLB 4H0GA 4YX2L 1BZ9A 3EHBD 4YPGA 2YBRA 2AJXL 1AHWA 4QRUA 1B0RB 4XAWH 3MGTA 4L8SC 1DQLL 3IAGC 3MO1B 4ODSH 3ZT6A 3QIUC 4LPXA 3QUXC 3P73B 5CEXB 3E3QC 2I5YL 4HUXB 4XMLL 3HLAA 4FQLH 3WN5B 3B4NA 4OV5A 1YYLL 4NZUH 4ZS6C 2P24B 1DDHA 5E99L 1AD0A 1CE1H 3MGAA 3MJ9A 3KYNB 3E0GA 3HCVA 5HDBE 4PJ5B 2MNUA 1TITA 3MODH 3D9AH 1PDKA 3T77A 3HUJA 2V7NB 3SQBA 1S7XA 1A3LL 3F7RA 3F7VB 3IRZA 3L5HA 2BK8A 3TIDA 1FFPA 2B2XH 3BP4A 4TNWF 3VD7A 4JPWL 1FCGA 4PJCA 2AS5M 2AV1A 1ZLVH 3HNVH 4UOW0 1XR8A 2R4SH 5I19L 3OJMB 4AIXA 2V7HA 2FSEA 4I3GA 1I7TB 1FN4B 1IC4L 3GSUA 1IL1A 1VHPA 1F90H 1N5YL 2YPKA 3EYSL 1MCSA 1FBIH 3MNZB 2CDEA 5C3TA 4L8CB 1JFQL 1U8LB 3UZVB 5AUMA 4QXGH 5DRZA 1RZ8A 2FWOB 1FAIH 2CKBL 2NW2B 3N1QC 3DHMA 3DGGB 5F88A 5C3LD 2LV4A 4ZAKB 5B3JF 4NO2B 5D5MB 1AE6H 5MEOA 4DZ8A 5F3BA 5CFHA 4CMMB 1Y18B 4N0RA 4XCEB 4XP5L 2MCPH 2IMMA 3ZL4H 5F7MC 1U3YA 4Z7QF 4DVBA 4ZOEA 3KLAB 2HVJA 4I3RL 4ZFGL 3DX7A 3GMOA 4DAGH 5IMKB 4WY7H 5JIHA 1H8OA 2VWEE 5JOPD 1KIRB 4XX1G 1ACYH 2MSPA 4OD3H 4POYA 1UVQB 3OKEA 4W6YB 1EHNA 4Y5XC 2ITDA 1SJEB 3ZHDA 1KPVB 2CIIB 5TJWK 3SE3A 4XP6L 4CNIA 4TNVK 4LDOB 3FT4A 3O3DA 4N5ED 3TF7C 3DWTA 4F2MB 3W0WB 1LO5B 3MO1A 3H0TB 5DJDB 3RY6A 4LNVA 1CK0H 3WUWA 1REIA 4JRXD 3T0DA 1JV5A 3OB8A 4KGLA 2VB5A 5JQHC 3QYCA 2HKHL 5GGRA 2R29H 5FXCH 3S35X 3WHXA 4ZNEE 4LCUA 1N6VA 1IT9L 1FAKT 3BKJL 1MY5A 4FNLL 2EH7H 3KJ6L 1PY4A 4D0BB 5F1OB 4MNGB 2RHEA 2AJSL 1LDSA 2OSLB 4M93B 3TIDB 1Q9WA 3WUZA 4Y4KC 1X5KA 1WQVT 1MVUA 4G8GE 3WFBL 4OLZH 3VGEA 4UT6H 5DD5H 1GRWA 3OKNB 1L7IL 1OAYH 4QXWA 3QXAA 2DIAA 2UWEE 2MQ0A 1XF5B 4YXHL 4LCCB 4RCAA 5FIEA 3D0VA 3IDGB 4G7VL 1P1ZA 3BZEA 4F7MA 5IW6A 4R7NA 1V3LA 4J4PC 4C4KO 4PB0L 1BD2B 3EO9H 1Z2KA 2HH0H 3MOAH 3RHWK 3V5HA 4I0PD 1TETL 4WWKB 5DMKB 3KDMA 4I77H 4NO2A 1SYSA 2NXZC 2BERA 4LSUL 5I1HH 4DQOH 1ZE3C 1M7DA 2CDGA 1RZ7L 2YN3A 1WISA 3FFDB 3P0VH 4R0LA 5I9QB 5KSVB 1RZFH 3BEVB 3SKUD 4P46B 5SWZE 5BOPA 2P5WD 4FFVD 5E4IA 1W72H 3WFHB 4HT1H 5EORL 5JUEL 5EOTB 3O2DH 1E4JA 5D70H 1ZVSB 4U31A 2PXYB 4EQ2A 1U8JA 1U6AH 1HDMB 2D03H 4NQCD 3WIIL 1RJCA 1RUQL 3QEQB 3FO9A 3HI5L 4F7PB 4HJJL 4RGMC 2C1OA 2JCCA 5AZEH 3DVFA 5EUOA 1QR1A 4U6XB 4LP5A 3SDCA 4ZMAT 1Q0XL 4ZUTB 1MQ8A 4V1DA 4XAWL 1FSKC 5EDXA 1JE6A 3TP4A 3IDXH 2FO4A 4BKLA 4GXVL 4M5ZH 4QHKJ 3ALPA 2DKSA 5TE7L 3SJVA 5FA3B 4DEPC 4M02A 5I73C 1CBVH 5C08D 5EA0L 4NCDA 4S1RH 5AYQA 5HJ3B 5H2BA 2R15A 4TUKH 1YYLH 4MAYB 4APQC 3MRBB 3L7FB 1PX3A 4JFYB 4PBXA 5IEHB 3S5LB 4NUJB 2E27L 2CKNA 1NCBL 1TZHA 1I1AC 5TDPB 1VADB 3KPOB 5CHNA 5GRYA 5FYLL 3RWJA 2E6JA 1DUZB 2HJFA 1JWSB 5D72H 4AH2A 2DQHH 3LV3A 1RIUH 5E6IA 5E03A 2E7HA 1JL8A 1H9VA 2A6KA 3PGDA 2B1HH 4L9LC 1PFCA 4N8CL 4OZGB 4Y16A 4G9FD 3INUH 3H7BB 1KTRL 5FM8A 3QEUB 2V2XA 3NAAL 3PWJB 1GOGA 4X4ME 5LCVL 3MXVL 1QEWB 1DE4B 5AG8A 4IS6B 5I1KH 1W0VA 1I9RH 1YN6B 1I1AB 2GSIB 4UDTB 2ZPKL 5ESQB 4NYLA 1LK3H 3VG9C 5DHYB 4XBPB 1MWAA 5ITFA 3AROA 2GY5A 4XVTH 2OI9C 4N0YH 1ES0B 5ID0B 4YHMH 4M4PA 1Q38A 4EVNA 1ZHBB 4S0SD 2Z93B 5E2UL 5IUSA 4GG6E 5TE4H 3BP6B 4G9FB 3F12B 4K23H 5E8PA 1UACH 1G7JB 1HK6A 3V5DA 2VE6A 1OAKL 4YK4C 1KJ3L 4NQDB 3O6KH 4XNQB 2H45A 4G6ML 4GRLB 2VQ1B 5EO9B 5EUOB 1D5IH 4L29A 5IB4B 5EU6B 1NSNH 2NQCA 2X4UA 