2FMJA

220-loop mutant of streptomyces griseus trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
222
structure length
222
Chain Sequence
b'VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Conversion of trypsin into a Na(+)-activated enzyme.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 59
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fmjA02
1BRCE 3O8CA 1OS8A 1Y3WA 1BBRH 3UUZA 2FOFA 3SJKA 1HAYB 1C9PA 1TABE 1KTTB 1SGFA 1BHXF 1UTQA 4GCHG 3LGUA 1DUAA 2JETB 3TPIZ 1IQJA 1O2TA 1C1WH 1UK3A 2JKHA 3T28A 2HOBA 3T26A 5IYTA 4IMZA 3VFEA 1HJAC 1DITH 2A4RA 3GY7A 4O97A 1GVLA 2G5NA 3ZV8A 2BMGB 3BG8A 1TRNA 3EYDA 2PSXA 1XMNB 1D3QB 1B5GH 1DWCH 1NU9A 1E36B 4K1TA 2XC5A 1GDNA 5DJ7A 3KQDA 2VIDA 1BUIA 3UWIA 3RXFA 1B0EA 1LVMA 3UR6A 3MMGA 1P9UA 3QX5H 2GVFA 2W3KA 1GI9B 1EAIA 1NU7B 1XUJA 2F9UA 2WPLS 2ZDKA 1K1OA 1SHHB 1J9CH 1UHBB 2V3HH 1NFYA 4O9VA 1VGCC 3MOCA 1L4DA 1P2JA 3E8LA 2F83A 1MTWA 2H9HA 3BTFE 3ZZ8A 1O5BB 1JOUB 2ZHQH 3GCTG 3LONA 1ZGIA 1NFXA 3PO1B 3M7QA 4INLA 4X2VA 2G8TA 3IITA 1CHOG 1S6HA 2I6SA 1QJ6B 3VPKA 3MI4A 1YM0A 4JMYA 4ABJA 1W2KH 4AYYB 2Z9GA 5I46H 2Q6DA 4FU9A 1V2LT 1J15A 1BIOA 1O2LA 2PKSC 1SGNE 2KAIA 3UOPA 1BHXB 1QIXB 2IN2A 3UQOA 2VINA 1PPEE 1N1LA 1YPKH 1EP5A 1TNGA 1V2VT 1YCPM 1C2MA 7GCHF 1EZSC 2VIPA 2VVVA 1QL9A 1HAPH 1CT0E 3BTWE 3LT3A 1JRTA 1PFXC 2TBSA 4FUGA 4I32A 1JWTA 3FFGA 3PMBB 5HYOA 1MTUA 2EI8A 4IMQA 3VGCB 2GCHF 2ZI2H 4NZQA 5H4IB 1WQSA 2XXLA 1C2JA 1A5GH 2BVSH 4UFGH 1HCGA 1P06A 3QGJA 3BIUH 4A5TS 3GY2A 4ABAA 1G37A 1O31A 3OYPA 4A1VA 3TU7H 1ETTH 2OLGA 4ASHA 2R9PA 4GUXA 4CR9A 1GMCF 1BTZA 1LCYA 3SUEA 1O2PA 2GCTB 1OYTH 1ARCA 2ZDNA 4H6TA 2STAE 1K1NA 1V2RT 4M7GA 3HATH 2FP7B 4AORA 1NROH 4B71A 3TJVA 2QV1A 1QJ1B 2UWOA 2BX4A 1W13U 4Y10E 1RJXB 1IQKA 4K5ZA 5A8ZA 3RXQA 1C5LH 5FAHA 4MTBA 2J38A 3U1IB 4E05H 1P9SA 3BTKE 1YPEH 5FPSA 4XDEA 3FP6E 2VIVA 3K2UA 3SNCA 1ELEE 1GDUA 2XBYA 1WV7H 1KDQA 3S69A 3VB3A 1X7AC 3A85A 3LPRA 3KQBA 4KTSA 1DSTA 1GBJA 1J16A 1JBUH 3AW0A 1KLJH 1ZHMA 5A8XA 2STBE 3PLKA 1A2CH 2Z9KA 5HM9A 1GGDB 4INKA 2XWAA 5EG4A 4MLFB 1JXPA 5JBTA 2C8YB 3BG4B 4X2WA 2UUJB 1CA0C 1K1JA 1FAXA 3G01A 4JYUH 2ESTE 1GJDB 1D6RA 3RLWH 3UREA 4X1PU 4LZ1H 2VJ1A 2TGTA 2EEKA 4NSVA 5C1XA 1BZXE 1L1JA 4ZROA 2BLOA 1QTFA 1XUKA 1SI5H 2BDGA 2FYQA 2QXIA 2G55A 3NXPA 1IQMA 2RCEA 5CHAC 1FY4A 4KP0A 1OP0A 2C3SA 1LDTT 3FANA 2DE8A 1H9LB 4BNRA 4UEHH 2Z6BD 3E91A 1AFQB 1P05A 2TIOA 3RU4D 3EGKH 1N6XA 1WUNH 4FVDA 3M5NA 5LPFA 3SW2B 4CBOA 1QRWA 1OOKB 1DDJA 1TX8A 3LKWA 1P03A 3RXVA 2NU2E 2QXJA 1AY6H 4HFPB 4KGAA 1TBQH 1HAHH 9ESTA 3RXBA 4ABGA 4B2CA 2CJIA 1BDAA 3GICB 2ALVA 1QQ4A 1UTKA 1SSXA 1T4VH 3I78A 3UY9A 3AW1A 1DFPA 5C5NA 1C2EA 3A87A 1TGNA 1P3CA 3PMAB 1O32A 4X0WU 2H6MA 2Z3DA 1KXDA 2FI5E 2VGCB 3DD2H 2VVUA 1FLEE 2A5IA 1GJ9B 1UTPA 1ETRH 1FAKH 4LOYH 2G5VA 2W7UA 2O9QA 4A92A 3RMMH 1NN6A 1TRMA 4GAWA 1Z1IA 3BTTE 1IQNA 1L4ZA 2BY9X 2HVXA 3RXKA 1SLXB 2QXGA 4ISOA 1O5FH 3GOVB 1H1BA 3K65B 2R2MB 3SJOA 4UFFH 1NT1A 1LHGH 1LPKB 3SZNA 1HYLA 5DP6A 4GHQA 2WPKS 3VB7A 1V2MT 1AMHA 3W95A 3RUOA 5ESBA 1U6QA 4Q7XA 1QL7A 4WWYA 3VB5A 1LHDH 1TNJA 3TGJE 2GCHG 3LDXH 4ZKSU 2NU3E 1NRSH 3RXIA 1SPJA 2ASUB 2PGQB 1O3EA 3DFLA 2VU8E 1BMNH 5T6FA 