2FBJL

Refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
EIVLTQSPAITAASLGQKVTITCSASSSVSSLHWYQQKSGTSPKPWIYEISKLASGVPARFSGSGSGTSYSLTINTMEAEDAAIYYCQQWTYPLITFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Crystal Structure of the Galactan-Binding Immunoglobulin Fab J539 at 1.95-Angstroms Resolution
rcsb
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA J539 FAB (LIGHT CHAIN)
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 1989-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fbjL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fbjL01
5BS0A 1B0GA 4FFYL 1ZLSH 1CFNB 4ZOBA 5DHVH 5FKAA 4HWBA 1K2DA 1FNEB 5SWQB 1S7XA 1G9NH 5AD0B 4PG2A 3UZVB 4KMTL 5IR1A 4N8CL 2VZ1A 5C0ND 3VGHA 5E6ID 5KSBA 1QFWL 3CPLA 5D7JA 1MJ8H 3RHWK 1KFAH 5HHQB 5FB8A 3HN3A 3NBNA 5JDSB 1F42A 2J8HA 4YDLB 4FMFA 1OD9A 4I3SL 3QIBD 3T0EC 5E03A 4JDTL 2QR0B 15C8H 3HFMH 1S7SB 3TIEA 4MAYA 3OAZK 3DGCR 4OZHA 4LFHD 5TQ2H 3VXSA 4OD1H 1I1AC 2XICA 2HFEA 3B43A 5FIEA 1JGUH 4GRLC 2JIXB 3V5KA 4M48H 4JFEA 2P8PB 3B9KD 5LCVL 2CLVB 2VB5A 1X5IA 1DDHB 4JPIA 3DO3A 4J7RA 3MRPB 4MSWA 2P47B 3CFKB 1U3HC 4F8QA 1DUYA 4UDUA 4J1UB 4O2FB 3BOVA 4ZO8A 3T4AB 3MYZA 3MLSH 5T1LB 2AEQH 1F4WL 1LK2A 5F7DB 1J8HB 4KQ4L 1N59B 3G04B 2EDXA 3FHQA 4K3DH 5IIEB 3EYSH 5K9JH 2VDKH 5E24E 1HHJB 1CGSH 3L1OL 4KRMB 3DROA 1BMGA 1R5WA 2FGZA 3I6LD 4WEUD 2I24N 2QLVB 1INEH 2W9DH 3VD7A 1XEDA 5C0DB 5GRUH 3WIIL 1H3XA 3PWPD 4AEFA 1KFAL 3VXRB 5C92A 3THML 3AROA 3U82B 4R4FL 4S1QH 1IC7L 2NW3B 2FIRT 1S5IL 3I50H 3MOBH 2IMMA 4LAQH 5EOTA 4M43H 2LU4A 5DVLA 1I4FA 1RJYB 3P73B 1DQLL 3V5HA 4LLMB 4JFDB 4CN6A 1BVZA 5TH2B 1GZQB 1G7HA 1U8MA 1XF3A 3MRGB 3RIFF 4TPRL 5EU4B 4HUXB 1NLBL 4KKAC 2ZZUT 1RJZB 4R96A 3RL2A 2Y36H 2ZOKA 2NY6B 1UA6H 3QHTC 5C0EB 1B0GB 1A21A 4FFZH 1C7TA 3D39A 1JJUA 1F4YH 1NCDH 1XCTA 3LKOA 3S7GA 1KB5L 1KPVB 4Z7OF 5I19H 5IR1B 4WI8A 8FABB 5A40E 2LABA 1GOGA 2OXHA 3N06B 4KKLD 3FN9A 5A1AA 5KS9F 1IQWH 4R4ND 3ROOB 1CLOL 4MZ3A 1JGDB 3IDYC 1K6QL 4AQOA 4N9GA 2ITDB 1I8IA 1R24A 3QCVH 4KDWA 3FOLB 3ECBB 4EQ3A 3HC4L 5DFVD 4JQIH 2JIXA 3QUKB 5T3ZD 4KVNL 2Y72A 1EAJA 3U4EB 5IHLB 3FJTA 4UOW1 2FSEA 3BPCB 5E5MA 3UC0L 4MHHI 1YMHB 1YN6B 1JTPA 3HZKB 3DNKA 4PJFE 1I3GL 5BJTA 5CCKL 4FZEH 2WBKA 5E8DH 3GRWH 3I3EA 3TJEL 4ODXB 2A1WL 1W72H 5D72H 4ZPTA 3NCYP 1N0XH 3BD3A 3K2UL 3VXRD 5GZNC 2IANB 2VERN 1ETZA 4NHCL 4BZYA 1R5WB 2DQUH 4XVJH 4G3YH 2DQDH 4D9RE 3TPUB 1N8ZA 3FAXA 2AEPL 1Z9OA 2OJZL 5DMIH 5TGBB 3SGDI 4OCXH 5D8JH 4WY7L 2BHYA 3CMGA 3LRSB 1AIFA 1MEXL 4M6NL 4PLKC 3PP3H 1I9JH 3MRNB 2X05A 4CVZB 2J8UA 2F74A 3PNWB 3LD8B 4KI5C 4ONHA 4P5KA 3KLAB 4HIJB 4ELMF 4U1MA 3PJSA 3HMXA 1IKNA 1S7VA 4XBGA 3DSFL 4I0PA 1OD7A 4CDGC 1BZ9A 2AXFB 1S3KH 2OP4L 2VDML 4Q74A 4YK4B 2VLKB 4PRBB 5GGQL 1AQKH 2V5TA 3CH1A 4G9FD 4GW1B 3AUVA 2AJSL 4JDZA 1VADA 1WEJH 1X5XA 3KPQB 5IEKA 2EDNA 2YA1A 4HPYL 4NNYB 1BBDL 4UTBL 1RZJH 4XP4L 2OZ4H 4PJ5E 1TNMA 5C9JA 1A6WH 3GSUB 1L7IL 5A2IH 1FL3B 3QIUA 2A6JB 1U3HB 4ZXBB 4QYOB 3TBSB 5MEQA 5KSAD 5KVMC 3F58H 4POZC 1N6VA 4LBEB 2AJVL 5AUMA 3LEYL 1XGYL 5FCUH 3FB5A 5F1IB 3N1PC 5E1AA 5FYLH 1G0XA 1R5VA 4P2YA 4YNYA 2VXSH 4U0RC 3U1SL 1R24B 3TO4C 2AXHA 1ZTXL 4M6MH 4YQXH 4EOWH 1LEGA 4XX1G 5IKCA 5KVEH 1NDGB 1D6VL 3D85A 4H8WC 2NY4B 1BIHA 4LCIH 3T0ED 1I1FB 1PG7W 5KW9H 1F11A 2X2YA 1WWWX 4MJ6B 4EI5B 1AD9A 1XGPA 3PP4H 4L3ED 5ID1B 5L0QC 1L7TL 1P84K 4ZQKA 1QKZH 5HI5D 1UCTA 4NDMB 5JXAL 1U8PB 2NY7H 4ZUUB 5I8KH 2VDMH 3QJFA 4PRHE 3RRQA 5CEXA 5E8PB 2FEEI 3UJJH 4R7DB 4PY8I 3MJ6A 3WDJA 4KHXL 43CAB 2AJ3B 1P6FA 4ZFZA 2MCG1 1SEQL 3VCLA 4OLUL 4HH9B 5ACZA 6CGTA 4UU9A 1L6ZA 4G8GE 1CWVA 1OVZA 4XP4H 5JR1L 3VFMB 4PB9H 4X0KB 1BQHG 2Q3ZA 4PJHE 5IFJB 4YO0B 5ANMA 1U8LB 3S3JA 8CGTA 1QRKA 4F7CA 3K8MA 4HIXL 4UT7L 4M8QB 4Q6IA 3DV6B 4XXCC 1RUKH 1UZ8B 2G9HB 4KUZH 2DQJH 5HHOA 4Q9CA 2YPLA 4FZEL 4XCFL 2GIYA 4LF3A 1W72B 3GIZL 1C5CH 4Y16B 1F2XK 5T1KA 2OI9B 1ZVYA 3BZEB 4FQLH 4JFQB 4S2SA 4QHNA 3WXWH 4QXUH 1FPTH 3ZDZE 2DTML 1L4IA 3MJ9L 4ELMB 3G5ZB 3QRGH 3GO1L 3QDJB 2RCSH 4QHLA 4N90E 5I76A 5BO1H 1J0ZA 4APQD 1MHCA 4U1LA 1OM3H 3JWDH 4NNYA 4OZGB 1KTLB 1DBJL 1S7RA 4DKEH 3RBGA 5F7HA 4OZFA 5IG7A 3MO1A 2WIMA 3TV3H 2VITA 2KPNA 3MLTB 2A9ML 1K8DB 4APQA 2JK5B 4MNHA 4NKQB 4HKZB 4LSTH 1I7ZA 1G6RH 5J56B 5F9WB 2JLLA 5FEBA 2HRPL 1G0DA 1B3JA 5ALBH 4L3AA 5EN2B 2HLFD 3V6OC 1PVHA 4WW1B 2IH3A 1EPFA 3LKPB 4C56D 4NC0B 3D5OF 3N85H 4U33A 2ATPB 3DIFA 4P23A 1JNJA 5JW3H 4V1DB 2XWJB 1IM9D 1UCBH 2CLZB 4GBXD 4LEOA 3M45A 3AREC 2DICA 4J12A 3PHSA 4M1CD 4M7ZC 2F58H 1ADQL 2R29L 2YZ1A 3KJ4C 1FSKB 4JQVA 3D3VE 5DJ0A 4M7LT 3OJ2C 3QQ4A 1H15A 2PW1B 2R1YA 5DLML 4L1HA 5ADOL 2NY1C 5CSZA 3CDGB 5ETUB 4LSQL 1AQDA 2MQ3A 2DYPD 4HJJL 5F8QC 4KPHL 3DX7A 5I8KL 1CE1L 1A6VL 3U7WL 1UXSB 3GSWA 4ZFZB 1MVUA 4UTAH 2CDEB 3MLYL 4Z78B 4BKLA 4OUUA 3SJVB 3V7AE 1JZ8A 3L3JB 5JORB 4XAKD 3CDYA 1QTYT 4PB0L 3IAQA 1VPOH 3ZTJH 3ILQC 4HCRH 3BP5A 4RNRB 3EOTH 1N6UA 1Z2KA 3IJSB 3D39E 4Q2ZB 4EKXA 4MQTB 1MRDL 2K3TA 1DSFH 2MCPL 4D8PB 5HHOB 2P5ED 3OKLA 4CVUA 2MFNA 1BFOB 3CD4A 4JZOB 1NDMB 5J06A 1VDGA 1UB5A 1FVDA 4K3JH 4Z5RB 2XZCL 3B9KB 3PIQB 3BUTA 5FGBA 1WBYB 3MGTB 4JPWH 4DGIH 