4MDJB 2PW1B 4RAUA 1OAUL 3BKCH 3FB5B 5GRUH 3VWJA 3DYMA 1ACYL 3F58H 1G6VK 3ARDC 2A83A 3T0EB 4G7YL 1OARL 4HUMB 1UKQA 1HXMA 4XP6H 5T1DL 1A6ZA 3QBTB 3BN9C 3KPRD 4JKKA 3CH1A 2CMRL 1YJDL 3PJSA 3GUTA 4GS7B 4JFQB 4CVZB 1Q9LB 2BVOB 5MENE 5EIQA 1I7ZB 5IEHA 3QUKB 2O61B 5I8CA 2EC8A 1OTTD 1YPZF 2A73A 2JJUA 2IALB 1HXYB 3S35H 5BV7H 2V2TA 2OMBA 1OGAB 4XH2A 3UTQA 4ZNCD 1EMTL 1T2JA 1A9BB 1P2CB 2WSKA 4KRPC 2P43B 4NJ9L 5DZLA 3WNKA 3IU4L 5HVWA 3OR7A 2XFXA 1EEZB 2ZOKA 3PGFL 3W39A 2GY7B 5ECJE 5INDB 2IH1B 1SYVB 43CAB 1P4BH 5CKGA 2BJMH 3HG1E 4P2OD 4Z7UE 2VITA 3ZZ1A 2NY4B 3AS3A 4JHWH 3WS6A 3VRJB 3MLVH 1I1AA 1CI5A 4FXKB 3BZFA 4UT6L 2R2BA 5DD5L 5EOCH 4LSSL 1GGUA 2P24A 4KKBD 5HDQH 1FL6B 3HFML 4NBZB 3IDYC 4ZODA 1EBAA 3VXRA 3AMKA 5I66B 1K8IB 4S2SB 2B8OT 4DN4L 4XVJH 4X98A 4ODUA 4XPGH 3WNPA 1V3JA 2CK2A 4JHZA 4D9LL 3R06A 3IFPA 4DQOL 1G6RB 3HUJE 3F12A 1MCFA 1V3KA 4HWBL 4A2MA 1A7NH 3PV6A 3GBML 3V5DB 4OI8A 3FOLA 2OTWA 1KPUA 2FJFA 2WUBH 3D85D 5KOMC 2Y06L 1UWEL 1HSAA 4K3EH 3FZUC 4WHYH 3KPLA 1A9EA 2YRZA 5IROA 4JDVA 5BOZG 5ICYB 5TE4L 5I74C 2XXMB 1J0HA 1NBQA 2PNDA 5LVEA 3HRZA 1G0XA 1R5VB 1S5HA 3WFBH 3UYRH 5LGJB 4WTWA 4DKEH 4JFFE 3O3UN 4P2OA 4PV9B 1XGYL 2DM2A 2DBJA 4OF0A 4J3WA 3DARA 4LCYB 3A6BL 3PWPE 4J2XA 2DLIA 5E8OA 4KZDL 2E9IA 4HUVA 4KJPD 2GITA 3QEGH 2NX5B 1YDPB 1FC2D 3QO1B 1JPTL 1W8NA 2OJEB 4HMEA 3R0MA 3ZO0A 3OHXA 1QKZH 4TSAH 4PJAF 2JJSC 4G9DA 3QWRD 4DJMA 3U0PB 4XTRD 3H6JA 4WENB 2EE9A 4BQ9A 4W4NA 2BVPA 1R3LA 1S3KH 1E4WH 3BIAX 1G0YR 3FT4B 1OSPH 2PTTA 4QLRA 4YWGH 1NEZB 3L3DB 3U0WH 3W11C 1E6OL 4UDUA 1CU4H 3ZKND 1QFHA 4KTDH 3SGEI 4JFZH 1Q1JL 4R96B 5F44A 1MPAL 3DSNA 2R1WB 5E5RB 4M7JL 5IV2B 2F58H 5IVNA 1QLFA 5FUOL 3BQUB 4ODXB 4MNQB 3FRUB 1UT9A 3C2AH 3VFRA 3RNKA 5IB5A 4N90D 4ZUWB 4MXWH 5JXED 2Y72A 5D1ZD 4JFFD 3O3AA 3OAZH 4OF3A 1L9NA 2O26U 4MCYB 4M9PA 1ZEAL 2CRYA 2Q6WB 2AJZB 5JA8B 4XZUB 3RBSA 4HKZB 5BZDB 1HQ4B 3S36L 3PXHA 2YEZB 4D9LH 4MDIB 1XIWA 4MD0A 5J6GB 5F6HI 1GPOH 1BFTA 4PJAB 2R8SH 3CZFB 3U7YH 4C54A 1YY8B 4WO4A 4X5LA 4JFFB 3NN8A 3PQYB 3TBWA 3W82A 4TOYL 2J6EL 4TULL 4KVCL 3EJYC 1MCEA 5DK0B 3SO3B 3QEHA 1O0VA 4LLYB 4HF5L 5ENWB 1RD6A 2WBJA 5ERWA 2CQVA 3PDDA 4LCWD 1I9EA 1NAML 5BVJA 1YJDH 2EDXA 3S7GA 4I1NB 3UYRL 2C26A 3RTQD 2OJEA 1BQHA 3JTSA 5F8RC 5ANMB 4RWHA 1JPGB 5KSBA 1EMTH 4BK5A 4O9HH 4PG2C 4JLRB 1N26A 4Y4KA 2J8UB 2OP4H 1IBGL 4NZTL 1HINL 4YDVA 3RFZC 4QWWD 4FQ2H 3WNNA 2VLME 3AUVA 1KB5L 4ZXBB 3DRQB 5JOFA 1KN2L 4GUPB 1F6AA 3BFOA 2BDNH 4OCSH 1CFVH 1JHLL 1E27A 4YDLC 5FGBC 1HH6A 4K7PX 3WMSA 2KL6A 3UTSA 3T2NL 2HFEB 4M61A 3LOWA 4TYUA 4WEBL 1IGIH 3IXTB 1CFBA 2J12B 5AD0A 2SEBB 4LSPH 2IANB 1QUNA 5DJYA 3BAEH 5J57B 4YHOL 1QSEB 1VADA 2B7DT 2MJWA 2NY1B 5EOQH 1JWSA 1UB5A 4NKOA 1Z0MA 5DRNB 2NPLX 2H6PB 3O4LD 2XY1A 4UOJA 1ADQA 4YGVB 4AEIH 2A77L 3U9UA 2DI7A 4NO3B 1K6QH 3LAFA 4HGWA 4PJHF 1H3PH 1HQ4A 2HT2C 3QULA 1N7ML 1EV2E 4BQCA 5JPMB 3U1SL 3VXME 2CR3A 1D9KD 2X2YA 5FHBL 1D9KC 2N7BA 4MA8L 5DVMA 4PJ7B 4ZO9A 1A6AA 4WUUD 1GGIL 3VRIB 1YECL 1VDGA 4Y4KD 2X9XA 2BNRA 4UBDD 4XHJC 3GHBL 5B8CC 4P57A 4HULB 1H3TA 4GBXD 4R26L 3SPVA 5L6YH 1JZ2A 1J8HD 1FQ9C 3KYKH 3RIFF 1ZHBA 2PO6C 3PWLB 2VDLL 5C0DA 1T3FA 2F74A 3H9SD 