3RXCA 1HXFH 1C1MA 4HI3A 1UTJA 1UK2A 1TPAE 4MPXA 1YCPH 4JZDH 4ZKOU 5F8XA 3P95A 1QA7A 1O5AB 1SOZA 4ZMAH 3T27A 4NA7A 4NWKA 1HJAB 1UVSH 3PWCA 5EGMA 1F0SA 1YKTA 2ZIQH 3SI4H 1ACBE 3BV9B 1SGTA 1WOFA 5F8TA 2H9EH 1GMHF 2BDIA 4R0IA 4X6OA 4NSYA 1CQQA 1O2GH 4FUHA 3HK3B 2V6NA 1QA0A 4X6MA 3KQCA 1ESBA 1BMLA 1ESAA 3A7VA 3U98H 4I8LA 4CRFA 1KLIH 1PQAA 2PR3A 3SU3A 3A8AA 4NGAH 3IG6B 4ESTE 2A0QB 1SG8B 2B9LA 4B76A 1UK4A 3ZZ4A 3E90B 4D8NA 1EOJA 2FOHA 4BAKB 1HRTH 1PPCE 4ZAEA 1HAOH 5EODA 1BTWA 3Q3KA 3QTVH 3LGTA 2QAAA 1VGCB 1Y3VA 2TGPZ 1JRSA 4UFDH 2AGEX 1A0JA 3TH4H 4JCNA 2BY7X 2EC9H 2OC7A 3OTJE 3EDXB 2WYJA 1EXFA 1T31A 4DURA 4IN1A 1ZMNA 3NCLA 2FESH 3JZ1B 1GJ7B 3QGNB 2XWBI 2WUCA 1AVWA 1F5KU 1C2LA 2R2WU 1DPOA 1FY1A 1HJ9A 1O3BA 4WJG2 4YT7H 5FBEA 1AKSA 1S0RA 3P8FA 1YLCA 4GCHF 2BYAX 4TY7A 1PJPA 2D2DA 2PKSB 5HM2A 2OD3B 3LC3A 3MHWU 3U9AH 3SV8A 1BRUP 2OQUA 3TLOA 4ABBA 3ZVBA 2BD3A 2GKVE 3L33A 4Y8XA 4ZKRU 1MTNC 2ZGXH 1GI4A 2Y7ZA 3ZZ9A 1G36A 3F6UH 3GY8A 3GDUA 1S83A 5LPRA 1DANH 3U8OH 3SGQE 2ZC9H 5AVDA 3CS0A 1SGEE 1YPHE 1ANCA 5L6NH 4JYVH 4Q2KA 1P8VC 2ZNKH 1SHYA 2Z9IA 1SQAA 1D3PB 2R3UA 2A32A 2PSYA 3B23B 2J92A 3ATWA 1UMAH 2GX4A 3P8GA 3R0FA 4J1YA 1AWFH 1VJ9U 1PYTD 4IW4E 3MNXA 4X8SH 4BAMB 1Z8RA 3KHVA 3RXSA 3T5FH 1O2SA 2ZHWH 1TMBH 1NFWA 3HGNA 5F8ZA 2ZCLP 1B0FA 1VITG 2ZTXA 1SFIA 2ZF0H 1FY5A 2ZECA 1BBRE 4OGYA 3VB4A 1QBNA 3ELAH 2NWNA 2CXVA 2EI6A 1CHOF 2OUAA 1TNKA 4K60A 1P2MA 2O8MA 2AS9A 5K7RA 1QRXA 2BD5A 1TAWA 3EQ0H 3HGPA 1CO7E 1Y5BT 3SHCH 3SN8A 2VWNA 4XFQA 5FCRA 1RD3B 4YOJA 2BQ6B 1LTOA 1GJAB 3F9EA 3SV9A 5C3NA 2B7DH 3SNAA 1DX5M 1VJAU 2FZZA 4MPWA 1EAXA 1NRNH 3ZZDA 4X1QU 2Q6GA 1RIWC 4FXGH 3UNRA 1AVGH 1WSSH 1NS3A 1ZOMA 1LKBA 1UHBA 2J34A 1LPZB 4XBCA 8KME2 3MWIU 4XBDA 1MD8A 2ZFSA 1GJBB 1RTFB 2WUBA 4OGXA 4DGJA 2XW9A 2QN5T 1O2XA 1A0HB 4JZ1A 4ZHLU 3TITA 1P04A 2QF3A 3ZZ3A 1SLWB 1W7XH 1ELAA 2XRCA 1BQYA 4AG1A 1XVOA 5GWZA 2GZ8A 3ZZBA 1CA0B 6ESTA 1AI8H 2TGAA 1WYKA 1YPGH 3RU4T 1QFKH 3B9FH 1TGBA 2Z9JA 1GJ8B 1DOJA 1ELBA 1CGIE 2ODYB 4RKJB 3Q3YA 4NFEA 4DT7B 1BJVA 3RP2A 1HXEH 1FIZA 1NM6A 1GBAA 2THFB 1IQEA 5CHAB 3I77A 5FX5A 4Y8ZA 3GDVA 2C90B 2F9VA 5J4SA 1HUTH 1G2MA 1G3EA 3OX7U 2Y6TA 2GD4B 3PROA 3CS7A 4XSKU 5TCAA 3P17H 3RMNH 2ZHEH 1HPGA 1LKAA 3RXEA 3VEQB 1C4U2 2B5TB 2ZHDA 1TMUH 2J94A 1J8AA 5LGOA 2CMYA 2Y5GA 5CE1A 2Z3EA 1CVWH 3LJJA 1AB9C 2GV7A 3LH3A 4PROA 3V12A 2ZGHA 3BTQE 2HNTC 4F49A 4MNVA 1GBHA 5DG6A 2Y7XA 4B1TA 1BOQA 1K9OE 3KQEA 1Q2WA 1C1SA 4RN6A 1TPOA 2QYIA 1EZXC 1TA2A 4D9QA 1FNIA 2O8UA 1MCTA 2ZDMA 3A7WA 1SGDE 3MTYA 5JB8S 1A61H 1SR5C 3ENSB 1T8LA 5C1UA 3ZVGA 2BDYA 2ODQA 4YOGA 2UWLA 1O2ZA 2G51A 1EOLA 4Z0KA 4SGAE 1AN1E 4ZHMU 3QN7A 4LZ4B 1ELFA 1Q31A 3F68H 2ZO3H 1BBRK 3PMHB 1EP6A 3RXPA 1XM1A 4KTCA 4XBBA 2A5AA 1ABIH 3KCGH 1QBVH 3SU0A 2BDBA 2OBQA 2IOTA 5JB9S 1V2ST 2ZPRA 2B0FA 2CV3A 1L1GA 2ZWLH 3RXOA 1A0LA 1BITA 3IWMA 1Y8TA 3QDZB 3T2NA 4AYVB 2IJOB 1UTOA 1AVXA 1DS2E 3BTEE 3U8TH 1S84A 4FUDA 4DJZB 4TWYA 2FOMB 1WCZA 4ZH8A 2OCVB 1DICA 7KMEH 1L1NA 4A7IB 2ANMH 1O3DA 1GBTA 1UTLM 1ELGA 2BLVA 2FEQH 3LGYA 4YO9A 1QB1A 3UR9A 2TRMA 2ILNA 1NO9H 1K1IA 1HIAB 4NIVA 2H1UA 2NU4E 2AIQA 1ANDA 1ZTLA 1AIXH 2BVXH 3RXMA 4AG2A 3U8RH 5EW1H 3QK1A 1O39A 