3VXMD 1EHXA 1U8NB 3MJ7A 2DS4A 3O3AB 3KJ6H 2Z8SA 5IVZA 1N2RB 3BSZL 3G5YA 4MCYB 4I2XA 4DVBA 1E4KA 2R0WH 4FQPA 5JIKA 2DM3A 2XY1A 4XPHL 5FOBA 4PJHF 4CU8A 4OZIE 4TSCL 4UAOC 4Y4FD 4UDTB 3G6JF 3SKOB 2EC9U 1JNHB 3O6MH 3ARGA 4XNQB 2R0ZH 3WLWD 4GKNB 3CMOH 3S37H 4HHAA 5GPRA 3VXTA 4LASH 3G6AB 4MQ7B 3FO0L 3DRTB 3RUGB 3AU1B 3C9NB 1WT5A 4H0HB 4WI9A 1A6VH 3H2WA 4PJ7B 1QSVA 3FB8B 2DDQH 4PGZA 4QTHA 3HPLB 4HIHA 1JN6A 3AS3A 4GMTH 3RZCA 4HW6A 3MUGA 4KTDH 1RULL 4F80A 3QCVL 3GMLB 1I1CA 1SEQH 4HZAA 2WBJD 3BD5A 1SY6H 3L7FB 3VFRB 4FXKB 1NGWA 3QUMH 2CPCA 1HSBB 5IB2B 1BIIA 4ZO7A 1UM6H 2IFFH 1UKSA 3BP6A 5I8EB 5B38G 1MUJB 4JO1H 5H37H 3TEUA 5L88L 5CLWA 3A6CL 3HE7D 4OCWH 5DO2D 3SDXF 1DBKL 2MNUA 3GHEL 4DVRH 2X9XA 1CD9B 3OHXB 3W0WB 4OZFH 3AS1A 2VR5A 2XFXA 5JZ7C 2UVEA 5T1LD 1NCNA 3AAZB 3QZWB 2R8SH 3L6FA 4RWYL 2J3SA 4KI5F 5I18H 2BP3A 2EDHA 5KG9B 4AIZA 4Q2ZA 1J0YA 3ARFB 1LD9B 4E0RA 1NCWH 2PXYB 3D87B 3JTTB 4QT5B 4P4KC 1XGYH 4MDIB 2X44D 5K9JL 2ZOLB 5L9DH 1DBMH 4TQEH 4PJAE 5EUKA 1N6QL 3IVKB 4N1EA 3H9SA 2FZ3A 1PJ9A 4UQ2A 5DDHA 3X12A 2A38A 3P30L 3BMVA 1O7SA 4YDKL 3QXTA 3QUZA 5F9WC 1FNSH 2EDTA 3QI9D 3VXUB 2XNAB 1AD0B 4XVTH 1TETL 4PJGF 4WFGE 3S36H 4QY8B 2V2XB 1CL7H 2NY0B 3TH3T 5JDSA 2LAAA 5C0JB 1P5VA 3PL6A 5ALBL 1NBZB 3JWOH 4HG4K 1FO0B 1P7HL 4K3EL 4LMQI 4M7JL 2YRPA 3C09B 2YMXH 2VZ3A 4KVCH 2FJGA 3HG1E 3BN9D 1MFCH 5IHZB 4YFEA 1TDQA 1UKTA 4NZJA 5A16A 1EFXD 1MLCA 5DJZA 4OZHE 4OCLC 2WINA 3X3GH 3G5XA 3LKNB 1XMWA 2BFVL 7FABL 3O4OB 4IJ3C 4F9PA 1G7PA 4HKXA 2V5MA 4MYWB 3F7VA 3RL1A 4GSDL 3LH2L 3K2MC 4U7KA 1N0LA 3LQZB 5EWIH 5T1MA 5HGAA 1HDMB 3OV6A 1A0QL 1JHLH 2J12B 5D7LA 2D7PA 2HWZL 1VFUA 1VSCA 3LDBC 5D1XB 4YPJA 3ARED 2WAHA 4YDVB 3EDKA 3PWPA 4ORZC 5KZCB 1MFEH 5SX5K 2WWKO 4HGKC 4F7MA 3ULVL 3G6JA 1D5IL 4LLDA 3K8KA 2FO4A 3G6JE 2P8PA 4OIIH 4PJDA 4XTRD 3D25A 1RHHA 3FO0H 3VGFA 3WCYA 3L9RB 5CMAB 2D31A 1FORH 5GGTL 2HG5B 4KZDH 3GSNB 2YPKA 1FZKB 4X99B 3MV7A 1RJYA 4RMRA 1A7NH 2C1OB 4G8FB 5HJ3B 1Y6KR 2Q76B 3RWFA 5I66B 2OR8A 4HF5L 2H1PL 3CLFL 2Q8AH 3CZJA 3QG6A 1R3KB 1YPZF 5KOVC 1S9XA 2MKLC 1CDHA 1CXEA 4MNGB 4XWOD 2FATL 1VFBA 4K8RH 3TT1H 4Z77B 3CFCL 3VXSD 4EZMA 3HE6B 5GISH 2BC4B 3T04D 5JXED 3KPSE 3QIBA 2RR3A 3P30H 4FQ1L 3GI9H 3NFSL 1QVOB 2WLZA 3QUYB 3SPVA 4BQ6A 4PBXA 2EH7L 1DUZA 1N26A 5HHXH 2BVTA 4GFTB 1RHFA 2R39A 3F58L 1KIUA 1N4XH 3MNVB 2QADC 3FOLA 4PJIF 4S1SL 1KB5A 1T5WA 4HUWA 1D5IH 2MKWA 2HTLD 3V5HB 1OAZL 3QG7L 4LLYA 1OM3L 2GCYB 3QR2A 1NJ9A 4JO3H 1MFEL 5KVEL 4XI5C 1OTTC 4R0LC 1ODAA 1QEWB 3QQ3B 4NC1C 3QIWA 1SY6L 2XPGA 1FFOB 2VE6A 4NRZA 3EYOB 2I5YL 4EUPA 3C8KA 3GBNL 4ZUSB 1U58B 1A6ZA 4NKOB 1MHHB 1RK0B 3UTSD 3REWA 5FDWA 1MJ7H 1YYML 1I1AD 3LN4A 3ARBB 3PQYE 1P7KA 2IAMD 5DS8B 4HWZB 5HGBA 5KSBF 3HC3H 3L5JA 1HHGB 3BKYH 3TLRA 3UTZB 2ADIA 3KXFD 1U0QA 3I75B 1WBZB 3WNMA 4IDLA 4LSVL 2GEEA 4WV1A 3V0VB 1TVHB 3UTTB 2WBJC 4P4RA 4FQXB 5GZOD 1SEBA 3BDYH 5H37G 4K8RC 3X11A 1AJ7L 3NFPA 4LHUD 2VUYA 2OI9C 5E70A 4U1MB 1OAKL 3NOIA 4ZOEA 4DK3A 2F8OA 1JHLL 2AJZA 3LAFA 4KK5D 1FNAA 3IFNL 4XVTL 3BMWA 3LSOA 3HC0A 5ECJE 4CW1B 4PJCE 1YMMA 4LAJH 4QWWD 3VMNA 1RSFA 1QSFD 2BY0A 3GMRB 4JDZB 1NC4D 4P5TA 4C4KO 3LEXA 3CAFA 2XN9E 2J7LA 1G7JB 4GMSL 4RGMB 3DMMA 5LG1A 5EDXA 4PJ9B 4OZGF 3EO0A 2BC4A 3KPMA 3IDGB 2BSTB 3OR6B 2P7TB 1S78C 2XWBA 5D4QA 2X89A 4EVNB 1HNGA 4JVWA 2AXGB 5EZIH 3LPFA 2R15A 3QUYA 3PXJA 1J0HA 2ZUXA 5KSBE 5A43C 5FO9A 2OTWA 4ZSOA 3WE6B 1RZ8A 1OGAA 2BOBB 3OAUL 4ZMAT 2ZUSA 1IGYA 3MSPA 4Z0XA 5L0QB 3T0EA 4S1QL 5C6PB 2FECI 4YBLC 4X7SH 1PD6A 3D9AL 4DKFL 1ZVSA 1VERA 3NZHH 5MHSE 4UT7H 4NN6B 4GG6E 1QSEE 2P42B 3BGAA 1BJ1J 3O6LL 4R26H 5HYSB 1OGTA 5HI3D 3LS5L 1B9ZA 1CR9L 5DJ6B 4O51B 3I84A 4M7KH 3A0OA 1EO5A 2P8LB 1BD2B 4NO0A 1RK1A 1T7WA 5BZWA 4PREA 2BNRA 2A6DB 2X4PA 2BVYA 2GKIA 5DD5H 4M7ZB 4XMLL 3JV4A 3MOBL 5SV3A 4BH7A 4Y5XB 1AGFA 5LXGL 1FFRA 4F33A 3SN6N 1UWGL 1NCTA 4YEEA 5GIRA 4Z7NE 3U6RB 2X89D 1YEKL 3K0WA 4WRLA 1KTDB 3S35L 3E2HB 3GJFA 4FQCH 1A7QL 1ITCA 3Q0HA 4ETQA 2BNRD 4HWEH 5I6XB 3CSYA 3BE1L 3DXAE 3PABA 3QXDB 1MJJB 2ENSA 5L8LB 1QSFA 1JF1A 1T1ZA 4Y16C 4BH8A 1UJ3B 2UUDH 5IROC 3MRJA 2UYLB 3N0PB 1KEGH 3HUJF 2HN7B 1RY7B 3FTGB 1UZ6F 3DV6A 4JY5L 4OSUL 3OKDB 4P4RB 1ZMYA 3U36B 3STLA 3F5WB 1QQDB 4S0SD 3RWJB 1N3NA 3I9GL 3Q48A 4P9ML 1TQBB 3MRKB 1LNUA 4DUVA 4Z7QF 5HHPB 1ZLUH 4MD4A 2EYSB 4YUEL 2UWEE 2FX9H 2JJSC 3DTXA 3MBXL 5CJOL 3V4VH 5FA4B 4LQ1A 4ODHH 3HMWH 1PYWA 5ISZE 2GSIA 2W1NA 3O3DB 3QUXD 4GKSA 3DMMD 5BXFB 4OCYL 5CZVL 3S4SB 3DROB 2HFTA 2IJ0C 5CSGA 2Q7NA 3VWJB 2G5BB 2OX5A 4N0YH 2IBZX 1KC5L 4NHCH 3VH8A 3TBYB 3H0TB 4RDQF 1JFQL 2I60H 3BP4A 3KR3H 1B4RA 3BJ91 4NN7B 3MCG1 4HCRL 4BZ2H 1LP9E 3NFNB 1CFQA 2ZWLT 4XWOC 4RX4D 4XNZC 4QKXB 4HC1H 3KNBB 4TYUA 4XGZA 4FQHB 4IHOA 2R1XA 3QHZH 4HMCA 4NQDA 1GZPA 4HXBL 2IPTL 2GYSA 2CIIB 1U8MB 1XF3B 2GUOB 1Q94B 3HE6C 3MLRH 2PYEE 5GS0C 1ACYL 5EU4A 1HI6B 4R2GB 1IGFL 3EJJX 5BMFH 1UENA 1OGTB 2VTFA 2GTZB 4P23B 1U93B 3G5ZA 5AWNL 3UC0H 2YD4A 4LARL 5FOJA 4Y5VA 3CK0H 3JV6B 2BNRB 2X4UB 3IF1B 3RVXD 2XZCH 5J1AA 2YHGA 3CU7A 1XH3A 2P46B 4GAGL 4M3KB 4OZGA 4P9HH 4U3CA 1P4LB 4X9HA 4BA8A 3WUWG 4YBHA 5J6HB 3QQ4B 4XPBH 3U6RA 5IK3B 4D0CA 