4J1UB 1EAPB 4JFDD 3HE7C 1KCVH 4ZUSA 4OIAA 1MI5E 4E9LA 3CLFH 1PJ9A 3Q5OA 1JPGA 1C1EH 5CP3H 4E41E 1EVTC 3OZ9H 4NKIH 3RDTD 4E41B 5IHBA 4Y4KB 3L1OL 2EE3A 4S1QH 1J0JA 1U0QA 4BFGA 3EZJB 5EU7C 1J0ZA 4X9HA 4OQTH 3JTTA 1ZOXA 5I17A 5CZVH 5DC9B 3QEGL 3K80A 2FNBA 2LAAA 2CDEB 3G9VA 3NPZB 4JPIA 5IEKB 3K8MA 4H20H 4LRNL 5GJTL 3VXNB 3B2UD 4OUUB 4WTZG 4YQXH 2DB8A 1HKFA 4Y4HD 5DJXB 1CDJA 2E7LA 4JY6A 1KULA 4FABH 2AW2A 3X3GH 5FECB 2VXSL 3X13A 3LKPB 1ITCA 1FGVL 1LO4L 5SX5H 5MEPB 3LN5A 2NY4C 2H32A 2HVJB 5EBLB 5KVDH 5IW1B 2OLDA 3TN0C 4PJGB 1FO0L 3GSNB 3LKOA 1RIHL 5F97E 3KJ6H 5C6TL 1CTNA 2IBZX 2V5RA 5CBAA 1TVHA 1WIPA 1JYWA 1SVCP 3HE7D 2CUHA 3BW9B 1BBJA 1JPTH 4AIZA 1YMMD 4ZFOA 3DI3B 4OLUH 3BP5B 4PS4H 1MREL 2W60B 2IAMC 3MRRA 4F2MA 4JFXA 1D5ZA 3WUWG 5AG9A 3DI2B 1L7TH 4G5ZL 4CU7A 4ORZC 1K4DA 3I3DA 3EHBC 3P9WB 4NN6C 5IG7A 1QRNE 4MX7A 3ECBB 1RSFA 5BJTA 2WBJC 4WFFE 4KTDL 5CJXA 3BP7B 1EO5A 4DCQA 1YEDA 2P8LA 3HPJB 3TV3L 5IVZA 5I1JH 4Z6AT 1MI5B 1D5XA 3BZ4A 5F9OL 3VFPA 5I0ZA 1VCAA 5KOVC 1AGBA 1CIDA 4I0KA 3AXLB 4GAGH 2UZYB 4LCIL 2LABA 2I9LA 5KS9A 1S7WB 5IMLA 4LLAA 1U92B 1MHEB 1INEH 3JTTB 1EZVY 1MIEH 4ISVA 5I17B 1T1WA 4X9FA 1L4IA 1AQDA 1TFHA 4FQCH 4P9ML 3JV0A 3BESR 1UH4A 4Q6IB 4X80L 4PLKC 2IEPA 4FFWD 3EFFA 4I13B 1MNUH 2ZG2A 2YMXL 4XC3H 5HHQA 5D2LF 4XMPH 2R1YB 1UZ6F 1TQCC 2X5PA 3CDFA 3CXDH 1PKQA 3UO1L 5K9JH 1JYXA 2R69L 2NW3A 4HH9B 3TJHD 4RBPH 3LKSB 4YFLF 3ZDYF 3TO2B 2XICA 3F6IA 1A0QH 4L3EE 4OZFB 3ZDXF 2QQLH 3SGEH 4PJGA 4OF5A 5EN2B 3QUZA 1CD1A 1ORQB 3S37L 5BS0A 2QQNH 2J4WH 4OLZL 1WFTA 1FNGA 4J3UA 3LKNA 1JI2A 5DMIL 3UX9B 4Y19D 5FYKU 3TBSB 4PJ5D 1PSKL 3VH8G 3FO2A 3D85A 3A67L 5HDBF 1K6QL 4MJ5A 4RGNE 2PXYD 1LEKA 1CLOH 1G7IA 5GRJL 1J0KA 4FFVC 4Z0BL 3OAUH 4P2QD 1R3HB 4NM4H 1N7MH 3LEYL 3FN9A 1UH2A 1NCUA 3HE6C 3RKPA 2EYSB 1Z3GH 4WJ5A 3VCLA 2Q8AL 4O00A 5IB5B 4LEXL 1XGPA 1LO2L 3L7FA 4KTYA 3DLQR 4XBEH 5HYQB 2C5DC 5FB8A 1U3HC 5ITBL 3T2NH 4HPOL 1JUFB 1RK1A 3O2DL 3JBG7 2XKSA 1J7VR 4EXKA 3HNTH 4BSJA 3S4SA 1NUFA 3CVHA 3O6ML 3PIQB 5B3JE 4R26H 1BZ7B 3EGSB 3ARZA 3CFKB 3VWKA 3ULVL 2F53E 4ODBD 2A1WL 5F7FA 1QA9B 3Q48A 5KZCB 1OT2A 2FGWL 3OZ9L 4ERSH 1MJ7H 4EJ1C 1S7QA 3O6KL 4GKZB 3CLFL 2OL3L 3VWKC 5DHYA 5BVPL 4R8WH 1AD0B 3WXVH 5L7XL 1NC4D 4WUKH 4S1QL 1KTKE 4J3SA 3F58L 1N2RA 2NY6D 2VABA 3O2VL 1NCNA 3V7MA 2W65B 3W0WE 1TJHL 4OIIH 1V7NH 4D0DB 4U1IB 1S8DB 1C16A 4OLWL 4ODHL 3PL6B 3MRDA 5D1XA 3CXDL 3NTCH 1I8LA 1WEJH 4WCYH 2R69H 1KUMA 3P4MB 3DV6B 3K4ZA 3ARGB 3V6ZA 2BSTA 4HUWB 2AJUH 5C0BB 5FM5O 4QTHA 3H7LA 2X42A 4PP1C 3S34H 1I1FA 5C8JA 1P7KB 2OXGA 3K1KC 3LKRA 4EN3B 1ZANL 4G8FA 1NGYB 2QQNL 5E9DD 2PYEE 3IXTA 2D0HA 3N1MC 2FJGA 1YEJL 3QB7C 4UIKH 1ZSDA 3PDGA 3V5KA 2DQUH 5I76A 1OLZA 5DMIH 3BGFB 4P2YA 4ZUVA 3V6OA 5HYQA 3WBDA 1UB5B 3UTTD 1YNKH 3C5ZA 4WHYG 3BD5A 5F7DB 1ADQL 2VZ1A 1NBZB 5FCUH 3ARFD 1A9BA 2BNQD 5M7QA 1GHFL 4ODTH 1TQBB 1JNNL 5DMJB 5DDHA 5DTFA 2EC9U 3LZFH 5BW7A 5E5MA 5EFIB 1JGUL 4CNIB 1QG3A 1D5IL 3MRPB 2YPLE 5CUSL 1A1NB 3ZYZA 4Z76A 3K46A 1HSBB 3GI8H 3LN4A 4NQVA 4N8CH 1EXUB 3DUSB 1FZJB 4NQCB 4P2QE 3FMGH 4KY1H 3MCLH 3DX6B 2HG5B 3BKYH 3JWDL 3D3VB 3VU2A 1J10A 4J12A 5CJXC 1A4JB 2X4OB 2BHZA 4XMPL 1BVKA 2NCMA 1C5DB 