2J95A 1O37A 1QCPA 4B2AA 2ZDAH 1INCA 4UE7H 1XXFA 9LPRA 1GL0E 1S5SA 3TVJB 3VB6A 2YOLA 3SUFA 1IQGA 2FLRH 3ZZ7A 1YPJH 1KSNA 2GDEH 2HPPH 1KY9A 5I25A 1MUEB 2P3FH 3LGWA 4WXVA 1EJNA 6GCHF 4LXBH 4AOQA 3K6ZA 3SJ8A 4CRAA 1TGCA 4GVUA 2HRVA 4DCDA 3SU2A 3QO6A 5HMAA 2PW8H 3P6ZB 4DG4A 1SOTA 2ZU4A 1HGTH 1MKXH 4AFSA 2JH0D 3M5OA 4DOQA 2WYGA 3K9XB 1GVKB 4DIHH 1MTNB 5DO4H 1FY3A 3MU0A 3KGPA 1TPPA 1W14U 2UWPA 2NU1E 3TNTA 1CGHA 5E2PA 1FN8A 3GY4A 3T62A 4TYDA 1VITH 2QXHA 2ZGJA 1THPB 3ZV9A 2M5TA 1C1PA 1P2OA 4AN7A 1WTGH 4I8GA 4ISIH 1MKXK 4O03A 4Y8YA 5FPTA 3ZYDA 1EKBB 4TPIZ 4CREA 1F5LA 1RRKA 3UOUA 5C5OA 2JH5D 1E0FD 1C5ZB 1FIWA 2BDCA 1OYQA 2FX4A 2GP9B 2P59A 1Y5UT 2ZPQA 1XX9A 4K69A 2V35A 4ZHAA 3SGAE 1W7GH 4AGKA 4Q80A 1GJ6A 1AE8H 2OC0A 2FXRA 5FX6A 2XCNA 1BCUH 4AFUA 4UDWH 3B8JA 1D3DB 4AB8A 1Z6JH 1MTVA 5HGGA 4U01A 1PQ5A 1GL1A 1AZZA 5A2MH 1ZHPA 1S6FA 1UVUH 3SNBA 1ID5H 1C5QA 1AHTH 2LNCA 2AIPA 4Z6AH 1OWIA 1DLKB 4BOHA 1KTSB 1GMDG 1SLVB 1PPFE 2WINI 2Z9LA 4VGCC 3KNXA 2ZA5A 5DP5A 1CE5A 3BIVH 1ZR0A 3SUDA 1TRYA 5E0JA 1EB2A 1F2SE 1K21H 2OC8A 1D4PB 2HNTF 3F9FA 1C4Y2 1T7CA 4K2YA 1GPZA 2FOGA 3L6PA 1RIWB 1OP8A 4MQAA 7ESTE 4B2BA 1TWXB 3MO3A 4MPVA 1A3EH 4UONA 1DM4B 4Q7ZA 4FUBA 5GIBA 1O2YA 2V0BA 2FO9A 2PTCE 1W11U 6LPRA 5AFYH 5A0CA 1T8OA 4MNWA 1UVOA 1AFEH 2XBWA 1SGRE 1SVPA 5T6DA 4E7RG 1ZPZA 2TGDA 2SNWA 3HKJB 4UD9H 1CA8B 1P10A 3TIUA 1BRBE 1ZYOA 1ZGVA 4WF8A 1O2MA 4X1NU 1HAIH 2A7CA 3ATMA 2A7JA 3FP7E 5A8YA 1MBQA 1P2KA 4O3UA 1NY22 1H9HE 1H8IH 1HAZB 1THRH 1D3TB 1VITF 2ZFPH 3RMLH 1RXPA 1XXDA 3UIRA 3PM3A 1MKWH 1PPBH 3M3VA 2C8XB 3PLBA 1GHWH 4YLQH 4YM9A 1V2TT 1EATA 1NRQH 2VWMA 2ZDLA 1O3MA 1TIOA 2YNAA 2XCFA 1H4WA 1Y3UA 2FTLE 3MNBA 2FWWA 1QGFA 2FDAA 2CF9H 4YOIA 3RMOH 4K8YA 2A2QH 1C2HA 3HK6B 4BTTB 6CHAC 3P92A 1GHVH 1DWEH 3A84A 1AB9B 1OWEA 4F4OC 3S9BA 1CBWC 2AMDA 3A81A 2ZGBH 1ESTA 2SGFE 3V13A 1O3FA 2ANYA 4BXSA 3M36A 3RXJA 2SGEE 2XTTB 1GWAA 2BY5X 2FOEA 5JBCS 1PPGE 1ZTKA 1A5HA 1QR3E 2BZ6H 2A1DB 4BAOB 2GZ9A 6GCHG 3KF2A 1O2OA 1OXGA 2QIQA 3MNSA 1SMFE 2FMJA 1ELVA 2CHAC 1WTHD 1OWDA 1TFXA 1N8OC 1QQUA 1XUFA 2W7SA 2P8OC 3EAJA 2Y82A 4O3TA 1SGQE 1M9UA 3RDZA 1EUFA 1TX6A 2FS9A 2ZCKP 3UFAA 1FONA 1IQLA 2WV5A 3DA9B 3BEUA 1YPMH 3MNCA 1ANEA 3JZ2B 5EPYA 1ZPBA 2AFQB 3SV2H 3RXDA 3M3SA 3QTOH 3SV7A 3HKIB 1MQ6A 1QB9A 3U69H 1YCPK 4CRBA 1JIMA 2A7HA 3N7OA 4NZLA 4X8UH 1NRRH 2VH0A 1FUJA 3O8BA 1BTUA 2CGAA 1O3IA 3CP7A 4WMEA 4TY6A 1C5RA 1IQFA 1OWJA 1YC0A 1ZSLA 2WPIS 5GPIB 1GI8B 3KIDU 1KXAA 1GVZA 2FPZA 1O2QA 1MH0A 3BTME 2WV4A 3ZZ5A 2SGPE 1LVBA 3GYLB 1C5OH 1QB6A 1TNIA 4GLYA 2Y81A 4SGBE 3UTUH 1C5YB 1NPMA 1C2DA 3MO9A 2F91A 1V2UT 2AH4X 2VIWA 5EXLA 1EPTC 1PPHE 5A09A 2ZQ2A 4I31A 1JMOH 1A3BH 2BB4A 2P95A 1AD8H 4K3JA 4MG3A 1O5EH 2W26A 2SFAA 3PTNA 2H5DA 5C2ZA 3MO6A 3ZZAA 3ESTA 1TGSZ 3M7UA 2ZP0H 3T25A 3TK5A 3S9CA 2G4UA 3MYWA 1BJUA 2ZFFH 2UUKB 3QZQA 3M61U 3MH6A 1GHBG 1TGTA 2WPMS 1WU1A 4FVBA 1SL3A 1C5MD 4OS7A 5ESTE 3LC5A 1EAWA 3QWCH 1O3AA 5E0HA 1LVYA 1P2QA 1C5UA 3QZRA 3LGIA 1YP9A 3K6YA 1F92A 1CU1A 1QY6A 5DK1A 2ZPSA 3M5LA 5TCCA 4Y0YE 1HLTH 5DP4A 2AMQA 4NFFA 2QGRA 1OWKA 5ABWA 3LH1A 5FBIA 3EA9A 4LK4A 1YBWA 5AFZH 3LJOA 1Y3XA 3MU8A 1LHEH 1KYNA 2PUQH 1LMWB 2O8WA 2ZU2A 1SGIB 