4XMLH 5AZEH 3B2VH 4FQIH 4NQCB 3VDCA 1F8TL 2WWKT 4JM2D 4LNRA 4LAQL 4HKBA 1LEKB 5FCSH 1D6VH 1WBXA 2B0SH 3D18B 1AHWC 4MA1B 2BHZA 1OAUL 1DN0A 2UWEB 4CVXB 1IFHH 5JW5A 3LRGA 4HG4J 3HAEG 5FGCE 1CICD 2ICEA 4PY7B 3K4ZA 2AJVH 2FR4B 2Y36L 3L3GA 3QDMB 3FTGA 1YC7A 2IMNA 3U9UB 4ODUA 3OKOB 3S6CA 4JQVC 5SWZE 3RU8H 4FFZL 1KNOB 4YX2L 3DIFB 3VFNA 3MV7D 4I0KA 1YN6A 1J10A 1VESA 3RGVD 1QRNA 1OHQA 1CE6B 4LRIA 1JMZA 5CZXD 5C6WH 4PJBA 3QNXB 3V0WH 5SWSA 4X9BA 3MGTA 1F3JA 4QRPA 4HEME 5I0ZA 2DQEH 2XQYG 1OT2A 4CAGA 2BDNH 5EOQH 25C8H 5D9SA 3DGGA 4QRUB 5D2NA 5GRWA 4CADB 4XAWH 3SGKA 3EYUH 5F9AC 2GSGB 5F96H 4DVBB 1RMFH 3JTSB 3QPXH 1KCUH 3M17A 3MLVH 4L8CA 2VH5L 3WFCH 3ARPA 2OR9L 3EHBD 4WWKC 4YHPB 3GMPA 4PGDA 3MRLB 1I1RA 3BIBX 1PGRB 4UUJB 3WHE0 3SKMB 4NQVB 5D7LD 1AIFB 5AWNH 4MNGE 1A7OH 1IKNC 4N0YL 2DF3A 2VXUL 1A4JA 1AR1D 4LVNB 2I07A 4NQTA 4Z7WE 4FOMA 3ARGB 1D9KA 3WFHA 3FZUD 1L0YA 4Z7WA 1ZA6A 1KN2L 1EAPA 2W07A 3GNMH 3K1DA 2R1XB 3KLDA 1XGTB 5DEGA 3LQMA 1E28B 3DETD 3I6LE 2C3GA 3QEQA 2BNQA 1UM4L 2V9TA 1V5JA 1W0WB 1GYAA 2FECL 2AEWA 3GK8H 5JOFA 4G43A 1BX2A 5C07A 4I77H 4MCZB 3MTRA 2GT9A 2MTPA 5FHAL 1I7TB 4WEMB 1OTTD 5DUBB 5B4MD 3WXWL 3GMMA 5F72S 4LCWB 3TZVB 1TQCB 5CD3A 3B9DA 1QFUL 4L5FL 5D7SL 3GSUA 1E6JH 2L4OA 3SDAB 4J3SA 3KPTA 4HBCH 2RQ8A 1ZHNA 4PJ8B 2CJUL 3PGCB 3WXVH 3ESVF 3U79A 4KK9C 5C6TL 4YFLF 4LSPL 3MJ9H 5DFWH 4I3SH 3OHXA 4JQIL 4IRJB 1SYVA 4O2EB 3H9SD 1J0KA 4ZS7L 2FH8A 5CLTA 4E41A 1EFXA 4Y16D 3CFKA 2W0FA 4DN3L 4RZCB 4XNYH 3KJ6L 4I18A 3H8NA 4M1GH 5TQ0H 1QP1A 2AGJL 1G1CA 3REVB 3ZDYF 3DSNA 2Y07H 2EKSB 3HNSH 3I3DA 2WUBH 4NPYA 3ARXA 1N59A 1A22B 2OZ4L 3MUGB 1FO0H 4QRQB 3FO1A 4JZJA 1RJCA 1JHKH 1FE8L 1AXTH 4QXGL 3QNXA 5CWSA 1IAKA 3RWGB 1D5XA 1SBSL 3VXUA 2NY2B 3R1GL 4JDVA 3QI9A 1AD0A 5TDNB 3WDHA 2X1PA 3MRCB 2AJYH 4NNPH 5DLMH 4YJZL 1OAXL 1ZTXH 1FNHA 2PO6C 1A9BB 3PL6B 2NXZD 3KPRA 4A6YA 2VLLA 5L8JB 2QSCL 1E4JA 2WBJA 3L5XH 2OJEB 4QRRA 4ZUVB 3NFSH 3RHWF 1Y6NR 2J4WH 1U8JB 3RU8L 3MJ9A 4OZFG 1NQBA 1S7TB 3CCHB 2CMRL 4F3FA 3L95A 5D7IE 5T1LA 4R0LB 3D6GA 2FX7L 1JPSH 3G5XB 4G6FB 1CXHA 1RZFH 3QDGA 3HE7A 2V9RA 5L88H 3RDTB 4NN5C 4XC3H 3IKCA 1W0YT 2Q8BL 3O4LE 4ZOCA 3UJIL 1GGBH 3IXTA 2WBWB 1HSAA 1MWAH 3ZE1F 4YHIA 5KZCD 5I1IL 2Y1VA 3OQ3B 4KRPC 4NUJA 2IGFH 4WHYG 1K5NA 1FYTD 1RZ7L 3QUYC 4AQ1B 1NBZA 3H9YA 4HIXH 4IOIB 4IRSD 5I0DA 2BVUA 4G8GA 1FZMB 1II4E 5LGHL 3FFCE 2CK0L 5EOTB 1Q9OA 3RDTD 3O41A 4Y4KD 4Q0XH 4JN2A 3SDDB 4IEFB 3SDCD 3QUKA 4QF1A 5FUCE 3ZTNL 5DHYA 1T21A 2EIZB 1D5MB 5EBMB 2WINB 3T2QA 3F12B 2YPKB 5TE4H 1KIPB 4RGNB 1JYNA 1YQVL 2DQEL 2O93L 3Q6GH 4NRXB 3TBTA 3QFJE 3RTQB 1HH9B 3P4MA 4YE4H 1ZE3C 4L9DA 2W0LA 4FQ2H 3HB3C 1FYHB 3OR7A 1GSMA 5E00A 4X9GA 1GPOL 4JAMA 2EXWC 1WCBA 3ELAT 4P5TD 2VQ1A 4P0DA 2FIKA 3N50A 3T0BA 4JFFA 4P2CG 1MWAL 2OSLB 2PUQT 3WJLC 1HHKA 4I0PC 2XIDA 2R4SL 1ES0A 4X6DA 4BKLB 4KI5E 1YECH 1FFQA 5IGXL 2EYRA 5D7KE 3C8DA 4B41A 1IQDB 5AEAA 1R3LA 2FWOB 3HZKA 5CP7B 3ZKSD 4H8WL 3NIFE 4RAUA 3VRIB 1OSZA 3QDGE 1KELL 3BQUB 4QRSA 3OZ9L 3C09C 1WFUA 4ZAKD 3ZSSA 3D9AH 3EHBC 2H32A 1EO8L 2BY3A 4NO3B 1UB5B 3UTQA 4EI6B 1XIWB 5GGSB 1EGJL 3LN5B 1QEWA 2IADA 2KL6A 3RWEB 4MD5B 2Q6WA 2FGWL 35C8L 1ZA3A 1VFBB 5FM4A 3UPAA 5J7CC 2C5DC 2ADJB 3FB7B 1MHPL 1SVZA 3ULUE 3SQBA 4TVPH 1UZ6E 4PTTA 3RJQB 3OKYA 4QYOA 3TBSA 1GGCL 3DO7B 1T83C 5LQBH 1S9YB 2YBRB 3RPIB 5LBSH 4FQXC 3STZB 1IL1A 2X41A 3T2NH 1REIA 3O4LD 1T22A 1CVRA 4O9HH 4HUMB 4U6YA 1KYOK 3UYOD 2HH0L 5LCVH 4U1GB 2X4OA 4ZFOA 2CLVA 3QDGD 5E2WL 2D0GA 4OZ4A 2ENYA 4ODTH 4WV1B 3PQYD 5ERWA 1BBDH 4UTBH 5DJ2A 1HEZB 4CU7A 4MAYC 1UM5H 4UNVA 1ZEAL 2EO9A 5FYKD 2VNCA 1T21B 5D7KD 4OD2A 1JGVL 3ARDB 2D9CA 3QIWB 5C2UB 3MXWH 1G6RB 3WNKA 4BQ8A 1F4WH 1U8PA 1DFBL 5DR5H 3UYRH 4ZUUA 5C9JB 2VL5A 5D7JB 2YUXA 2YK1H 4QRRD 4LCCB 4F37F 3C6SA 2WUCH 5I1CL 3MBXH 5F7WC 2APTA 2DM4A 1PZ5A 4WW2C 1S8DB 1DL7H 4P4KA 5DRWB 3A67H 5SWZB 5CZXC 1RVFL 2QKIB 1WAAA 5EPMA 1P2CB 1C5CL 2AV1B 5DS8A 4OCRL 3NCJL 5ESQB 4HWBH 4YO0A 2F54B 1BLNA 3VRLE 1HHKB 4Z18A 4JPIB 5D1ZA 1TVDA 2AXGA 1XGUB 2Z31A 4I5BB 4M9OA 4TSAH 2Z4QB 4I1NB 1LWRA 2F53E 4F2MA 4A2MA 4X4XA 3QZWA 4NN5B 1IQDA 1H5BC 3UBXB 5KSVB 3TESA 2VIRB 1OSPH 1YZZA 4QHNB 2ZSVA 3O45A 1OSZB 1K4DB 5TPWH 5DQDL 1CICB 3CH8A 5DQ9B 3C8HA 4BJLA 4HFWA 1FFPB 5HDOA 2OLDA 4LDEB 4CW1A 3FO9A 2R29H 3VMPA 1TITA 4U1IB 2QBWA 3U4BL 3FQUA 1MJUH 1QBML 2DWDA 3TC9A 2VXUH 3B5GA 1QNZL 4RRPA 1MREL 2DL2A 5I1EL 3E3QC 3O6FB 4HIEB 3UROR 1KCKA 1OW0C 35C8H 2Y06L 4O58L 2VITB 1LO4H 1A9EB 2OBGA 2X09A 4HLZG 1GH7A 4N0UA 1YN7B 4L3EA 4KRPD 3WV0A 5DJ8A 4G8IB 1JGDA 3LB6C 4H1LA 2BHUA 5EOCL 5C86A 5JOEA 1B2WL 3CDCA 3WFZA 4GBXB 4HIIB 1QFWI 2HFGL 4V1DD 4N9OB 2QHLA 1KELH 2YD7A 3QQNA 3KPNB 5BV7H 1VEPA 3QB7C 5SX4H 5DFVC 4ALAL 4L29A 3JWOC 4GW5A 4PGJA 1CGXA 1IAMA 4O51A 1SMOA 4WUUD 1WK0A 5KSAC 3ZE0F 5GS1A 5J6GA 4KZEL 4L9LC 4GKOA 1QQDA 4PJDE 5EIQA 5L2JA 5LWYL 3WMSA 2A9MH 1SYSB 5I73C 3JV4B 2P5WA 4Y5XA 3BPLC 2Y25A 4UV7L 4OLXL 3OKNB 1G9NC 3MO1B 2IF7A 2Z93B 4GMSH 3TO2A 5C70A 1B4JH 1HQ4B 3MZTA 2B1AL 1RUPL 2ICWA 2ID5A 1M7IB 2DQCH 2XN9B 2X4SA 3ROOA 4XXDA 3TPUA 1BWMA 2JCCB 3CSYB 4GAGH 4P9HL 3T2PA 2FEEL 4QOKB 2P1YA 3KDMA 1KF9B 4AIOA 