1J8KA 2EO1A 4I0CC 2VABB 4I18B 3MLYL 1XGTA 4HXAL 4XC1H 2YHGA 4O2CB 2AEWA 5D1QD 1WF5A 2BY3A 1CL7I 5IM7A 3WFDH 3NACH 1YEGL 4YHML 1U8PB 3KVQA 1MFAL 1FZMB 4E41A 2AGJH 5JIKA 3RZCD 2ZUQC 1IC5L 3GRWH 3CFEB 4QRPB 3U7AA 2W91A 3UTTA 2HH0L 4YO0B 1DBAL 3QI9D 4FTVA 1YNLL 4OM0H 5TPWL 4OKDA 4D2NA 5FK9B 3VDAA 1ZLSL 4PUBH 1V7NL 4P23A 4F7MB 4GG8A 2ADIB 3WEXB 4WW2B 3RTQA 3BEWB 3IKCB 1GZQA 2GHWB 4G6MH 1AGEA 3V0VB 3GSOA 1C7SA 1VENA 1YQ2A 1J0IA 1NAMA 1F4XL 2LE9A 5EU3B 3VFSB 4DTGH 4PGJA 3GBLA 1OAUH 1MIEL 3BKCL 2I60L 3UYPA 1SYSB 3QDGE 4HPYH 4M00A 5IF0A 3EKCA 4LLDA 3G5YB 2NY1C 3MLUL 4R3SB 1J87A 1IEAB 3RVUC 4ZUVB 4PR5A 5HI3C 4U05A 4L8BB 3GHEH 3WO3B 5DUBA 3MFGB 3RJDA 1G9ML 3SE9L 4WUUA 4PJ9B 4XNYH 1KELH 3D1MC 2UY7A 4LPCA 4Y5VA 3TCXA 4YHYB 3U30C 3LEYH 4XBEL 2VDPH 2C1OB 4U6XA 1B0RA 3K1DA 5IB1A 2F5BH 4QHUA 4UQ3B 4JFXB 3RWFB 3DX9B 1FZKB 4HX1A 2YA1A 1UB6A 3BN3B 2M8XA 3VGAC 1PZUB 1TJGH 5D71H 1CG9A 3QI9A 1FNFA 2ICEB 3CPLB 5BMFH 1VPOH 3OR6A 3DHJA 3K7UA 5IBLD 5D72L 4NQDE 2X4QA 4Z5RA 1OT1A 2WIIA 4JM2B 5DLML 4JVPA 3QJFA 1KJVB 1J1PL 4HFUL 3C6LC 3Q0HA 1FL3A 4FQIH 3TCLA 1N59B 1E6JH 3MCLL 3P9MB 2GTZB 1GAFH 3BSZH 5DFVD 3ARGD 1G6RH 3V52L 1P6AB 3RL2A 2ZJSL 2BHUA 3HE6D 3WFCL 1DQMH 1DQQB 4OM1L 1KG0A 3RZWA 1J1OL 3VXQB 1X5XA 1ZHLB 4GBXB 3H9YA 1NCDL 4ZOCA 3M8OH 2JCCE 3DVIA 3H2WA 3H9SB 3VGGA 3MREB 3LPGA 4HV8B 4XX1E 2JIXD 4GKNA 3UPCA 4PGZA 1MPAH 5TF1L 3RX8A 4DGIL 2XZAL 3D0LB 4QO1A 1PKQB 4IRSC 2VDNL 4BZ1H 5IF0B 1HWHB 4Z7VB 5D6DC 4NQSA 3EFDL 3HCVB 1EHLH 1KN2H 2Y7QA 4OCNC 1HILB 5D7JA 4MCZA 3KYMA 3NABH 2YD3A 3MR9B 4JFEE 2PO6B 1HKLH 3STLB 2ZUUA 3P4NB 3C9NA 3IT8D 3QWOB 3QFJB 4V1DE 4OCWH 3BP4B 4IHOA 2WMPA 2IQ9H 1A3RL 1J05A 3B9KD 5DSCA 5FEBA 5DJ2B 4JLRA 3HUJF 2QQKL 4YHIA 2KZ1B 4X6BA 3EOBB 1FN4A 5D7IE 3SGKC 4Z77B 3QQ9C 1Q94B 4RWYH 2ICWJ 3OB0K 4EUPH 3EOTL 2EO9A 2F54A 1KELL 5I8KH 4NHCH 3QIBA 4IOSD 2ZCHL 4NN6B 3ULSA 4ZAKA 3QPXL 2J6EH 1HNGA 4LBEA 2R0KL 5DD6B 4ONHA 4N9GA 4XWGL 5JDSB 2AERT 4YBLB 1P4IH 1N0XH 1NMCB 2VLMD 4YDJA 4OIBA 1EH9A 3RIFK 2DLFH 4PYHA 2DQCH 1V7MH 1ZWIA 1YMMB 5DRWA 4G3YH 2AP2A 4YHLL 2IGFL 2LQRA 4UTBL 1NLDL 1PZ5A 3W9EA 1J9CT 4X6CB 1KIRA 3DIFB 4TUJB 3SE8H 2PCPB 1T5XA 2A6JA 4MZ2A 3DO7A 2NY0B 1R3IH 4WVRA 1DSFH 2KKQA 3C6LD 1FAIL 3TT1H 2DWEA 3NCCB 3FKUS 4DZBB 1GC1L 4D3CH 5DUMH 5CP7B 4ALAH 3OKKB 4EUPB 4FXKA 5EO0B 1QLEH 2VYRE 1DQML 3ULVC 3IB4A 2ADFH 5HI4C 4XCNA 5F93C 2YD9A 2R2EA 3VXRB 3U7YL 5CZVL 2VDML 1XAUA 1JPST 2R0WL 1A2YB 1AH1A 5CEZE 2IWGA 4CDGC 3GGWA 3C5ZC 5EC1A 3AVEA 4EI5A 3EYUL 4JY4B 4P2CG 4L3EA 4X5XB 3TA3B 4NQXB 3SCMC 1SY6H 2NXYB 1FYHB 3CDYA 1Q9WB 1GXEA 2OP4L 4MJID 1UYWL 1MVUB 5HYJE 2EDTA 3UDWA 1OSZA 1KJ2H 3BE1H 2ZUXA 5ICZB 2J6EA 1T0MB 4PLNC 4IRZH 1QR1B 2MMXA 3MA9H 4LCCA 3C5SB 2UWEA 4BFBD 2AV7A 1BQLH 2AJVL 3GBNL 1U8QB 2APXA 3SE9H 3VFUA 1MCJA 3S96A 3ZKMC 2ZOLB 5ALCL 3T0EE 4JG0H 3M17A 2JK5B 4FQXB 3ZE0E 5B38G 3V5HB 5BW7C 5DHVH 2NXYC 4M48L 3RWDB 1ZS8B 2IH3B 4OZFH 5HJ3A 5DD6A 3V6FA 3QHZH 1E4KA 3BO8B 4O58L 3E8UH 2BDNL 4OCSL 3FFDA 1NGPL 1JK8B 1F58L 2YSSB 4EKXA 4KVNL 4QYOB 1TCRB 4R4FH 3ULUE 1EZVX 3ZSSA 4OAWA 4PG2A 4FQJL 1INDH 1J1PH 3C8KA 1MH5A 2VOTA 5EBLA 3LKQA 3BPCA 5E6IB 4PRIA 4MD4B 4P2QA 