5DKMA 1O2UA 3E3TA 5A0AE 2FLBH 2ZCHP 2A4OA 1SB1H 1V2PT 1MU6B 3H5CB 2P3UB 1ZSKA 2ANKH 5L2ZH 2SGDE 5T3HA 1OP2A 1WBGB 2O8LA 1O36A 1ZLRA 1D6WA 3ATLA 2ODPA 1C1VH 1TA6A 2OINA 3KN2A 1S81A 1C1UH 2BY6X 4OS6A 2BOKA 1O2WA 4IBLH 2EA3A 2RG3A 1SQOA 1D9IA 1DXPA 1FJSA 1FMGA 4FUEA 5DP7A 2J2UA 3GISB 5DPAA 2ZZUH 2W5EA 3WY8A 4I7YH 1V2KT 2ZU1A 4IGDA 5J4QA 1O33A 1EZUC 1HBTH 3U1JB 3NKKA 1P3EA 1ZJDA 4WH8A 2A4QA 2VB0A 4X1SU 5EW2H 3A82A 4IS5A 4Q7YA 1LHCH 2SNVA 1GHYH 1Y59T 4VGCB 3LIWA 1FZZA 4Y76A 3RLYH 3BTHE 3A8DA 2GMTC 5L2YH 4I33A 1E34B 1FPHH 4BTUB 4HGCA 1T32A 4YZUA 3GDSA 3ZZCA 4A6LA 1NTPA 1HV7A 3BF6H 4E7NA 1HFDA 3QUMP 4IC5A 4FU8A 3UNQA 4Y7BA 1P2IA 2QF0A 2ULLA 2Y5FA 1HIAA 4H42U 5GCHF 3ZYEA 2B8OH 1O2NA 5K0HA 1F5RA 2BD7A 1EB1H 3FZZA 4JZEH 4K8BA 1LPGB 5DGJA 1BT7A 4YLUA 1UO6A 1ZPCA 2ZTZA 3RXAA 1G9IE 1ZRBA 1SLUB 3C27B 3M5MA 1GG6C 3SNDA 4A1TA 1NFUA 4UFEH 4ABEA 3ODDA 2BLWA 1XUIA 3URDA 2HNTE 1HAGE 3SI3H 4ZKNU 4CHAC 1KIGH 3SU4A 3OY6U 1OX1A 3SJ9A 1FXYA 5C67A 1MQ5A 4MVNA 1LHFH 1AZ8A 3STIA 2ANWA 3MH7A 2OP9A 2VH6A 4Y6DA 4ABFA 2FYRA 1KXEA 1ZRKA 1CT4E 1AU8A 1LQEA 4WMFA 2BQWB 1GJCB 3O8DA 4XE4A 2QA9E 1KXCA 1K22H 1EZQA 3PV4A 1OSSA 2BD2A 4R8TB 1TNHA 3C1KA 1V2JT 1K2I1 1EX3A 1YF4A 1P01A 1ZMLA 1XUGA 4ABIA 2R0KA 3LGVA 2AGIX 3F9GA 1GMDF 2K1QA 1VCPA 1YPLH 3MFJA 2BM2A 3EA7A 6CHAB 3E0PB 1DWDH 4DW2U 4BTIB 3AAUA 1CBWB 2QC2A 2ZTYA 1OPHB 2PKAB 8GCHF 1TOCB 1SGCA 1XUHA 4B74A 3SV6A 5LPEA 4Y71A 1A4WH 1G30B 1N6YA 1QJ7B 4HZHA 1HJ8A 1Z8IB 5B6OA 1T8NA 1V2NT 2HWLB 1W12U 1HAVB 3HPTB 4CH2B 4DVAU 4JZFH 1T4UH 1LO6A 1TE0A 2CHAB 2UUFB 1BTHH 1N8OB 3NPSA 1ZMJA 2P8OB 5FXLA 3RXGA 1ETSH 5G4BA 2FI4E 3O8RA 1C5WB 1C2KA 1SGPE 2DE9A 4X8VH 1O3GA 3FP8E 1GCTC 1QL8A 2FTMA 3ATKA 1TLDA 4FUCA 3TJOA 3RM2H 1GI3A 1P12E 3GY5A 3I29A 1TOMH 3Q77A 1W10U 4MNYA 4AZ2B 5JYIA 1A5IA 1MBMA 2FOBA 1Q3XA 5L30H 4DY7B 4D9RA 4KTUA 4BAQB 1K1LA 1V2QT 1HAXB 5EXNA 4AGJA 2IPHA 5SGAE 2GDDA 1T8MA 1IQIA 2BOHB 2AYWA 1G3BA 2GT7A 1P57B 5F03A 1C5TA 2GT8A 2G00A 1JIRA 1C1RA 1C1NA 2ZU3A 1GHXH 1C1TA 3DFJA 4GSOA 1E37B 2PWXA 2BD9A 2WPHS 3SQHE 1QHRB 1ELTA 2BXTH 3ZVFA 1DSUA 1GBFA 2FI3E 1GBMA 2TPIZ 3SUGA 1C2GA 5CMXH 1TQ7B 5FCKA 1AQ7A 1UTMA 2P94A 1O3HA 1YLDA 4GPGA 1EPTB 1SGYE 3SQEE 3M35A 1GI2A 2R0LA 3DT0H 2C4FH 4D7GA 3S0NA 1GCDA 3KL6A 3LOXA 4CR5A 5JBAS 2OTVA 2HGTH 2OBOA 7LPRA 4NA9H 1ELDE 4YT6H 1P11E 1C1QA 3GCHC 4OS5A 2BD8A 3A89A 4RKOB 2VWOA 3RU4E 3SBKA 5GCHG 4ZUHA 2P93A 3MU5A 5EXMA 5EQSA 3FZDA 3TGKE 3UPEA 4ZXYH 2OC1A 3RXLA 1O5DH 1O3LA 1Z6EA 1DT2A 4GHTA 1TYNA 2A31A 4HTCH 1C5PA 1QRZA 1LVOA 2UUYA 4X2XA 4OS4A 1DE7H 5BRRE 3RXHA 3S7HB 5IDKA 3RXRA 5FHTA 1EQ9A 1GBCA 3H7TA 3TK9A 3SJIA 3MU4A 1MCVA 1SQTA 2VVCA 3R3GB 1IAUA 2BXUH 1BTYA 5BPEA 1FN6A 1TBRH 4NG9H 4NWLA 1GDQA 3EE0B 1BMAA 3PWBA 1C5SA 1NESE 1S82A 2F3CE 3D23A 4NIYA 3STJA 5JPMH 1ZSJA 3RC6A 3ITIA 1IHTH 5EU8A 2XNIA 4X1RU 1ORFA 1G3CA 3RC5A 4BANB 2A45B 2ZDVH 3TNSA 2CN0H 1Z71A 4IN2A 2BVRH 1O3PB 2BDAA 4BXWA 1GBLA 3A7TA 1A46H 8LPRA 1YYY1 1S85A 2XC4A 3TJNA 3GYMA 1PQ8A 8GCHG 3OY5U 2VIQA 1J17T 1KLTA 1GHBF 1SC8U 1OKXA 2G52A 1F0UA 5TJXA 3RM0H 3V3MA 2PLXA 2LPRA 3GY6A 1TBZH 1PQ7A 3V0XA 3L3TA 3A83A 1F0TA 1AUTC 4OS2A 3DUXH 2DUCA 1A7SA 1LQDB 1ELCA 4WXIA 4TWWA 