5C07E 2Y07L 3QNZA 2RBLA 3B8SA 4EDWL 2FO1A 3UTPE 4DAGH 3GK8L 5KVGH 4RNRA 1S7UA 1ZANL 4XHJD 2F74B 2GFBB 3PNWA 4P23C 4UIKL 5C0RL 1RUAL 4HIJA 3LIZL 5J13C 5KS9E 1YNLL 1UH3A 4XVSL 2AW2A 5BVPH 1H3TA 5E9DA 3TA3A 3M1BA 2OL3H 2CRIA 4RMSA 3PIQA 4JFPA 5FKPB 1GC1H 3IFOB 4Q9RH 2R2EA 4KY1L 3BKYL 3DTXB 4PRAB 4QTIH 2XZQL 1VEMA 3P9MA 4FMKA 1CICA 1EEQA 4PJ9C 1L9MA 1S9XB 4WI5A 1DEDA 3MLZL 3S4SA 1LK3L 3FO9B 3NZ8B 3SE9L 3IF1A 3AFLA 3ILPA 5LAXB 4IOFD 1FIGH 4G6JH 5DVKA 2LAGB 5J6HA 3QIUB 5IK3A 1KJVB 3OJDB 3SE8H 5D6DC 2N4IA 4PJAB 4CBPA 3UO1L 3BP5B 3IJSA 5KANI 4AMKL 1BQLL 4XCEA 5E1AB 1DN2A 4J3OC 5EIIA 3HMXL 1JRHI 4XH2A 4Z7UE 2AK4D 3ETBF 1T4KA 4UB0L 4GLRI 5EU6A 3MV8B 4JZOA 5E6YA 3T4YA 4KXZI 1NDGA 2BY2A 2CIIA 3ZYZA 2X42A 4YR6B 5DR5L 2DKMA 2X40A 3TVMB 3U9UA 4OIBA 4BQ9A 3BGMA 4KJYA 3CFCH 3ZHKA 4HPYH 5FM5O 4D9LL 1ZT1B 1FNGA 1QRNB 3MX0A 3EYOA 4EUPB 5B8CB 5C0GA 3OGCA 5CHNB 4DCQB 1DQQA 2EO1A 3TIEB 1BBJB 4OZHB 4P49A 5CINL 3ZZ1A 4A6YL 3D39D 4NO2B 5K9OB 4YHZL 4X8JB 1P7KB 3SKOA 5FCUL 1MIEH 3BAEH 3O3UN 3VG9B 5E4IA 5L9DL 2UWEA 2VQTA 4CVXA 5FYLL 3CVHL 2XFXB 4P5TC 2F5BH 1WBZA 4OGXL 4WI6A 4U7MA 2VLKD 2L0DA 3T65A 4M8QA 3PE9A 4H5SA 5EB9A 1DBKH 1U8HB 5DJCB 5ICXB 1HWHB 1M4KA 1M7DA 2GJ6B 4FP8L 4JCMA 1VGKA 3MLRL 4E0RB 1DQJA 2RFXA 3HMXH 2AI0L 1A6WL 1HHHB 2DWEB 3JTTA 2E6JA 3FFCA 3HAEH 1EAPB 2ARJQ 5D7LE 4L4JA 1JVKA 1NH6A 1XGTA 5DD0H 4Y88A 4Y2OA 4Q6IC 1T7YA 3W11D 2E3VA 2WLYA 3V52H 4RMQA 3LV3A 1MH5B 4R7DA 3HRZB 4ZAKC 5MEPA 1CD1A 2FX8H 5EZJB 1AGCB 1FFNA 1I8MA 2J5LB 1G7JA 2HTKD 5DWUH 4DKEL 3V5DA 3QZWG 4L8CB 3RZCC 1H5BB 4KQ4H 1G7MA 4G42B 2HJLB 2P5WD 4IDJH 1YEGL 1GGIH 2K1MA 5DA4A 1QO3B 2V5RA 4XAKE 1J11A 4FTVE 4CJ1A 4WWKA 1MFDL 1NGXB 3L3KB 5DK0A 1OGAB 3LB6D 3BZ4A 5A16B 5HYQA 3F62A 1CK0L 5DJZB 5EZOL 4YE4L 1EH9A 2R2HB 3SKNB 1EFXB 1NMAL 2HT2C 3CFEA 4PJXB 5C0EA 2BMKA 3IGAA 2AK4B 3ULUF 5HYSA 1BGXH 1T0MB 4XTRC 1BF8A 4L3CB 4NGHL 5TF1H 2CLZA 5E2TH 5FXCH 3CVHB 3FCTB 4MAYD 4U05A 4F7TB 1BX2B 3EYQD 2OR9H 3HFML 3QO1A 4N8CH 1ND0B 2D7OA 1IRAY 2OK0H 5SWSE 4QY8A 3BX7C 2VZUA 4PJEF 4GBXC 3TBVA 3QT2A 5E2WH 3BKML 1S7WA 2RGSA 4C83A 3D0LA 5MENB 4MLIA 3FB6A 1RV6X 1OP3H 1HYSC 1UXSA 4AT6B 3FRPA 4RGMC 2H8PB 5FUZH 4RFEB 3CFIC 3OKMA 4WFEE 1GHFH 4NM8L 3U7YH 3IJHB 2PO6A 3DBXB 3RPKA 4ZUVA 2IH3B 3BKJL 4N0CC 5DVMA 1ZHBB 2HN7A 5T33H 4I18B 5DJDA 2YPLD 3WFDH 4RX4A 2BSRB 3MCKB 1IAOA 3O0RL 3RL1B 4F3FB 2XWJA 4HJJH 1BFOA 2W9DL 2Z31D 1N5YL 4NUGH 5EO1B 4XCNB 3OZ9H 1CGSL 3HI1B 3Q3GA 4L3EE 1HKFA 2PW1A 2R1YB 3NA4A 3E6HB 3QNYB 4LSQH 3NPSC 3QCTL 1MH5A 1DE4A 3WKMH 1J0JA 1KENL 4MCYA 3NA9H 3G6DH 2DDQL 4JGMA 3TO4A 4DKAA 3CSBA 2VL4A 3O9WC 4PJ7E 1AXSB 2FO4B 1BQLH 2KZWA 3Q1SH 4JKKA 3JZ7A 2B20A 3D25B 4JM4L 4ZYKB 3UAJD 4ETYA 2NY5L 5DQDH 2NY4C 2FJFA 4IS6B 3TN0C 1TJHL 3DX6B 3FZUC 4KAQH 2A6KB 2ZKHL 3BJLA 4U6HB 4HS8L 2Z8WC 2FL5B 4OQTH 3C5ZA 2A0LD 4XVJL 3TT1L 2IAMC 2R0ZL 2PN5A 1JZ3A 5D1QD 3DX8A 4JN1L 5AZ2L 4M1DL 3BT2L 1FL6B 4NKDB 5BS0B 4XNMB 5SX4I 1C08A 4TULL 4Y2DA 2EYTB 2GUOA 3A67L 4KROB 3DHMA 1IGCH 5GZND 1QPXA 5HDLA 3HI5L 4PP2B 1PSKL 1F2QA 1S9VB 2VE6B 5IOPB 3MFFA 1NUNB 5HDQL 4J4PC 4JM2B 3MV9B 1WWBX 3GMLA 2PXYC 2R0WL 2VABA 3MBEA 1CDUA 1T03H 1YEIL 1XH3B 1PY4A 4MXQD 1KJ3H 2RCSL 3DRQB 1BIIB 3F7PC 4Y1AB 1W0VB 1KTKE 3QWRD 5C7XH 5D70L 5DFTA 2NR6C 1Q9LB 3O41B 2EECA 1IZJA 5T3ZL 1C5BH 3T1WA 1E4XL 3H9ZA 3BQUC 3WS3A 4XNQA 4LOUD 4RMUA 5IVOA 1CL7L 5DUML 5I1LB 4LIQE 4U6VL 2O61B 5HVHC 2L7UA 3ABZA 1UJ3C 1XF4A 4NZRH 3MNWA 3F7YA 3WNLA 3Q2CA 4LSVH 2YD5A 3EOAA 4GRWE 4XPGH 4DZBA 2AJZB 4XWGL 4RAUB 1M05A 1LK2B 1LE5A 5DRZB 1BJMA 3SO5A 3KYMB 3QFJD 4ONFL 5HVHB 1YYLL 4IRZH 4L4VB 2ZCKH 4PTUA 2VJXA 1T66D 2VDOH 1CDIA 2VDPH 4OLYL 3EGSA 1FVCA 2YXMA 3AMLA 5IBLD 5IWLA 1NGZA 4GKZB 4U6TA 5E00B 3CXDH 2XN9D 3DXAA 4XCCL 2ADJA 5IQ7L 1J7VR 3VFMA 1DLFH 3ZDXE 4KJPC 3VMOA 1K9TA 3O6FC 1OP5H 1CI5A 3OR6A 4QHMA 3H7BA 1YNTA 2IPKA 3W0WA 3DO7A 3JWOL 2Q87A 4CGTA 2YBRA 2C26A 1ES0B 4X6DB 3IYLW 1IGML 3MRLA 4CKVX 1WZMA 3FFCD 1N7ML 3EFDL 1KULA 3AVEA 1AGDB 1NKRA 1I4FB 1R3JB 5F93C 1N6QH 4PJGB 3VJ6B 1D6EA 4U6YB 4LHUA 1DBBL 3Q1SL 1KJ2H 2ZSWA 2ZUQC 5T5FH 1R3LB 2FWOA 1FNSL 4AIZB 1NMCC 3CFDA 1A4KB 3CX2A 3TV3L 1KLGB 2DIJA 4GLRH 2B7DT 4P99A 4NHUA 5DJ6A 2A83B 5A3IC 2HJKA 1L7IH 4ZUWB 5ITBH 4Z6AT 3CUPB 2G60L 3HG1D 1AE6L 3O9WA 4KTEH 5F6IB 4NBZB 5GGTH 3GMNA 2SEBA 1NGYB 1P7QA 4P48A 2X4PB 1WISA 1QBLL 1T7XA 2VXQH 4XWGH 3UO1H 3NCEB 3HZVB 3DUUA 5IG7B 3N9GL 1AO7B 5IW1A 3EO0B 5D1ZC 4OZIF 5E2VL 3TN0A 3C5JB 3GEWB 3INUH 1A3RL 1XAUA 4FQLL 5C0JA 2ORBH 5CUSH 4K2UH 2JK5A 1SM3H 4MNHB 4X7SL 5E08L 5CJXC 1AP2B 1I7ZB 3GMQB 1EK3A 4GRWB 4JEGB 2PYEB 2V7NA 3STZA 3PABB 3G5VA 4N9GB 3DYMA 1BP3B 3OPZL 3BFOA 1JGUL 3T0XA 3EYQC 2VDKL 1DLFL 1WQVT 4CVWA 4PJEA 2VSDA 3DWTA 1RJLA 2JJSA 4R2GD 2DQIL 3ARWA 1DJSA 3KAAA 2AP2A 3OKDA 2EIEA 3ZL4L 4YBQD 1G7PB 4LQFH 4A2LA 4AEEA 5BV7C 2FRGP 1P53A 4I77L 2HVJB 2J6EH 3CMOL 4PUBL 2AEQL 4E5XB 1HDMA 3S5LB 1K4DA 2OL3L 1FGVH 2VDQL 3QWOB 4LKXB 2D7MA 2VL5B 2CIKA 3SE3A 1QPPA 3VDAA 4PJIA 2X7LB 4PTUB 5JXEA 1ETZB 5CEYB 1I3UA 3FQTA 2Z0BA 3LEVH 1MCBA 4UAOB 5DRWA 1Y18B 3QPXL 1E4XH 2Q8BH 1MFAH 3DXAB 1X5GA 2YN3A 1QSFB 5GGSY 3V4PH 