5AZ2H 3F6LA 4FQLL 1PKOA 3I6GB 3B6SA 1G7MB 1RUPL 3W2DL 1MRCH 1H3XA 3SDCB 2VTFA 1YEKH 2MQ3A 5LKNA 3O8XB 3OF6D 1IMHC 5E6ZA 1DE4A 3LCYA 4ODWB 5HGDA 4JO4H 4Q0XL 3VMOA 3P73A 4PRBA 4FQIL 3D5OF 1CL7H 1OTUD 1L0XA 1RPQA 4JRXE 1GGBL 1TNNA 4HC1L 1XZ0A 1XH3B 3K0WA 1X6LA 4WHCA 3DMMC 2ZCLH 2ZJSH 3WFCH 3I6LE 3MV9E 4HS8H 2ZUQB 3BH8A 2VKWA 3DBXB 3CCHA 4EDWH 1T03L 3QUYA 4CN4A 3LEVL 1WZKA 2NY7H 3V6OC 3U4AA 1AQKL 1SHMA 1XMWA 4AG4L 2P47B 3LB6D 2HFFA 1ED3A 4QRPA 1EA9C 3WIHA 2XI9A 4YO0A 1MUJA 1CGSL 5DGRA 1RJLB 1MHPH 4BZ1L 3ARDD 3ZDZE 4NCC2 1GGYA 2BNQA 5DO2C 4IS6A 5AAWA 3OGOE 3PABB 2ARJB 2VLRB 4KKCC 1W0YT 1C5CH 3WFEL 3QG6B 4EZMA 3E2HC 4NNXB 4RBPK 3MRQA 1TVBA 4MS8C 3WNLA 3T65B 1IC7L 5MERA 4IMLA 4RRPA 2NYYD 4JY5L 3AGVA 3N1PC 4NRYA 5EU4B 1T5WA 2XPGB 2LTQC 2YSSA 1OGAA 3MCG1 5KTEH 3SGJC 4YHNA 4NN7B 3UTQB 2WK2A 4NZTH 2DQCL 1PLGH 1N5YH 4WV1C 4HZLB 3AS0A 4U2ZA 1N0XL 3ROOA 2IQAB 3MJGX 5SWSE 4C58B 4QF1B 1HIMH 1WIUA 5DVLA 5C86A 5FYKL 3QXDB 2ZPKH 4E5XB 1E4KC 3LB6C 1VFUA 3PWNA 3RL1B 2W9DH 5DRXA 2LU3A 2IG2H 4HUNB 2X89D 4L4TB 3VRJA 1RV6X 3WSQL 3ES6B 1Q9KB 2XQYG 5L2KB 3FO2B 5FO8A 1WV7T 3QWRA 2PYFA 4Y4FA 2Z8RA 2P5EE 1GC1H 1FVCA 2QQKH 1HI6B 1NFIA 4X7CC 3GSQB 4X6DE 2BMKA 3TT1L 4G80B 2H8PB 2VLKB 4PJEF 1XCTA 2CIKB 2VUYA 1VACB 3CCHB 5DUML 1JZ8A 1YEHL 2VDOL 3MRGA 1A7PL 3MYJA 1FNAA 2HJKA 5I2IA 2WBJD 1F4WH 3IGAB 1A6UH 4Y5XB 1GGBH 4I2XE 1DQQA 3D2UD 5GS3A 2O5YH 4CMHC 3OKNA 5D7JC 1BQHG 1IAIM 3LD8C 4HS8L 3NPSC 3GK8H 2VL5B 3LS4L 3NFPA 4LAJH 2XQBL 3C5JB 3CX5K 4LAQL 2E9BA 2J4WL 5F1NA 2CLRA 5J3HD 4HG4J 1RZJC 1SQ2N 1J8HA 3TH4T 4Z9KB 5EO1B 3RU8L 1EJOL 5CD3A 4MQ7B 5I75B 4LSRH 5L9DH 3LIZL 5A2KH 5J13C 4L4VA 1TVBB 3NFSL 4XMKL 5IKCB 4TQEL 2Y9RT 2Q7NA 5SX5K 4F3FB 3CFBA 2MOVA 3IU3B 2M26A 4HIHB 2WLZA 1NGPH 4N90E 2RFXA 5A16A 2NY3C 1WSST 5IW3A 5SX4H 5GHWL 1KFAL 4JM4L 3RWCA 4Z18A 2R0WH 4ZUUB 4HCRL 1SM3L 3P77A 2ICWB 5I1IH 3IDJA 1GVIA 1F58H 3RVXC 5IQ9A 4F7PA 1A1MB 3ZHLA 4WI3A 5EOCL 4XVUD 1JWMA 3R0NA 4U1HA 4GMSL 3ZTNH 2V5TA 3IETB 4V1DB 2GJZB 1SJVA 3VXUA 4ZO6A 3STBA 5C9JB 1OAXH 1HHKB 1CLZH 4C56E 3KYAA 1JGLL 1JGUH 5IWLA 4ENEC 3KWWA 3QJHA 5KN5A 1NANH 2BNUB 4K8RH 4XPTH 3SKMA 1CFTA 1WZ1H 2OZ4H 1RUPH 1CGXA 1YMMA 4OZHB 2OCFD 4MJ2A 3MRMA 1KIPA 3LN5B 1FP5A 3IJHB 3RGVC 4O5LH 3DIFA 5F7DA 3O11A 2BNRD 1GIGH 2X4PB 4LEXH 3UTSD 3VW3H 1IAIL 5CJOL 1LILA 5DUPL 2H1PL 3AU1A 1CVSC 4KMTL 1S9XA 3VG9B 3MBXH 3ILPB 2PTUA 1WEJL 2YC1A 4IRSA 4YPGB 2DWEB 5DTFB 5EA0H 3U0TB 2N7AA 2OI9B 1BECA 1AQKH 1WBZA 2NLJB 3EYFB 5DQJB 3UDWC 4X4ZA 4C83A 1A6UL 4JFDB 4GFTB 3FCTA 4LLMB 2VISA 2XRAH 4ZTPH 2NX5D 5CEXA 1DDHB 1DBAH 3VXMB 2Y07L 5CSZA 3SDDC 3I9GL 2P8PB 1MCIA 3VFOB 5J1SC 3CFBB 4UQ2B 2F8XC 4QHMA 2CK0L 2Z93A 1N6UA 3U4EB 2BCKA 3F7VA 5GS2H 2DN7A 2HFGH 3S4SG 1AKJA 1FV1A 1HEZB 2EECA 2JE8A 2FX7L 1AXSA 1KLGB 2V7NA 4NM8H 4G8GD 3SDDA 3O4LE 4PJ8D 4ZUUA 2AQ1A 5FM5M 3WKMH 3ULVF 1IGFL 4YHPB 4XNQA 4ZFZB 3QUXA 4PJCB 1QNZL 1NFDF 2ZUVA 2UWEB 2YMXH 4PGBB 3V4VH 1I75A 5JW4Q 2HT4D 4PJHB 2KQMA 4K3JH 1YEIL 1I7TA 3R4DA 4AEFA 5DA4A 1MJUH 3BJ91 3R8QA 5TF0A 4PRAA 5C0FB 4L8CA 4JHBA 4ODVL 3HZKB 1LK2B 5MEOB 5EU5B 1SJHA 1UKTA 2IG2L 3UJTH 5HDOA 3HAEA 3OJ2C 2IBGA 3MC0A 1MCRA 2JELL 5L88H 