1J14A 3AVZA 3MH4A 1AUJA 3T29A 1MD7A 5EQQA 3SGBE 2F9BH 2GMTB 2BQ7B 3SU5A 1Y3YA 2KAIB 4CRCA 2A4GA 4ISLA 1VR1H 1EJMA 4U32A 2AEIH 1QBOA 5AF9H 1O2HA 3A86A 5A0BA 3TGIE 3ZVCA 3SNEA 3CENA 1GHZA 1ABJH 2OXSA 1SGFG 2PFEA 1MZDA 1KXBA 4JZIA 1E38B 1F0RA 3SU1A 3BEIB 1GHAF 2PV9B 3D65E 3E16B 2BD4A 1GI0A 1GJ4H 3E1XB 3BTDE 1GG6B 1HB0B 3GCNA 3KEEA 5AHGH 3TH2H 2AMPA 1TB6H 2G81E 1C4V2 5T6GA 5E2OA 1UVPA 2BHGA 4CHAB 1GI7B 2D8WA 3P8NA 1MKWK 4U2WA 1B7XB 5GXPA 3RC4A 3V7TA 2O8TA 1O3OA 1XKBC 1O34A 4H4FA 2ZKSA 4Y79A 3F9HA 3UWJH 1UCYE 2JETC 2ZGCA 1WAYB 4KELA 4BAHB 1V3XA 1W8BH 2VNTA 4MPUA 7GCHG 1RTLA 3E6PH 1NC6A 4XOJA 4AFZA 1MAXA 3A7ZA 3SU6A 3BN9A 5EPNA 1SFQB 3ZZ6A 1O3KA 2P16A 2Y80A 4AB9A 1BRAA 1UVTH 1V2WT 1O3CA 2ZHFH 2YNBA 1DXWA 2H9TH 1RTKA 4H6SB 4TPYA 3ZVAA 4I8KA 1THSH 1AWHB 2NU0E 1HNEE 1ZJKA 2Z94A 3PMJA 1FI8A 2AGGX 4K1SA 1CGJE 3NWUA 1A1RA 1GBBA 1K1MA 1O3JA 3TH3H 2XYAA 1KDQB 1VCWA 3A8CA 4A1XA 5DP8A 4CRGA 2ZFQH 3MH5A 5GDSH 2JH6D 1GJ5H 5EQRA 2Y5HA 1PYTC 1TONA 4X6NA 2PTNA 1H9IE 3PO1C 3NK8A 4NA8A 2V3OH 1H8DH 3AAVA 1GMCG 3OU0A 2FOAA 2SGQE 1G3DA 1TX7A 4FUJA 3A7YA 5GJ4B 8ESTE 1TNLA 1O0DH 1ZZZA 3Q76A 4X2YA 1GCTB 1NZQH 4ZXXH 5C20A 3UQVA 3S9AA 4CBNA 3M7TA 1O5CB 2CF8H 1K1PA 4OS1A 1DWBH 1C5XB 2F9PA 2WPJS 5JBBS 3FAOA 3LU9B 1EAUA 3PTBA 2HALA 3Q3XA 2GTBA 4NCYA 2D26C 3A7XA 2FODA 1GI6A 2ZFRH 1S0QA 1MU8B 1FPCH 3TJUA 1UJ1A 2BLQA 3A88A 1O2KA 2SGAA 4RSPA 1P0SH 1XKAC 3VGCC 5EOKA 2ZEBA 4K1EA 3NUMA 3ODFA 1EJAA 3RXTA 2F9OA 2J9NA 2RA3A 1SBWA 1MTSA 4ABHA 1WQVH 1GBDA 2ZU5A 1L0ZA 3SOSA 3D49H 2GZ7A 1BB0B 4YESB 2VWLA 2BTCE 1TPSA 3W94A 1O30A 1FQ3A 1UCYH 2J4IA 4B75A 1O38A 1C5VA 1P09A 1GBIA 1C2IA 1XVMA 4MNXA 3E0NB 1BTPA 3OSYA 3PB1E 1MAYA 2Q6FA 4D76A 1RGQA 4FUIA 2XBXA 3P70B 2GCTC 1GBKA 1DUEA 3ATIA 4THNH 3BSQA 3D62A 3FVFB 3A80A 3GCHB 4WMDA 4QT8C 4D7FA 4KKDA 5DP9A 5F6MA 3GCOA 1RS0A 1C5NH 2R3YA 4B73A 1YPHC 1UCYK 3SHAH 4WY3A 1VZQH 4JK6A 4AFQA 1G32B 2GV6A 1P02A 1GHAG 1W0ZU 3EA8A 1OWHA 2D1JA 1CHGA 1CT2E 3GY3A 2PKAA 3VXFH 1IHSH 1O5GH 3GCTF 1G2LA 1W3CA 4ISHH 1K28D 3F1SB 1FY8E 1O35A 3Q00A 1V2OT 1KXFA 2G4TA 2FX6A 4X6PA 4I8JA 1HAVA 1C9TA 5LH8A 2W3IA 5E8EH 1Z8JB 1GGDC 1P2NA 3AASA 3P8OA 1IQHA 2C8WB 3ZVDA 1DY9A 1GI1A 2AERH 3BG4C 4ISNA 1PPZA 3DHKH 3PLPA 1ANBA 3RXUA 4CRDA 5JDUB 2I6QA 3MU1A 2ALPA 2QY0B 4NIXA 2ZG0H 2VIOA 1GI5A 1QURH 2BDHA 1TQ0B 2PUXB 1C1OA 2RA0A 4YTAA 1TMTH 1CSOE 2ZQ1A 4CH8B 1DLEA 2BZAA 3VXEH 1E35B 5DP3A 4AX9H 3S7KB 1Y5AT 3SO3A 1C2FA 4Y11E 2XBVA 1QNJA 1BA8B 1YGCH 2Z3CA 3H7OA 3NZIA 2H2ZA 2C93B 2EI7A 4WVPE 1AE5A 2F9NA 3M3TA 1TALA 3QLPH 5FPYA 4JYTA 1AO5A 2HLCA 2Q1JA 1EASA 1AFQC 4INHA 5C1YA 1O2VA 2PGBB 5HXFA 2XC0A 4Y7AA 1DVAH 1Z8GA 3UNSA 2Z7FE 4J2YB 2FM2A 1BMMH 1HDTH 2OQ5A 4MDSA 1FDPA 4U30A 1ZTJA 3A8BA 1GMHG 2FOCA 1IOEA 1DY8A 1ZHRA 2PHBA 2FIRH 1ARBA 1AGJA 1AKSB 4NIWA 3BEFB 3ZVEA 1BTXA 2BX3A 4IC6A 1F7ZA 3SORA 2A2XH 1MMJN 2GGVB 2VGCC 1W0YH 1EPTA 1MZAA 1O2RA 2A5KA 1RFNA 1GBEA 3PYHA 5PTPA 2BY8X 1O2IA 3M37A 4DIIH 4X8TH 1FV9A 1V6DA 1O3NA 2ZFTA 2C8ZB 2QCYA 1Z1JA 1L2EA 4Y0ZE 4FU7A 3URCA 2FS8A 1NRPH 1VCQA 4E06H 2P3TB 4JK5A 1Z7KA 4ABDA 4I8HA 1O2JA 5ETXA 1UTNA 3TK6A 3BTGE 2RDLA 2HPQH 4WH6A 5E0GA 2H5CA 4FUFA
chains in the Genus database with same CATH superfamily