2R9HC 4YXKH 2HLAA 4BSVB 3L3DB 3GKZA 2W9EH 2XI9A 5FHBH 1J5OH 2GJJA 1YNTB 5J9PA 2OMNA 4PGEA 1TNNA 1YUHA 4OGAD 5DZOA 3WIHA 4PJ8C 1PG7L 3RZCD 5I71C 1WZKA 4NIKB 1A3LH 1KCRH 3SOBH 4X6BA 1FZKA 3A6BH 4WUUE 4XBGB 3QIBC 4RFNB 4NJ9H 4JM2C 3FHAA 3VGGA 3MRKA 4IRJC 5IF0A 4JJHA 1NGQH 3PQYB 5JOPE 1U8QB 4GRLD 5BS0E 1AKJA 5I1DB 3SDCB 1PYWB 3EOBB 4X7TA 3QYCA 4X6CA 1U93A 2AQ1A 4X4ZA 4NZUH 4BSJA 1A6TA 4N8PA 4IRSB 4AM0B 4OCSH 2D7TL 1XR9A 2BDNL 5D96B 5CEZE 3ULVF 3QUMB 4FN0A 4G7VL 3IJYA 4J4PD 1T1YB 3I85A 5JQHC 4IRSC 5EUOE 1QVOA 3WNPA 3QIWC 5JHDB 1CFTA 4UOJA 4LBEA 4EIZC 43C9A 3V6BR 4MAYB 1CGUA 4HF5H 4NGHH 1NANH 5FYJD 1DLHA 4GKNA 1LEGB 3ES6A 3L5WA 3SDDA 3QXWA 1PAMA 5GJSL 5I8OL 4GRLA 2ARJB 4DN3H 3BQUD 1WVZA 4KU1A 4LLWA 4K7PX 4ODVH 1RPQA 2OJZH 5DMIL 5ESVA 1P9MA 1UB6B 3QULA 5ALCL 1ZT4B 2EH8L 3ARTA 4OI9A 2JJTA 2HAZA 1VFAA 3L3IA 5D71H 2XPGB 1UCBL 1KJMA 3DV4B 4YZFE 3B8YA 3K81A 4D0BB 4WTXA 5FHBL 3S96B 2B0SL 3IFNH 4E5XA 1NAML 1OQXA 3S5LA 1EJ6A 1P4LA 4N8VA 1A6UH 4DKFH 4HLJA 2HRLA 1NAMA 1I8LA 4OD3L 3VCLB 3VGDA 2D03L 1LEKA 2A77H 3HKFA 1JNLL 2GW5A 1XGQB 3QRFM 1KN2H 4QWWC 4P2QD 3WLBA 1J87A 5C0DA 1IBGL 4RBPK 3QBTB 4TUOA 3ZTNH 1JZ5A 4OB5H 3SKMA 4TUJA 4NKIH 2WZPD 4WGWB 3C5ZC 3TCLB 3HR5B 4JY6B 5C0NC 4FNLL 2YR3A 2G75B 3FT3B 4L4TD 1DR9A 1YEGH 4ZSOB 3QUXC 3V7MA 3DMMC 1S7UB 2I07B 5DUPH 4Z0BL 2VR4A 4FFYH 1D9KB 1XZ0A 1ZLSL 1RZIB 3WFHB 5CBEB 2NY4D 2P5EE 4LGPB 4QGTA 3U48A 5GGVL 1QACA 1HN1A 2B2XH 1AH1A 1FZOA 4KUCF 5D2NC 5FFLA 3LSOB 3OF6D 2H32B 2YS4A 1KEGL 2C1PB 1BOYA 3HCVB 5C0AD 3VXUE 2EIDA 4HUUA 3RWCB 4BM7A 3DVIA 4WHTB 2ORBL 4U1LB 5CUSL 2GSGA 3R06A 1AGFB 1U3HD 5JR1H 1KB9J 1BVLA 5B8CA 1OAQH 1MWAA 1NAMH 2IGFL 2GITA 5F3BB 5LGJB 2FJHA 5C0CA 4WHYH 2IQAA 1YNKL 2MMXA 1OP9A 4RISH 2FD6L 3IXAB 4OFKA 1KEML 4NO2A 3RX7A 3TYFA 5K9KA 5K9OA 2VC2H 1AGBB 1UA6L 1A4JB 5I75B 1MCKA 2J6EA 1CG9A 5C2BL 5F6IC 3WEXB 3WIFA 4QHKI 3PHOB 4KHXH 3TVMD 1UGNA 3GBMH 1X9QA 4RAVB 4ZAKA 3LS5H 1FIEA 3ARRA 1RIHL 3BPLB 1V3KA 5HGAB 2MOVA 3HR6A 1JZ2A 4RAHA 3O4LA 4OCSL 3X13B 2OTPA 4M6ML 4EOWL 4YQXL 2Y7QB 4HWEL 1MFBL 1VFAB 3K8LA 4UNTA 4XPFL 4E42A 1Y0LA 3NN8A 2CXKA 4Z7UF 4H26A 4F33B 2DJ4A 2X1WL 2AK1L 3BRFA 2R2BB 5CJQH 4IMLB 3O6KH 1KPRA 1KJ2B 4MD0B 1Z0MA 4PYGA 5SV4A 4X6EB 3OAUH 1IGFH 1T66C 2CO7B 4KGJA 1TENA 4KKBC 2CDEA 3GKWL 1P2CA 3O11B 4QNPF 3VXPA 5GRVL 1U8OB 3AM8C 4BH8B 2JJVA 4AMKH 2HG5A 2Q7YB 2FYYB 2CDFA 3QCUH 2EICA 2F54A 3U9PL 1NEZG 1UH2A 1WFOA 3IDJB 4MXWL 5GISL 3SKJH 3DUSA 3FT3A 4M5YL 3C6LB 3NIGE 5I9QC 4XGZB 5JPNB 2JB6A 2CUIA 3T3PF 2HMID 1DVFB 5F9DC 4IRJD 5ID0A 1NUGA 5EWIL 4IBLT 1LP9A 4JFFD 1B0WA 1U8NA 3EYVA 1QR1A 1GVIA 1FVEA 1IAKB 4Q0XL 3TYGL 5GS0D 4H88H 4HK3J 5C08D 1CF8H 1GOHA 4GRMB 4OF3A 1IEBB 1JV5B 4G8GD 1KXTB 5IEKB 2DWDB 2HP4A 4NUJB 1FYTA 1WTLA 1YNLH 5F7NC 1RUML 3MXVL 5BVJA 2NLJA 3MV9D 2WBJB 1TZGL 2NX5A 1JZ6A 4LNRB 3RKPA 5EU7E 1ZXQA 1I3VA 1T0NA 2OMBA 1MCDA 2F19H 3IXAA 3ZTJG 4S1DC 3TBWB 4QNPE 1H0DB 1MCFA 4XBEL 3X3FH 1NFDE 2XKUA 3CCHA 1Q9WB 3LS4L 5DEFB 1Q38A 5DK0B 1NFDA 4GSDH 2EXWD 2EDWA 1RMFL 1A7RL 1QBBA 5TFSH 1I9RH 1FAIH 4R0LA 4HKJB 2HWZH 4KC3B 4JFDD 2AI0H 1H3WM 3QDMA 2BMKB 3IGAB 3DUHA 2JCCE 2NY2C 4Y4KA 3ZHDA 4CMMB 1NCDL 2YA2A 3KG5A 3RDTA 5GS1B 3FQNB 2FHCA 4Y4FB 5ANME 1LE9B 1XGPB 2FB4L 4GXVH 1AI1L 4NWUL 4JFOB 1VACB 5EO1A 4P57A 2AKRA 4NZDA 3EJZD 3TP4A 2AABL 32C2A 1FGNL 5ADOH 4F57L 4NNXB 3VFTB 5D7JC 4K23H 3HE7C 4XAWL 3VXNB 2GJZA 1NC4A 4NQSB 3HNVH 2QADB 4MVBD 3NIDF 1DN0B 2JCCA 1CGYA 5J1TC 3V0VA 4HUNB 3D0VB 1A1OA 1NAKH 2ICEB 4PY7A 4WDIA 4D9LH 1FLTX 2GAZB 3QFJB 3QDJE 4CNIA 3PGDB 4Q6IB 5C0FB 1KG0B 2FL5A 3VFUB 2V5SA 4HGMA 2VZVA 1Q9KB 2PXYA 5D2NE 5F3HA 5FO7B 4Y19A 4YDJA 2WIIA 3BI9X 3OB0H 4NKDA 2DBLL 5T1KB 2PO6D 3QEQB 4WUKH 3P0YL 2GY5A 4NP4H 1NBVH 1H8SA 2ZCLL 5DVNA 2VAAA 5ID0B 3RWEA 4Q9QL 2OK0L 4JY4B 1F58L 3CXDL 4X9FA 4ELMA 2GT9B 2ESVB 3BKMH 1NUFA 3SKUD 5ESAB 5K33A 3MA7A 3QUZC 4LCYB 5BRZB 1ZSDB 3T77A 1AI1H 4NWUH 5JIPA 3W2DL 1PBYA 3OAZH 1IL1B 3VXRE 5J89A 1RFDL 2H1PH 2AERT 4TSCH 1GHFL 4NM8H 4LLUA 1IZKA 4GG6F 3QIWD 2NY1D 5F6HJ 1H0DA 4BK4A 3NIGF 4MDJB 3FOMB 4MQSB 3BQUA 3FAWA 3GGWA 4QRSB 3UJTL 2XKSA 4C56B 1RUQH 1CFBA 3CFJA 1RK1B 5BZWB 4MNQE 3QAZC 2EYTA 4WW2A 5ICYB 1F6LL 3L7EA 2CH8A 1T89C 1IJ9A 3LQZA 5TPWL 1TPXB 4DQOH 4LU5H 3MRDA 2G5RA 3KYMA 3T2NL 1EBAA 3GSVA 3HLAA 3FO2A 4IOSD 4MNQD 3NCMA 5ENWA 3GSXB 4YDVA 4PTTB 2ATKA 2OYPA 1LE9A 3UMTA 4UMGA 3GJFB 3NA9L 5HY9A 2NQCA 1A7PH 2QKIA 1MI5E 1BBJA 4KVCL 3BDYL 4GQPH 4OF8A 4HV8A 5DD3H 5EU3B 3RIAK 2NY5C 4MXWH 1FZJA 1QR4A 1MCOH 1D5BB 2BNQD 1RHHB 3GSWB 3VGAB 5DC0A 1TJHH 1F6AA 1ORSA 1XGUA 2Z31B 4I5BA 4OZ4B 4XNXH 3NPZB 5KAQF 3L3JA 4RZCA 3C5SA 1KV3A 2P43B 3L3HB 1RZ7H 1MCRA 3O2WL 1VGEH 2IBGA 2VIRA 4FQQA 2HKHH 1HIMH 3HI6H 4JRYB 1G6RA 4WTZG 4YWGH 1QYGL 3H42H 1AR2A 3BRDA 5I1HH 4OCMC 1U6AL 2Y9RT 5M94B 2PYFB 3ROLA 2ZG2A 1C16A 3O2DH 1GGYA 1JHTA 4Y5YC 2FH6A 4U1HA 4H1LG 4ACPA 2IAMB 2CRZA 1NBQA 3HE6A 4JFYA 3QEGH 4X8XA 1A64A 2AV1A 5GGVY 5DHVB 1F97A 1I9IH 4U2ZA 5E5RB 3SDAC 3T2OA 3MRCA 2IH1A 3TN0B 5IWLC 2IFFL 3T77B 4MNQB 4BZ1L 1CGWA 4M1GL 1H5BA 2IPUG 2ED8A 1K3ZA 3MJ8B 3U30C 2Q20A 4X6DF 5EZIL 5CJ5A 1URLA 4K71C 