5GRVL 1TCRA 3FB6A 2A9NH 1VFAA 4KI1A 3BDBA 2HRPL 2X40A 1Y6MR 2Y6SC 1OAZL 3C8KB 1JNNH 3AM8A 1P2CA 3LKQB 3B9VA 5IVOA 3TC9A 2H6PA 3MOBH 4PGCA 4KRLB 3U9UB 4FTVE 5GZNC 3BDYL 4KQ4L 4ZYKB 3Q5TA 1FVEA 2W0LA 4NQEE 4RISH 3ARUA 3OPZL 4KK5C 2F54E 4YDVB 2ITDB 1I3UA 4LU5H 2X4SB 3QIUD 5FYLD 1AP2A 3L5IA 5TDNB 3H0TA 5DJDA 3O3DB 4XAKD 5LG1A 3FMGL 2XV6B 5E24E 1U8MA 1KEGH 3W0WA 2QEJA 3QSKB 2BNRB 3IRPX 3EDKA 5J56B 5C0CB 2R0ZH 1S7UB 1GCFA 2XTJD 2ICEA 1EIBA 3WHXB 5KVGH 2AJXH 5L9DL 4U6YA 4M6OL 1BD2D 4OSUH 1A7QH 2ZUTA 3IFLH 4OTXH 4KI5F 2OSLA 3HNVL 5A2IH 3QIWD 5T3XD 1QO3B 4NUGH 1ZHKA 4TUOB 3Q3GA 2APBA 2OR7A 4NKOB 2Z35B 1FNEB 1KT2A 1BEYH 4HMDA 3ARQA 1BVZA 4JPVH 4NFBA 4XPBH 4MNQD 4IIQB 3P9MA 5GGTA 3O9WA 2W1NA 1FLRH 2ZCKL 4I4WA 4LQFH 1RUKH 2E6QA 3MLPA 2DJUA 1PYWB 1BOGB 3V8OA 1RJLA 4P46D 3UBXB 3NMEA 1LO3L 3MODL 2EDEA 2I26N 1KXVC 4G6FD 4LL9A 5FF6B 1NDMA 2DLGA 1G7PB 4P9HH 2G9HA 4JFHE 3J8F7 1OTSC 4XPGL 5CEYA 3O9WC 4JB9L 2FEEI 2WUCH 4XNZC 4HWUA 3E1F1 4RQQA 5DT1L 2XWBB 4FQQB 1OM3L 3CC5B 1H5BC 5HHOA 3I2CH 4Y2DC 3NIDF 3KDMB 5C09D 4K9EL 2Q3AA 5E8EA 5JXAL 3T2OA 1JGLH 1HQRA 3RVTD 1SEBA 1J86A 1S7RB 2D7TL 3GKZA 5MEPA 4PJXE 1G7LA 5E6IC 4HUUA 4GG6A 5ISZE 4NWUH 3P0GB 2C3XA 5JORB 5AAMA 5JR1H 2XWJB 5DWUL 2D7MA 5C09A 4ETYA 5SWQB 1BF8A 2MWCA 1MJJB 4OCYL 2PTTB 4E5XA 4XCFL 5ESAA 1IILE 1MCBA 3BQUC 4XNUH 2C3WA 3I84A 4L1HA 3LHPH 5FHAH 4UZGA 3RP1A 5IB2A 5JW3H 3MRCB 4M7LL 1RIVL 5D7IF 4Z7OF 3MLTB 3F8UB 5GGSB 1NKOA 1MRFL 3IAQA 2HA1A 3QQ4B 1DQLH 4MWFA 2CLVA 3JV6B 3RUGE 1QBMH 1QKZL 3VI3E 2VLRE 3OPZH 5C0JA 1GIGL 5E9DE 4CJ0A 4MNQA 1KXTB 3SDCD 3C8HA 3O9WD 3SHSA 3TO4B 3FRPA 4CADB 4N8VA 3BIBX 5FCUL 5D4QA 4YX2H 5DHXB 4AEIL 3QDAA 5FV1L 3KPOA 4LRIA 3UZQA 4I0PC 5MP6H 2AKRB 2X7LA 1B2WH 1AD9A 2F19H 3B5GA 3QXTA 4G6KL 2VAAA 1MLBA 4QRTA 5HHNB 4HQQH 1BM3H 4P48A 4UINL 3LDBC 1JYNA 2I9LB 3EJJX 5KS9B 5I1DB 5J13B 3BW9A 5J6GA 2YN5A 4P4RB 4LDLB 2J5LB 1AI1H 1RULH 1S78D 1K8DB 4P5TA 1LD9A 2W60A 3CZFA 1BBDH 5C0IB 4UIMA 2WQRA 12E8L 4X7SL 1F2XK 2FATH 5I1AB 4M3KB 1F45A 5T5NF 1V5JA 5CP7A 1RY7B 4OGYH 2BZDA 4QEGA 1RZJL 2A9ML 3HLAB 2VDLH 3CC5A 1NCDH 5ID1B 2HG5A 5IG7B 4YH6A 1IGFH 3JWOL 2ILLA 2X41A 3HC3H 1ES0A 5ID0A 4PLOB 4DGIH 2XRAL 2HT3D 1KYOK 2Y36L 2JELH 1MI5A 4LKCB 5IIEB 4HCRA 5JHLH 2AABL 4UTBH 5F1SA 3OKLA 5DD3H 4F37F 3RPIA 3EO0A 4Z7WB 3IDMA 3IDXL 1ORQA 4C56A 3EJZC 4Z7WE 2R9HD 4P2RA 1KXQE 2FYYB 5IBTH 2PW1A 1W2KT 1VSCA 1L0QA 4L29B 2GJZA 5JHDE 2W59A 3TA3D 4X99B 1J88A 5EU6A 2B1HL 5JW5A 3REWA 3BWAA 1OGAD 1KCUH 3T4AB 4P3CH 5EOQL 1AC6A 3GSOB 2PW2A 3Q1SH 4WDIA 1XGRA 4HJ0D 4G3YL 3BDYH 4KQ4H 4N8VB 2OS7A 4PJFE 3RVTC 2A73B 3GUTB 4OZHA 3QUMB 4AMKL 3VDCA 1FLTX 4UUJA 4OB5L 4PJDB 4DVBB 4OCMC 5L0QC 3F7YB 3CLEL 4QYOA 5I1EL 4AEHL 5DS8B 1D9KB 3DSFH 5F7KC 2FCBA 5TE7H 4GAJL 1CK0L 4F33B 1BLNA 3NPSB 3QUZB 4JN2A 1GGIH 3HN3A 2C3VA 2QSQA 4GW1B 1KJMA 5H8DA 1M71B 2Q8BL 3MRFB 1BZ7A 1K2DA 1IGIL 1U8KB 3FQTB 4PJ7A 2VITB 4S11A 5BO1H 3RZCA 2IADB 4BZ2L 4JANA 1UJTA 1UWXK 3G5ZB 4JFEB 4JCLA 5DJ0B 5I75C 5HGDB 5E2TL 5HDLA 4OD1L 3KLHC 4XPBL 4U1JB 5CSZB 3BGAA 3FHQA 3SPVB 4M48H 4X98B 3ARFC 2J8UE 4WWKC 1AI1L 5A2FA 3VXUD 3PWLA 4IBLT 5C0DB 4KZEL 3AM8C 4EDXB 1DQJB 3FFCE 