1BRCE 3O8CA 1OS8A 1Y3WA 1BBRH 3UUZA 2FOFA 3SJKA 1HAYB 1C9PA 1TABE 1KTTB 1SGFA 1BHXF 1UTQA 4GCHG 3LGUA 4ZCNA 1DUAA 2JETB 3TPIZ 1IQJA 1O2TA 1C1WH 2GJGA 2M2AA 1UK3A 2JKHA 3T28A 2HOBA 3T26A 5IYTA 4IMZA 3VFEA 1HJAC 1DITH 2A4RA 3GY7A 4O97A 1GVLA 2G5NA 3ZV8A 2BMGB 3BG8A 1TRNA 3EYDA 2PSXA 1XMNB 1D3QB 1B5GH 1DWCH 1NU9A 1E36B 4K1TA 2XC5A 1GDNA 5DJ7A 3KQDA 2VIDA 1BUIA 3UWIA 3RXFA 1B0EA 1LVMA 3UR6A 3MMGA 1P9UA 3QX5H 2GVFA 2W3KA 1GI9B 1EAIA 1NU7B 1XUJA 2F9UA 2WPLS 2ZDKA 1K1OA 1SHHB 1J9CH 1UHBB 3UAIC 2V3HH 1NFYA 4O9VA 1VGCC 3MOCA 1L4DA 1P2JA 3E8LA 2F83A 1MTWA 4ACBA 2H9HA 3BTFE 3ZZ8A 1O5BB 1JOUB 2ZHQH 3GCTG 3LONA 1ZGIA 1NFXA 3PO1B 3M7QA 4INLA 4X2VA 2G8TA 3IITA 1CHOG 1S6HA 2I6SA 1QJ6B 3VPKA 3MI4A 1YM0A 4JMYA 4ABJA 1W2KH 4AYYB 2Z9GA 5I46H 2Q6DA 3CNRA 4FU9A 1V2LT 1J15A 1BIOA 1O2LA 2PKSC 1SGNE 2KAIA 3UOPA 1BHXB 1QIXB 2IN2A 3UQOA 2VINA 1PPEE 1N1LA 1YPKH 1EP5A 1TNGA 1V2VT 1YCPM 3OEHD 1C2MA 7GCHF 1EZSC 2VIPA 2VVVA 1QL9A 1HAPH 1CT0E 3BTWE 3LT3A 1JRTA 1PFXC 2TBSA 4FUGA 4I32A 1JWTA 3FFGA 3PMBB 4YXWD 5HYOA 1MTUA 2EI8A 4IMQA 3VGCB 2GCHF 2ZI2H 4NZQA 5H4IB 1WQSA 2XXLA 1C2JA 1A5GH 2BVSH 4UFGH 1HCGA 1P06A 3QGJA 3SYJA 3BIUH 4A5TS 3GY2A 4ABAA 1G37A 1O31A 3OYPA 4A1VA 3TU7H 4HG6A 1ETTH 2OLGA 4ASHA 2R9PA 4GUXA 4CR9A 1NBME 1GMCF 1BTZA 1LCYA 3SUEA 1O2PA 2GCTB 1OYTH 1ARCA 2ZDNA 4H6TA 2STAE 1K1NA 1V2RT 4M7GA 3HATH 2FP7B 4AORA 1NROH 4B71A 3TJVA 2QV1A 1QJ1B 2UWOA 2BX4A 1W13U 4Y10E 1RJXB 1IQKA 4K5ZA 5A8ZA 3RXQA 1C5LH 5FAHA 4MTBA 2J38A 3U1IB 4E05H 2KCOA 1P9SA 3BTKE 1YPEH 5FPSA 4XDEA 3FP6E 3PRDA 2VIVA 3K2UA 3SNCA 1ELEE 1GDUA 2XBYA 1WV7H 1KDQA 3S69A 3VB3A 1X7AC 3A85A 3LPRA 3KQBA 3F2FA 4KTSA 4RT0A 1DSTA 1GBJA 1J16A 1JBUH 3AW0A 1ZHMA 1KLJH 5A8XA 2STBE 3PLKA 1A2CH 2Z9KA 5CDFE 5HM9A 1GGDB 4INKA 2XWAA 5EG4A 4MLFB 1JXPA 5JBTA 2C8YB 3BG4B 4X2WA 2UUJB 4ACAA 1CA0C 1K1JA 1FAXA 3G01A 4JYUH 2ESTE 1GJDB 4XD7D 1D6RA 2VBCA 3RLWH 3UREA 4X1PU 4LZ1H 2VJ1A 2TGTA 2EEKA 4NSVA 5C1XA 1BZXE 1L1JA 4ZROA 2BLOA 1QTFA 1XUKA 1SI5H 2BDGA 2FYQA 2QXIA 2G55A 3NXPA 1IQMA 2RCEA 5CHAC 1FY4A 4KP0A 1OP0A 2C3SA 1LDTT 3FANA 2DE8A 1H9LB 4BNRA 4UEHH 2Z6BD 3E91A 1AFQB 1P05A 2TIOA 3RU4D 3EGKH 3W1EA 1N6XA 1WUNH 4FVDA 3M5NA 5LPFA 3SW2B 4CBOA 1QRWA 1OOKB 1DDJA 1TX8A 3LKWA 1P03A 3F2GA 2NU2E 3RXVA 2QXJA 1AY6H 4HFPB 4KGAA 1TBQH 1HAHH 3VG8A 9ESTA 3RXBA 1MABB 4ABGA 4B2CA 2CJIA 1BDAA 3GICB 2ALVA 1QQ4A 1UTKA 1SSXA 1T4VH 3I78A 3UY9A 3AW1A 1DFPA 5C5NA 1C2EA 3A87A 1TGNA 1P3CA 3PMAB 1O32A 4X0WU 2H6MA 2Z3DA 1KXDA 2FI5E 2VGCB 3DD2H 2VVUA 1FLEE 2A5IA 1GJ9B 1UTPA 3N7DA 1ETRH 1FAKH 4LOYH 2G5VA 2W7UA 2O9QA 4A92A 3RMMH 1E1RD 1NN6A 5C0UA 1TRMA 4GAWA 1Z1IA 3BTTE 1IQNA 1L4ZA 2BY9X 2HVXA 3RXKA 1SLXB 2QXGA 4ISOA 1O5FH 3GOVB 1H1BA 3K65B 2R2MB 3SJOA 4UFFH 1NT1A 1LHGH 1LPKB 3SZNA 1HYLA 5DP6A 4GHQA 2WPKS 3VB7A 1V2MT 1AMHA 3W95A 3RUOA 5ESBA 1U6QA 4Q7XA 1QL7A 4WWYA 3VB5A 1LHDH 1TNJA 3TGJE 2GCHG 3LDXH 4ZKSU 2NU3E 1NRSH 3RXIA 1SPJA 2ASUB 2PGQB 1O3EA 3DFLA 2VU8E 1BMNH 5T6FA 3RXCA 1HXFH 1C1MA 4HI3A 1UTJA 1UK2A 1TPAE 4MPXA 1YCPH 4JZDH 4ZKOU 5F8XA 3P95A 1QA7A 1O5AB 1SOZA 4ZMAH 3T27A 4NA7A 4NWKA 5B6LA 1HJAB 1UVSH 3OE7D 3PWCA 1F0SA 1YKTA 2ZIQH 5EGMA 3SI4H 1ACBE 