4YIQA 4U0QB 4DGVH 1ORQA 3U0TB 3QA3A 1KIQA 4F7EA 2E9IA 4P2RB 4WU5A 5GGUA 4BQBA 5ILTH 3QCTH 4V2CB 2CGRH 2XV6B 3O2VH 3LPGA 4XI5D 1FP5A 3BRGC 4HX1A 4L29B 3SEPA 2CRYA 2AK4A 3ULVE 4HFWB 1J8HE 2CKBB 1BD2E 1Z3GH 3LY6A 3NTCH 1W8OA 5I17B 3IETB 1WUNT 4R9HA 1SYSA 3FB8A 3RVVD 3FQUB 1QA9B 4LCUA 4F7PB 4EDWH 1AO7A 2A2QT 4JFDE 4M8VA 5MP6L 1PKOA 2Y6SC 2ATKB 4MAUH 4Y5VC 4TTGA 3ARBA 1A9EA 1ZS8A 4M4RA 1JF6A 1HWGB 3T0AA 1XIWC 2X4SB 3OKKB 3P2TA 5D5MB 5AYQA 4XX1E 2YWYA 1PY9A 3B3IB 5DD1H 4EBQL 4EDXA 2JF1A 1EHLL 4QHKJ 3MUY1 1ZGLM 4ODWB 3QNZB 4JREC 1YEDB 2BVOA 1C12A 5IB5B 3PUCA 5EU6E 4N0CD 4EN3B 5E8EA 4TVSa 2D0FA 3TGXA 3VD3A 2K7QA 1VA9A 1EERB 4MJ2A 3BWAB 3E2HC 4FABL 2NTSP 5I1IH 4Q9QH 1TJGL 1YQVH 4MVBC 3MRGA 3AS0A 4NZTH 4J3WA 4NO3A 4LKXA 3KXFB 1MSPA 1ZHKA 4Q7DA 2D03H 4R90H 5C09D 3LEXB 5T3XH 2ICWB 2XN9A 3DXAD 4LPTA 1T5XB 1FC1A 2GI7A 1WCBB 1I1AB 3SE3C 2PW2A 5E5UB 4YHPA 3AREB 1CD8A 3VWKA 3PDDA 5F6HI 2UY7A 4LFHG 5E99H 1WFTA 2XA8H 4ZTPL 4OKVA 4YHOL 3C60D 3O8XD 1CFTB 1J18A 2F54E 5C3TA 5J9PB 4PLNC 1J1XH 2B1HL 3P9LA 3CVHH 4BUGA 2BOBA 1R3HB 4X4MA 4XRCA 1IGYB 4Z0XB 1MF2L 2MCPH 2DN7A 3QP3A 2ITDA 5BW7C 1WLHA 1ZA6B 2H2PD 1TTUA 1C1EL 4NO0D 1KXQE 4JFDA 5IHZA 1XCQA 2UY6A 4LPWA 2DLFL 5FKPA 4CJ0A 3WNOA 1XGRB 2ERJB 1JWMA 5DO2C 1AKJB 2WQ8A 1EEZB 4X7TB 1XIWA 1X7QB 4WI7A 5DF0A 1ZHLB 1OWRM 3VI3E 5JW3L 4OT1H 3QFDB 1RIHH 4PP2A 3RTQC 4F9PC 5J11C 1NKOA 5L6YH 1I9IL 3WIIH 2UVFA 3SY0B 2AV7A 4ZUTB 1E0OB 1NMBH 3MV9A 2NY0D 1IGIH 5IVXE 3KPOB 5BV7B 3NMEA 1DQQB 5GS2H 1A7RH 3QXAB 4OLZL 1S9YA 4UI2A 4JFHE 2BXZA 2IPTH 1NGPH 4DFHA 3PWLA 2YRLA 5HHVL 3B3IA 1Q9LA 1YNKH 3BO8A 4WVRA 5DQJB 1JTOA 1FQ9C 3GHBH 4NJAL 1SBSH 5D1QA 3ULVD 2NY6C 3PV6A 5D7SH 3B9EA 3RIFK 1FJ1A 3QDME 5IQ9A 3QH3B 1CF8L 5EBLB 4ONGH 2E7HA 4X5WA 5E8OB 1XZ0B 1NPUA 3PJSB 3FRPG 1WAAE 1EGJA 4LEXL 4U1KA 1FCCA 2E9BA 3LRHA 2R69H 2F54D 3KPLB 3QIUC 4X6CF 4K3DL 4FABH 4QOKD 4I9WE 2I9LB 3VGAC 3W82A 4O9HL 1ZHKB 4I8DA 3NH7H 4WHTA 5IBTH 3IDYB 4YGVB 4H88L 5IVXF 4EJ1C 1MJ7L 1YYMH 3ZKXB 5DSCB 1MWAB 4JFZH 1M6OA 4QRRB 1UM5L 5IW6B 3WXVL 3S5LG 1JBJA 4PUBH 3ZE0E 3MMEA 5IMKB 4OKVB 2VMFA 4URTB 3MLXL 5L6YL 4FZ8H 5TQ2L 1LQSR 2CDGA 1BQUA 1PKQB 3N1QC 4IOFC 1HYSD 2FEDD 5ALCH 2J8UE 4NQEB 4LPYA 5HVFB 1MCJA 3V4UL 4PJFB 4D94A 2ZPKL 3ZYIA 3KPRE 1KT2B 5HI4D 4DGIL 5IMLA 3ZLQC 4NFCA 1G9MC 4EI5A 5K59F 4JRXA 2Y7QA 1ADQA 1IAIM 5K9QG 3QPQC 3O4OC 2CMRH 1BOGA 3M8OH 2QSTA 3RP1A 2YPVL 2I25N 4K3HA 4LVNC 3V5DB 5DYOB 5CJXA 4ZTPH 1JPST 5IW1B 1GJIA 4LGSB 1QYGH 3ARGC 4IOIA 5FB8B 2QQNL 1HQ4A 1ZLWH 1FZMA 1EXUA 5EC2A 5D2LA 1U3HA 1PW3A 2VO5A 2Y6SD 1HQRB 4KI5D 1S7SA 2N1KA 4LVEA 4L8BA 3O11A 2MJWA 5DHYB 4NO5A 5IFJA 5L2KA 5C0BB 4OV6F 5DT1H 5GGQH 3KHOA 1BVKB 4QHUA 2FBJL 3DUSB 2GFBA 1CBVH 5GRJL 5TQ0L 2XTJD 4FZ8L 5I18L 1QLEL 4V2BA 1HH9A 3P4MB 2DLEA 1WZ1L 3BH9B 4RISL 4PJBB 5IJKA 5FUZL 4JHZA 4Z7UB 4N1HB 3NIDE 1LP9B 4S1RH 4OUOA 1HHJA 1BQHB 3FT4B 1KJ2A 4HMEA 3QHZL 3UYPA 4G6ML 1HXYB 4LPUA 3M17B 2JELH 1T7ZA 2FLRT 2WUCL 4UU9B 1FIGL 4G6JL 1RUQL 4QOKA 2E7CA 3PWVB 3DMMB 4JJ5A 4PJ9A 2J88L 4U2YA 3W39A 4KDTC 2HLAB 2B5IB 2LVEA 4HLZH 2FJFB 4PRIA 4JPVH 1AR1C 1WJ3A 1HCVA 4NCC2 5DUMH 5KN5B 2DTSA 4X6FB 3R0NA 1JPTH 2YPLB 1LK3H 4JY5H 4OSUH 5E9DB 5HI5C 4B53A 3EYSL 1S9WA 1F3RB 5TH2A 1IGJB 1DVFA 4KAQL 1BAFH 4BFIB 2OL3A 4M62L 3MNZA 4NRYA 4QTIL 4DEPC 3SDCA 4J3XA 3HB3D 3FT2A 5FYLE 2J8UF 5IB1A 1ONQB 3GJEA 3QSKB 5JUEL 4K3JL 5I15H 2Z91A 4UT6L 3TO4B 1VFOA 2VQUA 4IRSA 2H2PC 1G6VK 3LZFL 4MHHG 5IESL 3I9GH 4P9MH 2YKLH 4HUKB 3ZYJA 4OF5A 1MY5A 4LVHB 1T1YA 5F7FA 4AEIL 4ZNEE 2ICCA 1Q72H 5HYJE 5EA0L 4PRHA 1Z0NA 3QCUL 1JIBA 2DQGL 4WO4D 1ROWA 2H3NB 1DL7L 1AKJD 3DX8B 1CTOA 2P24B 4YGAB 4Y2DC 2D7NA 1XF4B 4U6XB 3AGVA 4J3VA 2E7MA 5I71B 5DD6B 3LN9A 3P40A 3K46A 1NCCL 3T3MF 2FHBA 3AC0A 4GT7A 3C6LD 4K94L 3LKRB 5DMJB 1J1XL 2B1HH 5FYLD 3OB8A 3ZKXC 4LEOB 3MV01 1ERNA 4PB0H 1GRWA 4U1JB 1IKFH 2NY7L 3H42L 3RVUC 5D93B 3KPRD 1HXMB 3ZMRA 1N7MH 3EFDH 3OGCB 4R3SA 5IT2L 3SE4C 5CHNA 3K80A 5FA4A 5K9QI 5JHLL 4Z7UA 1DQLH 1R5IB 1NFDF 4JO3L 5CSZB 5ETUA 5EUOA 4HH8A 4IIQB 4LHUG 3TWCL 1IC5L 1LMKA 3GB7A 4MA1C 4WIQA 4S11A 1S5IH 4MGXA 4WU7A 4KHTL 4PRDA 1U9KA 5IESH 1CN4A 4P59L 5LVEA 3PWVA 3JWNC 4X4XB 3H0TA 2EH7H 1R3IH 1IMHC 4XNUH 5JUEH 4KV5F 1MPAL 2ZSWB 5GGTA 3MV11 1TPXC 2NZ9D 5B38A 1M7DB 2GJ6A 3MRFA 2LTQC 2J8UB 4NQEE 1N5AB 2UUDK 2I9TB 4Y19B 5GGRA 3UBXI 3GNML 1H8OA 3UX9B 2CUMA 1QLRB 3G6AA 3S4SG 4E41D 3RWHB 5DMYA 5B39B 2AJUH 5CZKA 3VFSB 3LV3B 4WO4A 3CVIH 5TDOB 3RIAF 3MRBB 5I1KL 3EO9L 3FN3A 3MJ7B 3P4LA 2IBBA 1YY8B 4Y5VB 1QFHA 5HHQA 5LKNA 3ULSB 5IFHL 1NCUA 3TBVB 2CKBH 1B6UA 1MIMH 3MROA 3NGBC 1TVBB 4R7NA 3X14B 2ZJSH 4JRYE 2DMKA 2NY0C 1Z9MA 4HS3A 5E8DL 4DGYL 4WFED 1HCFX 4X7CC 4WUUA 4MJID 4UV7H 3HG1A 1SM3L 5E08H 3GUTA 4PS4L 1CK0H 1NBVL 1ACZA 3PWNA 1XF5A 1BAFL 1KN4H 5FF6A 2FCBA 1D5MA 3QG7H 3EZ8A 4Y5YA 5D7IF 1QOKA 1MJ8L 2A83A 5IEHB 5KVDH 1P1ZA 2Z9TA 3AAZA 3N9GH 2HJKB 3SCMD 4HDIB 2VDNH 3DX9B 3D85B 4FHBD 3B5TA 3HMWL 3T4AA 4L3CA 5FDYA 4FQQB 1D9KC 2DQJL 5CJ8A 5AD0A 2PCPB 3AXLA 3L5XL 5DURB 5JO5A 4ZOAA 4HT1L 3TO2B 1IEHA 3ROLB 1RFDH 3WFBL 5EUKB 3DVNA 2E7LA 5IM7A 5E7BA 3PP4L 1EA9C 4YAQA 