3MMEB 1ZA6A 2YD1A 1G6RA 2VERN 1IGTA 4RFNB 2OL3B 4NP4L 3FOLB 2ATKA 4X0KB 1MFDL 4BH8B 1YNTA 3U46B 1A7QL 5GGSY 4PTUB 1BOYA 1EGJL 1N8ZB 5T1KA 1ZHLA 1NMAL 4FA8A 4HG4K 1RZFL 1QSFE 2F53A 4RMVA 4DGVL 2IPKB 3VFWB 1YY9C 5EWIL 1RIVH 4GKNB 4C57C 3LRSA 3HS0B 5E70A 2R9HC 3TYFA 3NABL 3BPLC 3E6HA 2G75B 5D2NC 2APFA 4PJHE 2GITB 1BFSA 4P4KC 4H25B 1FYTB 2YKLH 4XCFH 4F8QA 4NFDA 2I07B 1KBGL 2HLAB 2B1AL 2IC2A 3SDXB 3QO1A 4RNRB 3I2CL 3QFJE 1AHWC 1I1YB 3GSNH 3MCKA 3HC4H 1UFUA 2VN4A 1DBKH 3BPLB 3WL9B 2XTJB 2YBRB 2YXMA 1K2DB 3ULUF 4NNYB 2AEQH 5C7XL 1UC6A 4JO2H 3ARGA 3V6ZB 2E3VA 1I1FB 2EYRB 1XF2A 2EYTA 4NJ9H 4AQ1B 1RUAL 2F54B 2VDQL 3DX6A 1RJZB 2IGFH 2OJZH 4LBEB 1B4RA 1T7VA 5H2BB 3ILQC 4N9GB 1D6EB 5C1MB 4KK6C 5FA4A 1P6FA 5KAQF 3HC0B 2BNRE 5DF0A 3SE4C 2V17L 5C70A 1FJ1A 4LSRL 5KVFH 5DK2B 3L7EB 3T04D 1DUZA 1FFPB 5F96H 3AXLA 3ZDYE 3O9WB 2WP3T 4BH8A 4PREB 3RWEA 3QUMH 4U6HB 2P8MB 1VEOA 4G5ZH 2HWZL 1FVDB 2QHLA 1MHEA 4FTVB 2KH2B 4PJAA 5T33H 5BXFB 2YZ1A 3A6BH 4MD0B 2MHAA 3OJDA 3U7WL 1JN6A 2CUMA 3LQZA 4DZBA 2UV3A 2V6HA 2ZZUT 3FT2A 1TJIL 1EPFA 4NQVB 4WHDA 3GSVA 1IEBA 5F9JB 3WN5A 6FABL 3QEHB 1QFWL 4PFEA 1RFDL 1CDGA 3T0VA 3M1BA 3V8CA 4XI5C 4OT1L 1CICA 1HHGB 3W11D 2DQIH 4LLYA 1NDGA 1RZKH 4J4PA 5J1TC 2I07A 4XRCA 4X83A 4MNHA 1L0YA 4X4YB 4G8IA 4WI4A 4LSTL 1I1YA 1EHXA 4GKOA 3L3IA 1KN4H 4Y5VB 3MCKB 5DHVB 4PG9A 1Q1JH 3HMWL 3NCBB 4IMKC 3QO0A 1ACZA 1MCKA 4HWZB 1U91B 2RJMA 4M7JH 4MVBC 4K3HA 1R5IB 4JGMA 1R0AL 3ABZA 3MV9B 2V7HB 4JPWH 1IL1B 3GSUB 2RIKA 5CIPH 3FTGA 3O3BB 3VW3L 1RZGB 1TMCB 5LAXA 1X7QB 1U8LA 4MWFB 4UT9H 4YC2B 1JV5B 4YK4B 3F7QA 4LGPB 3VXRE 3M17B 1MFBL 4NHUB 3CJJA 1S3KL 3G6JB 5MHSE 3V6FB 1TTUA 2EIZB 1CDBA 4A6YA 4OFVA 2AEQL 2N1KA 5BRZD 1BWMA 4E42A 1F3RB 3WLBA 1PAMA 3VFMA 4ZFFA 3QIUB 1H8SA 1WZLA 3ARDB 3HZVB 5LWYH 5DUBB 2UYLA 4XH2B 4OAWB 1UADC 1LEIA 4PBVC 5AWNL 1SMAA 4HIEA 3LRGA 4TPRL 3BPNB 2R2CA 5D2LE 2Z8SA 3WJJA 3L3GB 2DDQL 5D2LB 5JLZB 4WW2F 3MXWH 3KPMB 5F7EL 4NKDB 3ESUF 4YXLH 3H9HB 1BZQK 3QNYB 5C0IA 3DSFL 1JCKA 3QQNA 1DBBL 2R4SL 4TN9A 2NY5H 2AAVA 5KS9E 2H3NB 2HTKC 2QSCH 5T3ZH 7FABL 5BRZE 4Y88A 3QG7H 4DKEL 3BT2H 3MJ7A 1LE5A 3PXJA 2MCPL 2Z92A 3AC0A 1B88A 4BZ2H 1BAFH 1ZLUK 3U7WH 1S7TB 3KPQB 1RURH 4MCZB 4CKVX 1JZ6A 1WZ1L 4D9RD 2C7UB 2YA0A 3NFSH 4LKCA 4XMKH 3JV5A 1MIML 3TJEL 4N0UA 5T5FL 5FUZL 5F9DC 4CN1A 5EBGA 3HZMA 4KRPD 2HFFB 3RGVD 3D48R 5IB3A 3P4MA 4MMZC 3BIKB 3V0WH 4P2RE 2W9EH 2CKBA 3H8NA 2IPTL 2AI0L 2B1AH 3I6LD 1A6TA 3GB7B 4PGBA 1L7IH 3PHOB 4AL8L 4ZUTA 4WUKL 1I8IA 5GXBB 3SKOA 3GSNL 4QRSB 2VNCA 1FG9C 1JWUA 4BKLB 2FBJL 3QPQC 3VFNA 3FOMB 3CMGA 5E7BA 5BS0D 3KLSA 5KJRH 3RDTC 5DJXA 1AR1D 4ONHB 4I9WD 4PJIB 1X9QA 5JDSA 4DOHB 3OV6A 1FFNA 1M7DB 2A77H 1IAOA 4P5MB 3T0AA 5KSVA 1CDYA 4MSWB 3X13B 4NRYB 3VFMB 4ZFFB 1WJ3A 1KB5H 3M45A 1MCPL 1F3JB 4BSVA 2QJDA 2F5AL 1T21B 4JN2B 3WS6C 3SN6N 3FN0L 1QBLL 4B7IA 2EH7L 2P45B 3BXNA 3KR3H 5SWSD 3QEQA 4Q74A 1K3IA 2F58L 3GSXA 2VXVL 2ED8A 4ZDHB 3KPMA 2BHYA 4AT6A 3VI3F 5MEQA 3LEXA 2XYCA 2HFTA 1FRGH 4K55A 4Y4HB 4PGDB 4X8JA 1BIIA 1G84A 5EBWB 1D5ZB 4C56D 2H3NA 4BA8A 1Q72H 3C6SA 4LIQH 4U1JA 2H2PC 2VMFA 3DX8B 4QNPF 3D3VA 4XBPA 1RZ7H 4HW6A 2BSED 3NACL 2YD5A 5F7EH 