3BV9B 1SGTA 1WOFA 5F8TA 2H9EH 1GMHF 2BDIA 4R0IA 4X6OA 4NSYA 1CQQA 1O2GH 4FUHA 3HK3B 2V6NA 1QA0A 4X6MA 3KQCA 1ESBA 1BMLA 1ESAA 2EY4C 3A7VA 3U98H 4TT3D 4I8LA 4CRFA 1KLIH 1PQAA 2PR3A 3SU3A 3KYGA 3A8AA 4NGAH 3IG6B 4ESTE 2A0QB 1SG8B 2B9LA 4B76A 1UK4A 5IK2D 3ZZ4A 3E90B 4D8NA 1EOJA 2FOHA 4BAKB 1HRTH 1PPCE 4ZAEA 1HAOH 5EODA 1BTWA 3Q3KA 3QTVH 3LGTA 2QAAA 1VGCB 1Y3VA 2TGPZ 1JRSA 4UFDH 2AGEX 1A0JA 3TH4H 4JCNA 2BY7X 2EC9H 2OC7A 3OTJE 3EDXB 5DSFA 2WYJA 2QE7D 1EXFA 1T31A 4DURA 2QF4A 4IN1A 1ZMNA 3NCLA 5GNDA 2FESH 3JZ1B 1GJ7B 3QGNB 2XWBI 2WUCA 1AVWA 1F5KU 1C2LA 2R2WU 1DPOA 1FY1A 1HJ9A 1O3BA 4WJG2 4YT7H 1WDIA 5FBEA 1AKSA 1S0RA 3P8FA 1YLCA 4GCHF 2BYAX 4TY7A 1PJPA 2D2DA 2PKSB 5HM2A 2OD3B 3LC3A 3MHWU 5C94A 3U9AH 3SV8A 1BRUP 2OQUA 3TLOA 4ABBA 3ZVBA 2BD3A 2GKVE 3L33A 4Y8XA 4ZKRU 1MTNC 2ZGXH 1GI4A 2JJ2D 2Y7ZA 3ZZ9A 1G36A 3F6UH 3GY8A 3GDUA 1S83A 5LPRA 1DANH 3U8OH 3SGQE 2ZC9H 5AVDA 3CS0A 1SGEE 1YPHE 1ANCA 5L6NH 4JYVH 4Q2KA 1P8VC 2ZNKH 1SHYA 2Z9IA 1SQAA 1D3PB 2R3UA 2A32A 2PSYA 3B23B 2WV9A 2J92A 3ATWA 1UMAH 2GX4A 3P8GA 3R0FA 4J1YA 1AWFH 1VJ9U 1PYTD 4IW4E 3MNXA 4X8SH 4BAMB 1Z8RA 3KHVA 3RXSA 3T5FH 1O2SA 2ZHWH 1TMBH 1NFWA 3HGNA 2KCYA 5F8ZA 2ZCLP 1B0FA 1VITG 2ZTXA 1SFIA 2ZF0H 1FY5A 2ZECA 1BBRE 4OGYA 3VB4A 1QBNA 3ELAH 4XRNA 2NWNA 2CXVA 2EI6A 1CHOF 2OUAA 1TNKA 4K60A 1P2MA 3F2HA 2O8MA 2AS9A 5K7RA 1QRXA 2JJ1D 2BD5A 1TAWA 3EQ0H 3HGPA 1CO7E 1Y5BT 3SHCH 3SN8A 2VWNA 4XFQA 5FCRA 1RD3B 4YOJA 2BQ6B 1LTOA 1GJAB 3F9EA 3SV9A 5C3NA 2B7DH 3SNAA 1DX5M 1VJAU 2FZZA 4MPWA 1EAXA 1NRNH 3ZZDA 4X1QU 2Q6GA 1RIWC 4FXGH 3UNRA 1AVGH 1WSSH 1COWD 1NS3A 1ZOMA 1LKBA 1UHBA 2J34A 1LPZB 4XBCA 8KME2 3MWIU 4XBDA 1MD8A 2ZFSA 1GJBB 4AC9A 1RTFB 2WUBA 4OGXA 4DGJA 2XW9A 2QN5T 1O2XA 1A0HB 4JZ1A 4ZHLU 3TITA 1P04A 2QF3A 3ZZ3A 1SLWB 5T1VA 1W7XH 1ELAA 2XRCA 1BQYA 4AG1A 2L74A 2KR7A 1XVOA 5GWZA 2GZ8A 3ZZBA 1CA0B 6ESTA 2WZQA 1AI8H 2TGAA 1WYKA 1YPGH 3RU4T 1QFKH 3B9FH 1TGBA 2Z9JA 1GJ8B 1DOJA 1ELBA 1CGIE 2YMSD 2ODYB 4RKJB 3Q3YA 4NFEA 4DT7B 1BJVA 3RP2A 3OEED 1HXEH 1FIZA 1NM6A 1GBAA 1VKYA 2THFB 1IQEA 3FKSD 5CHAB 3I77A 2RDEA 4Y8ZA 5FX5A 3GDVA 2C90B 2F9VA 5J4SA 1HUTH 1G2MA 1G3EA 3OX7U 2Y6TA 2GD4B 3PROA 3CS7A 4XSKU 5TCAA 3P17H 3RMNH 2ZHEH 1HPGA 3EE7A 1LKAA 3RXEA 3VEQB 1C4U2 2B5TB 2ZHDA 1TMUH 3KQ5A 2J94A 1J8AA 5LGOA 2CMYA 2Y5GA 5CE1A 2Z3EA 1CVWH 3LJJA 1AB9C 2GV7A 3LH3A 4PROA 3V12A 2ZGHA 3BTQE 2HNTC 4F49A 4MNVA 1GBHA 5DG6A 2Y7XA 4B1TA 3OTPA 1BOQA 1K9OE 3KQEA 1Q2WA 1C1SA 4RN6A 2IPQX 1TPOA 2QYIA 1EZXC 1TA2A 4D9QA 1FNIA 2O8UA 1MCTA 2ZDMA 3A7WA 1SGDE 3MTYA 5JB8S 1A61H 1SR5C 3ENSB 1T8LA 5C1UA 2F4LA 3ZVGA 2BDYA 2ODQA 4YOGA 2UWLA 1O2ZA 2G51A 1EOLA 4Z0KA 4SGAE 1AN1E 5EJ1A 4ZHMU 3QN7A 4LZ4B 1ELFA 2K0QA 1Q31A 2CK3D 3F68H 2ZO3H 1BBRK 3PMHB 1EP6A 3RXPA 1XM1A 4KTCA 4XBBA 2A5AA 1ABIH 3KCGH 1QBVH 3DCLA 3SU0A 2BDBA 2OBQA 2IOTA 5JB9S 1V2ST 2ZPRA 2B0FA 2CV3A 1L1GA 2ZWLH 3RXOA 1A0LA 1BITA 3IWMA 1Y8TA 3QDZB 3T2NA 1FX0B 4AYVB 2IJOB 1UTOA 1AVXA 1DS2E 3BTEE 3U8TH 1S84A 4FUDA 5C17A 4DJZB 4TWYA 2FOMB 1WCZA 4ZH8A 2OCVB 1DICA 7KMEH 1L1NA 4A7IB 2ANMH 1O3DA 1GBTA 1UTLM 1ELGA 2BLVA 2FEQH 3LGYA 2IJD1 4YO9A 1QB1A 3UR9A 2TRMA 2ILNA 1NO9H 1K1IA 3U28C 1HIAB 4NIVA 2H1UA 2NU4E 2AIQA 