3GM8A 1JRHL 2NNAA 4MWFA 4MS8D 2BJMH 2XG4A 3HE6D 3HHRB 5D7IB 2Y06H 3BVNA 1CE1H 4Y19E 3U7WH 1WCQA 4YHML 2OSLA 3U1SH 1BFVL 4DZ8B 5CKGA 2W91A 5C0AE 5LXGH 1DDHA 3WHXA 5GRYA 3V79C 3RVXC 5DK3A 4WI4A 2CDFB 4PJEE 2DBLH 3BIKA 4JO2L 3F65A 3S35H 2MWCA 3BAEL 5KSUB 2A6KA 5GJSH 4RCAA 5I8OH 5DJDB 3QA3B 1CIUA 1FBIH 3KYKL 5BMFL 4P2RA 4WU5B 3MRIA 3VGEA 1NBYB 5B38B 4JO1L 4KMLB 3IDXH 3AM8A 4HUVA 4AEHH 1W72A 3LOWA 5F88B 2Y4SA 1JZ4A 5GGRB 1RJZA 4R96B 4NUGL 1RZJC 1FAIL 3WN5C 2EDYA 3LN5A 4PD4K 5T3XL 5B3NA 2VDLL 2FEDC 3BXNA 3P77A 2W9EL 5DDHB 3TWCH 3X12B 3VFSA 3GSQA 3NCFB 2EDRA 1KSRA 1I1YA 3I2CH 1AXTL 4Z7VE 1WTGT 4LIQL 4PLJD 5GRVK 12E8H 4N0FA 3MUHL 2L7JA 4UINL 4WWID 3NAAL 4HMDA 3BH8B 4MNQA 5HYSG 4OZFB 4G6AC 2AS5M 3CJJA 1WAAF 5EO9B 4R6UA 4LPXA 3Q6FA 3TH2T 4YHKL 4OCYH 5CZVH 3U7AA 1UM4H 4YIQB 3WDIA 5T1DL 3R1GH 5FV2A 1QRNE 5BS0D 5IMOB 4E41E 2DQDL 3PQYA 5FO8B 3LIZH 3S37L 3W9DB 2C3VA 4GOSA 3MRRB 1QFPA 2N7AA 4TULH 1C08B 1TMCB 2DLHA 2APFA 2JJUA 5EBWA 3L3IB 3DX9A 3DV4A 2ICWJ 3QI9C 4XNZB 5F9OH 4HBCL 1KCVL 3PHQA 2VDNL 1C5BL 5MI0C 4N8VB 1PZ5B 2XZZA 3P9WB 1FVCB 4PJ5A 5ICZB 1NGZB 4GKZA 4ZS7H 4OQ1A 5F89A 2BFVH 4HS8H 4OQTL 5I8CA 2IWGA 3IDNA 2NNAB 3IU4L 4PJBF 5FGRA 3OXSA 3AMKA 4JLRB 4F7MB 4OGYH 3ARBC 4OV5A 1G84A 4MZ2A 4WW2F 1MPAH 4U0RB 3UEZA 3RUGF 5D1ZB 4DZ8A 4FXGA 5HBBA 3SPVB 2ARJA 3U46A 4NSKB 3L9RA 1ZOXA 4OD1L 5CMAA 1JGVH 3OKEA 4CVZA 2WP3O 1I7RA 4CMHB 1MCSA 3K2UH 4RWYH 5CP3A 4RGNC 2F9BT 2P45B 3Q5TA 2Q86B 1A0QH 1RUPH 3RVTC 1BZ9B 2AXFA 4D0BA 4NCC1 3NACH 4OM0H 4D8PA 3L95B 5I1CH 2XQBH 1KB5H 1FFPA 4PJCA 4OGAC 3IDXL 1EO7A 3VFGL 3BESR 1BM3H 3G5YB 5TGBA 3B6SA 1HIML 4R97C 3H7BB 3BWUC 4FQJH 4XBPB 4P3CL 3V9FA 2P44B 4N0UB 3HR5A 4JY6A 2AJXL 3TYFB 5K9KB 2QQQA 5DA0B 3MACH 4FXLA 3TZVC 2KQMA 3MCLL 5F7UA 4UNUA 5ITFB 1R3JA 5C1MB 4ONFH 1OGAE 2VYRE 5T5FL 4POYA 3GHEH 4DVRL 3QJHB 3CLFH 4LLVA 1RZJL 1KLGA 3HTLX 4PRPA 2YOCA 3B2VL 4FQIL 5D1QB 3V4PL 1QUNA 4KDVA 3VDBA 1E6OH 4J3TA 1UYWH 1XGRA 4TSBL 2KQNA 3P0VL 2EDEA 4I0PD 1FO0L 3NFPB 4HT1H 5DZLA 1DANT 5E8OA 5GSRB 1JZ7A 3QO1B 2W38A 5DJYB 3TJHC 1Z5LA 4WFHE 1T6WA 2VLJE 1CT8A 5KSAA 1YY9C 4JQXA 2P5WB 4OBRA 5I1EH 5KSBB 1BVLB 1S7WB 1FGNH 3KPOA 3RTQA 2ZNXA 4Y5XC 1U95B 4ZXBA 5I30L 1FL5B 1JYVA 1FDLH 4L8SC 5FDWB 1QFWM 1HSBA 5IB2A 1XR8B 3O6ML 3IRZA 4KKAD 3W5NA 5F1IA 5C0AB 2HFEB 1GGIL 1CG9B 3ULUC 4V1DE 2BNQE 3W0WE 3L1OH 4OV5B 3MLUL 3VRJA 1KB9K 2KKQA 1YUHB 3DJ9A 1JTTA 5EZLA 5HGDA 2IG2L 2RJMA 3PV6B 1KGCE 4OGYL 2ADGB 3SGJA 3KLSA 4N8VG 1AD9B 4EIGB 2HTLC 4U3HA 5IF0B 4D0DB 5M95B 5ID1A 4JG0H 5EO0A 3X17A 2R2EB 1SJVA 3LVEA 3P4OA 5T3ZE 5TJWK 4DOHE 1TZIB 3IAPA 4S1RL 4YXHH 2ZOLA 4N1CA 4KTYA 4PJIB 2JIXD 2VLMD 1AGEA 4G80A 1KT2A 5EFIB 3UTQB 5CGYC 2AJ3A 3NAAH 4P5MA 2OTUB 4UQ3A 3GMRA 1E4WL 1JV5A 5I75C 3HPJA 2X4NA 3KPSA 4F37K 1Y18A 1CU4H 2NY2D 4Z7VB 4PJ5D 3UTSA 2Z8RA 4XCFH 1UYWL 4FQ1H 2IH1B 3IDGA 2E8YA 1R0AH 2F58L 2ZCHL 4K94C 1OOAA 1SMAA 5IMKA 3MBEC 4BUHA 1FE8H 5JIIA 4DUWA 1RZ8B 4TUKL 3L3OB 3ES6B 3L5WB 1OWWA 1YPZB 3MV9E 1CTNA 4Y16A 3ARZA 5I1HL 4PLJC 3CGTA 1A7QH 5I16A 4LL9A 4QXWA 1FH5H 2MHAB 3LKNA 1UWGH 4NYLB 1WIUA 5A2JH 1N3NB 2R0LH 1LNUB 4GRMA 4MB5A 2A6DA 2O5XL 4P59H 4GRWH 1OF2B 3BH9A 4Y1AA 4OZGE 5BVJB 1PKQE 2EEBA 4LSUL 5HD8C 1KTDA 1KCRL 3SOBL 4HFUL 1LO0H 4XPTL 3PP3K 2DLFH 4HS6A 3EO1B 2YUVA 4R90L 4APQB 3TNMA 3DECA 5D5MA 4XP5L 5C09B 5DGQA 3V95A 1XR8A 1T2QL 1DLHB 5TF1L 4HSQA 4W4OC 4OLYH 3G6JB 4M6OH 2DQFB 4NO5B 2QSCH 5GS2D 5JORA 1FN4A 4GRLB 1I85A 4JVPA 5HI3C 4XCCH 1YEKH 1M1SA 2XA8L 5AYUL 3HZMB 2J8OA 4OTXH 3MRNA 5E9DD 5IJKC 2G2RA 3VFUA 4CN4A 2ARWA 2IALB 5JQ6L 1UB6A 5C7XL 5MHSD 5KN5A 4P46A 1ZT4A 5DD5L 5FA3B 1MRFL 1UFUA 3UXFA 1U8IB 3BWAA 3VI3F 4E9LA 4JRWA 2EDKA 4NQDB 5E4EC 4JM2F 1RQ5A 1T80A 3R8BB 3SE8L 5EC1B 4DQOL 1YEFH 2OL3B 4Z95H 4LVHC 5EH1A 3QG6B 5HDQH 5C8JB 3MRQA 1A8JH 5GJTL 4PRNB 3D3VB 2XXCB 4JFED 4XVSH 5BVPL 2V7HB 2D0HA 4WEBH 4OLUH 1AGEB 1A1NB 4PG9A 2Z91B 4QGYA 2A77L 5FYKL 1CLCA 1LO5B 5ACLA 3DARA 3SGDH 1J05B 3DHJA 4WHDA 3RAJL 2B39A 1EEYB 4BZ2L 3KPSB 1V3JA 1A14H 1BJ8A 3AREA 1UQSB 3LEVL 2HMIC 3W39B 1QRND 5JW4Q 1U3ZA 2VKWA 4UZGA 4N68A 3VFOB 2KUTA 1TJIH 1NGXA 5D71L 1A5FH 3W2DH 2P4AB 2ZCLH 1QHOA 4RSVA 4UOW0 3GSNL 2WWMD 3SCMA 4NHUB 4IJ3B 3OKLB 2DMCA 1AO7E 3BSZH 1JE6A 4M9PA 2PTVA 5HYJA 4WFGD 5IKCB 2GJ6E 3P11L 5C08E 4J6RL 4KK6D 3AU1A 3BEWB 5FYKU 2V17L 3RZWA 1NGYA 1AC0A 1P7QB 2YMXL 3WKNA 2AAVA 5FK9A 4Z7OE 3H7LA 1F11B 1Z6JT 3V6ZB 2MHAA 4JG1H 5H2BA 4NYLA 1CLOH 3RWCA 5GGRY 4XHJC 3GJFK 3ILQD 1MAJA 2F5AL 4P2RE 2P48B 3V0AC 3D0LB 5DMGD 4UTAL 4XXCA 4MD0A 4NKOA 2W60B 5H94B 2KDGA 4ZFGL 5FOBB 2C3WA 5KS9B 5F7EL 3VA6A 4N5ED 4OFVA 1H3VA 3U0PB 2FNBA 4QOKE 4CADA 2QQLH 3JVGA 1V3LA 4S1SH 4YDIH 5TE6H 3BPOC 1QBLH 3MR9A 3WFEH 5HGBB 3BKCL 3SBWA 3WEXA 3DBXA 3KDMB 4O5LL 2NY6D 2M26A 1FH5L 5DQJA 3CFJB 4Y4HD 4NQDD 3LKQB 3L3HA 3BP7B 1BEYL 5KBNC 1JMXA 4ZO9A 1FC2D 3SDXB 1T0PB 1KCUL 2AK1H 2Q1EA 4Y19D 5MERA 3RUGE 4IM8A 3LD8C 3X11B 2CD0A 3HZYB 4L8DB 2IALA 3IDIB 4P46B 2CIKB 1NC2B 5E1HB 3O3BB 2ZCKL 3WSQL 5D1ZD 4U1JA 1T04B 3LHPL 1G7LB 3QJFB 1MHEA 3MGOB 5EC1A 5F71A 1W0WA 5E8PA 2R2BA 3RY4A 5HY9B 5TDOA 1FVEB 2HLFC 2ADFL 1YMMB 