1BVKB 3FB7A 1VEPA 3VI4F 5CJQL 5JW4N 4I77L 3BSZL 5C0GA 3VFRB 3X17A 3VD5A 5GJTH 1ONQA 4TUKL 3DMMD 3MRKB 1IGTB 3MOAL 4OZFG 4R4NC 4XHJD 5DJ8A 5M94B 1W72A 2VC2L 1TQBC 3BOVA 5DQ9B 4WGWB 2VH5H 3VXRD 3VE0A 1QNZH 3O3AB 4UNUA 1ZLWK 5GGQL 4GH7B 5CWSB 5T1LB 3C5JA 2OR8A 6CGTA 3B9KC 1JIBA 2VLJE 1S7WA 4PRHA 3GSRB 2HMID 2DL9A 4MDJA 4APQA 4Y5YB 5D7LA 3U48A 3WN5C 2NTFA 2XKNB 3BEWA 3IKCA 1FDLH 1OB1B 2IAND 3DECA 4HD9A 3EYVB 5E2JA 1P7QB 2HKFH 3HMWH 3VFNB 3U36A 5IROC 2A9NL 2N56A 3QQ9D 2LVEA 4ORGA 1I7ZA 2BVUA 5TQ0H 2ZWLT 4OCXH 4Y16C 2IQ9L 4WO4D 1S7RA 3Q2CA 5C0RL 5ESVA 1MFEH 2ARWA 4KJYA 5T3ZE 5CD5D 4J7RA 1RUMH 4PRIB 5BS0B 4P2QB 1JYVA 3MLXH 5F7UA 3TN0A 1SJEA 3BQUD 5F9OH 2J8UA 4KROC 1A1MA 3WO4C 4DTGL 4LSQL 5T5NG 3CSYB 3QNXB 3MUGA 1P4LA 4WW2C 4GO6B 4N8VG 3BGMA 4PJFB 2YPVH 2LFGA 4LMQI 3T3PE 3IETA 1QZ1A 3WUWB 1W0WA 3FFCD 4UV4H 3QFDB 4PJEB 5D1XC 4MGXA 1WC7B 1RJZA 5JNYA 5IBUG 1HXMB 1YECH 5FOJA 1FL6A 1XGQA 4JFOB 4IOIA 1D6EA 5C0JB 5D6CB 1QRKA 1SY6L 1Q9OB 3BVNA 2EYSA 4I8DA 3ZDZF 3L3OB 1F13A 3UXFA 2C1PA 3I50L 2IANA 1MREH 3G04A 3RA7L 3GMLA 5MI0C 1OTUC 2IALA 5D7SH 4X7TB 4NRXA 4HXBL 5DJ8B 3TZVA 2ENSA 4X4MA 4U3CA 1IGCH 1MH5B 1JVKA 4QT5B 3VD3A 5L0QB 3U30B 1MIMH 2CDFB 3GJEA 2BXYA 3I02A 3KPNB 4WRLA 1DZBA 4N0CD 5INDA 1TJGL 1QSVA 1S9XB 4RFEB 4NKIL 5E2UH 3ILPA 4JG0L 4U6TA 3OJDB 2MHAB 1JPSH 5LBSH 3TPUB 3FQXB 4LQFL 4LCWB 2NTFB 5AWNH 1GZPB 3IJSA 2J3SA 4CW1B 3SE3C 5CGMA 4GSDH 4WHTB 4M7LT 3NGBC 3PP3K 4UIMB 2UUDK 2EXYD 3V4PL 5A1AA 5KSUA 1ORSB 2VN7A 5EIIB 5GGQH 5CEZD 5JXAH 2PKDA 3BRDA 3GDBA 4O51B 3RY6C 2Z31A 4N1EA 3S3PA 4WEUD 1RAMA 5C07E 1FCCA 5GRUL 1G6RL 3V52H 1DLFH 3LD8B 5BV7B 3ORJA 3KYMB 2CLZB 3AMLA 5AZ2L 4YZFE 1AKJB 3QG7L 2H26B 1ODAA 3QFJA 1I3VA 2NMSA 4PJBA 2BOBB 4ZSOE 3UJIL 4HQQL 4JRXA 3EOAA 1ZT4B 2GFBA 3IJYA 3Q6FB 2OR9H 5JW3L 2V5MA 3SDAC 4JRYE 3RI5F 1U41A 4X6BB 3HG1D 1UM5L 4RSVA 5ICYA 2BRRH 3BGMB 4PJFA 2ZG3A 4PY7B 3MJ8B 4PJHA 1ZV5A 1RULL 2BNQB 3O4OC 5LCVH 4S10A 3H9ZA 2BNQE 3MV8A 1TVDA 2NXYD 4G8FB 4CJ1A 4R96A 4Y4FB 1XCQB 3KXFE 1MWAH 4Z7OE 1XGQB 1B6UA 4JFOA 1YY9D 4LSSH 2FJGB 5TDOA 1XGYH 5HI4D 1QD0A 2NYYC 2QKIB 2IAMA 3VXUE 2NX5A 1XT5A 1R3JB 3VJ6A 3T2PA 3MYJB 1A6WH 1VGEL 4K23L 4G9DB 3K2UL 3PP4H 4YUEL 1IAMA 3HNSH 4OZHE 3PGDB 4BYHA 5D2LA 5JLZA 2O93L 4P0DA 4GQ9H 5IOPA 1N5AB 1AHWB 1TVHB 1ZVYA 2ZCHH 1XF1A 4PJXF 2BVQB 1P9MC 4G6KH 3C5ZD 4ZD3L 4ONFL 4LCWA 2VDMH 3JWDC 4NGHH 1CFQA 4HGMA 3ES6A 1P84K 3OAZK 4PJ8C 3QIWA 4NQCA 3UBXI 4PRIE 5D1ZB 2XA3A 3LN4B 1QACA 2FJHB 3VA2C 1CFSB 4Q6IC 4OI7A 1S7UA 2D3VA 4L4VB 4YDIL 3RWHB 3C09C 3SKJL 4OZGF 4PJ7E 4OGXH 3ECBA 4F3FA 1T04A 1H5BB 3MUJA 5I1LA 4JY4A 3L9RB 3RIAK 4AMKH 3ZTJG 3ALWA 2GYSA 3CGTA 1OAKH 4JQVC 2DQUL 1KGCE 1LDPL 2FL5B 1MCHA 1RI8A 2JIXB 4GMTL 4M5YL 5GSRA 1GYAA 2VZOA 4KQ3L 3KAAA 4KWUA 4FQXD 5FYJU 1D5BA 4NSKA 3X12B 5E8DH 1K85A 1OF2B 5C0RH 1QFWM 2AV7B 4U1HB 1T1WB 4DKDC 3UYOD 3W5NA 2AK4D 1YY8A 4NJAH 2ZOLA 5FK9A 1FIGH 1TZIB 2EXWC 4LPWA 3NTCL 5I0DA 3DV4A 3IXAB 4DZ8B 5D1QB 2OTUA 2P49B 1NUGA 2X4NA 4YR6A 4HK3N 3TA3C 1FDLL 1FG2A 1X5LA 2G2RA 3NZHH 1NCWL 4H25A 5I8OH 4BQ8A 3FJTA 3VXTA 5F72S 3RA7H 2HLAA 4V1DD 1YEKL 2AJVH 3GBNH 3BPNC 3LMJL 3T1FA 3G6AA 3CXHK 4HWBH 3MBEC