1A1MB 1YEHH 3UBXG 5D9SB 1ZT7A 4HH9A 5ACZB 4LCWA 3VD9A 4D9QE 4NQCE 1N0XL 5HHXL 3P11H 1VGEL 3QUXB 5IFAH 1BFTA 4Z9KB 3BUYB 2WK2A 4PRDB 1UWXK 4R2GC 1RIVL 3SDAA 1OY3B 3ARYA 1B88A 4UUJA 1T0NB 5KTEL 4YHYC 4MJIE 3JVGC 2VISB 2X4TB 1EVTC 3JV5A 2A0LC 1CVSC 4OCXL 1UZ8A 2G9HA 4PJAA 5D8JL 5J3HD 2AQ2A 2A73A 1PKQA 4YPGA 4NT6A 3QDMD 3IRPX 5BQ7A 3KS0J 2HKFL 3OX8A 1NMAH 1T4KB 4JB9H 5I1AB 2NW2B 4AJ0A 2P8MA 2CKBA 5C0BD 1WWCA 2W65A 3MLUH 4ZD3H 4CUCA 2NXYC 3HRPA 4H0GA 3EYVB 4TSAL 1QR1B 4M7JH 2OP4H 3B5HA 1XR9B 4KRPB 3QPQD 2D4FA 2O26U 1JWUB 3EDDA 5I76B 3MBEB 1MHCB 5CCKH 4NQCD 2EE3A 2V2XA 32C2B 1MRCH 4KV5E 5I15L 1TTFA 2A6IA 5BZDB 3TH4T 5EBGA 1FO0A 4B7LA 1A6AB 4TN9A 1JPGB 3NIFF 3EJZC 1DFBH 1ZAGA 4LIQH 4CN1A 4FFVD 5HHVH 1NANI 3TBWA 2FJGB 3GBNH 3VXMA 1AE6H 3QXDA 2VWEC 4JR9H 3BD4A 4L8BB 3O3EA 2EEAA 2W9LA 1DVFD 4IRJA 1QKZL 1PQZB 4ALAH 2J88H 4O4YH 1GL4B 3PGDA 3QULB 3RWDA 1L0QA 1YEHL 1YMHA 2XTJC 1AY1H 4G8EA 1KTRL 5I17A 4OFIA 1G7QA 4U1NA 4JE4B 4JQXC 5EG6C 1B2WH 3AXLB 1V7ML 1HHHA 5GHWL 4P2OC 1F13A 5CD5C 5D1XA 3MCLH 4Q9BA 1OAZH 4FTVB 5IVZB 3OAYH 2PW2B 1D5XB 1MI5D 2H2SD 4WTZA 1MI5B 2DYPA 5D7IA 1NC4B 2J4WL 2Z92A 1I3RB 1YMMD 4O5LH 5CJQL 2G5BA 3TCLA 2FHFA 2BVOB 3RTQD 2H6PA 1U92A 3KGRA 4C4KT 4YH6A 1VCAA 3IDMB 3F8UB 1J8HD 1I8KB 1T7VA 2HJLA 1K8IA 1J0IA 3WO3B 1IM9A 4ZODA 2DTMH 1OAQL 2LV4A 3MV8E 2WUBL 5HGHA 3FOMA 5CEZD 1NBYA 4QEGA 2VDRH 4TNWK 1CQKA 3W9DA 2VLKE 2GQHA 2MQCA 4F57H 1S9WB 5BQ7B 5EBMA 3KXFA 3L7EB 3AB0C 3V8OA 3BXNB 3P77B 1KOAA 1NCWL 3R06B 3NGBB 3FT2B 4W68A 1ONQA 1BM3L 1I1AA 3MODL 1N64H 1I1YB 1K4CA 1FPTL 2A9NH 4JKPH 1A6ZB 3CDFA 5E0QA 5HXMA 3QIBB 1FSKC 1T03L 4NBXB 2APXA 1G7IB 4FXKA 2XZAH 4LARH 2FBOJ 4LK4A 3IB4A 1V3MA 2BCKB 2EDFA 3G9AB 4S10A 4C83B 3WD5H 1FLRH 3Q6GL 3GM0A 2CKBL 5MENA 4Y8AA 2Z35B 4OFPA 1GAFH 4YNYB 3MLZH 4NWTH 1TTGA 2R69L 5LGKA 1RURH 2YD2A 5JNYB 1U91A 2VOTA 2ZG3A 1BD2D 4X4ME 2H8PA 5I1KH 15C8L 4KROD 5IMOA 3QUML 1TVHA 3UTTA 3WS6A 1X5JA 4NSKA 4PLKD 3IJHA 2BNUA 2EYRB 2HTKC 3L6FB 3F12A 5EOCJ 4QRTA 3L3GB 4K71B 1S7XB 4H20H 1LO0L 1KN4L 4XPTH 5HYEA 1SJHB 2HYMA 3MA9H 4JVUA 1JN6B 1JFQH 2VXVL 3LKRA 2C4XA 3GSOB 3HC3L 3RWIA 4MA7H 3HC0B 4ODSL 5ENWB 4MS8C 4WNQA 5I30H 4M6OL 1HXMA 3MXWL 3QXAA 4EI6A 1CLYL 2EDBA 3OG6B 4G9DA 3EDJA 2XTJE 3L5IA 4FTVA 3BDBA 1PLGL 3BISA 5D5ME 5DZNA 4HWZA 1DCLA 5JPMA 2VDRL 4DW2H 4IMKC 2XKNB 1KBGL 3GZKA 4RMWA 3BO8B 4PJHB 4LDLB 4XBPA 2NW3A 5ABDE 4X5LA 1BFVH 1X5FA 2HA1A 3IDMA 1T22B 3S36L 5E2VH 3QXVA 2H9GA 4B0MM 1JRHH 2C3HA 3QJHA 4U6HA 3UZQA 2I9TA 1MLCB 1EUUA 3KPLA 1O5DT 2AXJA 1TIUA 3MLYH 3SDDD 4OGXH 4HBQA 4RFOH 3IVKA 3TA3C 1KLUA 1F4HA 5DJAB 3F7VB 4ISVB 3D69A 5E2UH 1U8KB 1RU9L 4JFYB 1KPVA 1S9VA 1QA9A 2UZYB 4MCZA 8FABA 5GZOC 1CXFA 3O6KL 3QISA 2E9WA 1K4CB 4S0TD 4J4PA 2FATH 4K8RL 2NXZC 2VABB 1PG7H 4EI5C 4HAGA 1XF2B 3OKKA 1I7UB 3PDOA 1SJEA 1CU4L 2NXYD 1M71A 5DC4B 2CDGB 4K9EH 4O58H 1XIWD 3P73A 1UJ3A 4F7EB 3QEHA 1U6AH 3W81A 3MRJB 5GGUB 4L1DA 4PJCF 1OAKH 1ZVSB 1BLNB 4NQEA 1RZKH 4WI3A 2ITCA 1NSNH 5F7KC 4PR5A 1ADQH 3STLB 4HKXB 1MCLA 5GS0L 4K3GA 3RWFB 5I66A 1MNUL 4QRTB 4N0UE 5IB3A 2CUHA 3FKUS 4DZBB 5A2FA 2AKRB 4BH7B 3P4OB 2YWZA 5DRZA 4OI7A 3PL6D 4NPYB 2ZUVA 3ZKQD 1A7OL 1D5ZA 1MCWW 4JPVL 2ZUTA 3RI5F 2D4DA 1QSZA 3C6SB 5F9OL 2CJUH 4X4YB 4HPOL 3DVNB 4G80B 1ZWIA 5EFIA 1MLBB 4B50A 4DN4L 3HAEB 1JK8A 4PD4J 4TNVK 4APQC 2BVPA 1F90H 1GGBL 1W72L 4K2UL 4OUUB 3SJVA 1A1OB 4JJ5B 3DVGB 4MQXD 4R4BB 3SJVE 1L9NA 1TJGH 2V17H 3BW9A 1A14L 1I3GH 2G75A 4PJDB 2E27H 2UYLA 2YK1L 4M02A 4UBDC 1Z3GL 5HYIA 1J86A 4Z7NF 3P9LB 2OJEA 4RGND 5EZLB 4QRPE 1HOCB 3KLAA 2FSEB 3ARFD 4YLQT 4PP1D 4TVPE 2DIAA 1GCFA 1NEUA 1NGPL 5IJVA 4HUWB 2F53A 1L6XA 1MAMH 3EIFA 5I1GL 3MYJB 1W8NA 2VLKA 4LCCC 5F88A 1WBYA 5DQ9A 3HCVA 4X98B 2E6PA 5ISZB 4HUUB 3NCCB 4MJIB 4KJQC 5EORH 1CFSB 1BF2A 1BQHA 3FT4A 1N2RA 2C7UB 3HE7B 2R1WB 1GC1C 2YD3A 3NABH 2OTUA 4NRZB 3PV7A 4XMPH 3C6LC 3MLWL 2X9YA 4Q58C 1WC7B 4YHIB 3TZVD 2ILLA 3R8QA 1JI1A 3LQAL 4TNVF 4EUPG 3D2UD 4PRIB 4UT9H 1U2CA 1P4BL 2APVA 4UDTA 3D48R 4F9LA 4LVOB 3CU1A 1YN7A 1YJDH 3RA7H 2VLRA 2DJSA 5JW5B 3PHOA 4JHAH 1CDCA 3TVMC 3EJYD 4AEIH 3QHFL 3IU3A 4K3EH 1UXWB 3G6DL 3VXTB 2DQHH 5FM8A 4UILL 2VWEE 4L8SB 3DI3B 1YYLH 3T0EE 4WW2B 5BW7A 5ICYA 1Q94A 1FJ1B 3OWEA 3ARGD 3SE4A 4LLQA 4RGOL 2GK2A 1OTSC 4F58H 5IB1B 4ZQKB 1JHKL 3KLHD 4WTWA 4TRPH 2AEIT 4K7FA 5E99L 3JXAA 1CR9H 3BYYA 4LCIL 5IB3B 4I4WB 3IFOA 1JPFB 3VFRA 3IFPA 4PRAA 3PHQB 1EVUA 4PJIE 1NGWB 1DBML 3A6CH 4OCWL 1WT5C 4XHQA 2D7TH 3U30B 3G9VA 3SQOL 2X10A 1I9RL 2V7HA 4TUKH 2X7LA 4WV1C 4M3JA 5BRZD 3VG0L 5F89B 1M7IA 4R8WH 1SVCP 4YGVA 2V6HA 1ORSB 4FQ2L 1M6OB 5K59E 3BEVB 2XXMB 4YXLL 2WQRA 1KC5H 2R2CA 1IC7H 4FG6D 5DRXA 4NQVA 5GHWH 3ORJA 3VFOA 2LFGA 2P5EA 2V2WB 4TTDC 4YHYB 4ZTOL 1MCEA 1IC1A 2H45A 4JFHD 3ULUL 2DMBA 3CNKA 2XZAL 1ACYH 4NC2B 5JPNA 4XH2B 2JB6B 1YPZE 1PEWA 1OLLA 5HPOA 1INEL 1X5YA 2UZIL 2Y5TA 1MFCL 1U8IA 5C6TH 4P2OA 4ODHL 3QEUB 5CILL 1DQDH 2Y23A 4KUZL 5KVFL 2RHEA 2YEZB 4YR6A 4Z7WF 4R3SB 5IMMA 2ADFH 2IC2A 5C8JA 5JA9A 4G43B 2I9LA 4Z7VF 4X6CB 5F7MC 5CSBA 1IC4L 4IIQA 4NKMA 1G9NL 3GB7B 2IG2H 1CDGA 3S3PA 3K3QA 1WGOA 1NCBH 3KPMB 3WUZA 3MBED