1ANDA 1ZTLA 1AIXH 2BVXH 5KEDA 3RXMA 4AG2A 3U8RH 5EW1H 3QK1A 1O39A 2J95A 1O37A 1QCPA 4B2AA 2ZDAH 1INCA 4UE7H 1XXFA 4FETA 9LPRA 1GL0E 1S5SA 3TVJB 3VB6A 2YOLA 3SUFA 1IQGA 2FLRH 3ZZ7A 1YPJH 1KSNA 2GDEH 2HPPH 1KY9A 5I25A 1MUEB 2P3FH 3LGWA 4WXVA 1EJNA 2XOKD 6GCHF 4LXBH 4AOQA 3K6ZA 3SJ8A 4CRAA 1TGCA 4GVUA 2HRVA 4DCDA 3SU2A 3QO6A 5HMAA 2PW8H 3P6ZB 4DG4A 1SOTA 2ZU4A 1HGTH 1MKXH 4AFSA 2JH0D 2OK5A 3M5OA 4DOQA 2WYGA 3K9XB 1GVKB 4DIHH 1MTNB 5DO4H 1FY3A 3MU0A 3KGPA 1TPPA 1W14U 2UWPA 2NU1E 3TNTA 1CGHA 1UW7A 1FN8A 5E2PA 3GY4A 3T62A 4TYDA 1VITH 2QXHA 2ZGJA 1THPB 3KYFA 3ZV9A 2M5TA 1C1PA 1P2OA 4AN7A 1WTGH 4I8GA 4ISIH 1MKXK 1YLNA 4O03A 4Y8YA 5FPTA 3ZYDA 1EKBB 4TPIZ 4CREA 1F5LA 1RRKA 3UOUA 1YWUA 5C5OA 2JH5D 1E0FD 1C5ZB 1FIWA 2BDCA 1OYQA 2FX4A 2GP9B 2P59A 1Y5UT 2ZPQA 1XX9A 4K69A 2V35A 4ZHAA 3SGAE 1W7GH 4AGKA 4Q80A 1GJ6A 1AE8H 2OC0A 2FXRA 5FX6A 2XCNA 1BCUH 4AFUA 4UDWH 3B8JA 1KMHB 1D3DB 4AB8A 1Z6JH 1MTVA 5HGGA 4U01A 1PQ5A 1GL1A 1AZZA 5A2MH 1ZHPA 1S6FA 2J98A 1UVUH 3SNBA 1ID5H 1C5QA 1AHTH 2LNCA 2AIPA 4Z6AH 1OWIA 1DLKB 4BOHA 1KTSB 1GMDG 1SLVB 1PPFE 2WINI 1K0HA 2Z9LA 2LELA 3KNXA 2ZA5A 4VGCC 1CE5A 3BIVH 5DP5A 1ZR0A 3SUDA 1TRYA 5E0JA 1EB2A 1F2SE 1K21H 2OC8A 3OFND 1D4PB 2HNTF 3F9FA 1C4Y2 1T7CA 4K2YA 1GPZA 2FOGA 3L6PA 1RIWB 1OP8A 4MQAA 2JDID 7ESTE 4B2BA 1TWXB 3MO3A 4MPVA 1A3EH 4UONA 1DM4B 4Q7ZA 4FUBA 5GIBA 1O2YA 2V0BA 2FO9A 2PTCE 1W11U 6LPRA 5AFYH 5A0CA 1T8OA 4MNWA 1UVOA 1AFEH 2XBWA 1SGRE 1SVPA 5T6DA 4E7RG 1ZPZA 2TGDA 2SNWA 3HKJB 4UD9H 1CA8B 1P10A 3TIUA 1BRBE 1ZYOA 1ZGVA 4WF8A 1O2MA 4X1NU 1HAIH 2A7CA 3ATMA 2A7JA 3FP7E 5A8YA 1MBQA 1P2KA 4O3UA 1NY22 1H9HE 1H8IH 1HAZB 1THRH 1D3TB 1VITF 2ZFPH 3RMLH 1RXPA 1XXDA 3UIRA 3PM3A 1MKWH 1PPBH 3M3VA 1NBMD 2C8XB 3PLBA 1GHWH 4YLQH 4YM9A 1V2TT 1EATA 1NRQH 2VWMA 2ZDLA 3AK5A 1O3MA 1E79D 1TIOA 2YNAA 2XCFA 1H4WA 1Y3UA 2FTLE 3MNBA 2FWWA 1QGFA 2FDAA 2CF9H 4YOIA 3RMOH 4K8YA 2A2QH 1C2HA 3HK6B 4BTTB 6CHAC 3P92A 1GHVH 1DWEH 3A84A 1AB9B 1OWEA 4F4OC 3S9BA 1CBWC 2AMDA 3A81A 2ZGBH 1ESTA 2SGFE 3V13A 1O3FA 2ANYA 4BXSA 3M36A 3RXJA 2SGEE 2XTTB 1GWAA 2BY5X 2FOEA 5JBCS 1PPGE 4I86A 1ZTKA 1A5HA 1QR3E 2BZ6H 3F3BA 2A1DB 4BAOB 2GZ9A 6GCHG 3KF2A 1O2OA 1OXGA 2QIQA 3MNSA 1SMFE 2FMJA 1ELVA 2CHAC 1WTHD 1OWDA 1TFXA 1N8OC 2J97A 5EJLA 1QQUA 1XUFA 2W7SA 2P8OC 3EAJA 2Y82A 2J98B 4O3TA 1SGQE 2LP6A 1M9UA 3RDZA 1EUFA 1TX6A 2FS9A 2KCAA 2ZCKP 3UFAA 1FONA 1IQLA 2WV5A 3DA9B 3BEUA 1YPMH 3MNCA 1ANEA 3JZ2B 5EPYA 1W0JD 1ZPBA 2AFQB 3SV2H 3RXDA 2WHXA 3M3SA 3QTOH 3SV7A 3HKIB 1MQ6A 1QB9A 3PV5A 3U69H 1YCPK 4CRBA 1JIMA 2A7HA 3N7OA 4NZLA 4X8UH 1NRRH 2VH0A 1FUJA 3O8BA 1BTUA 2CGAA 1O3IA 3CP7A 4WMEA 4TY6A 1C5RA 4RT1A 1IQFA 1OWJA 1YC0A 1ZSLA 2WPIS 5GPIB 1GI8B 3KIDU 1KXAA 1GVZA 2FPZA 1O2QA 1MH0A 3BTME 2WV4A 3ZZ5A 2SGPE 3F0PA 2KCPA 1LVBA 3GYLB 1C5OH 1QB6A 1TNIA 4GLYA 2Y81A 4SGBE 3UTUH 1C5YB 1NPMA 1C2DA 3MO9A 2F91A 1V2UT 2AH4X 2VIWA 5EXLA 1WXRA 1EPTC 1PPHE 5A09A 2ZQ2A 4I31A 1JMOH 1A3BH 2BB4A 2P95A 1AD8H 4K3JA 4MG3A 1O5EH 2W26A 2SFAA 3PTNA 2H5DA 5C2ZA 3MO6A 3ZZAA 3ESTA 1TGSZ 3M7UA 2ZP0H 3T25A 3TK5A 3S9CA 2G4UA 3N7EA 3MYWA 1BJUA 2ZFFH 2UUKB 3QZQA 3M61U 3MH6A 1GHBG 1TGTA 2WPMS 1WU1A 4FVBA 1SL3A 1C5MD 4OS7A 5ESTE 3LC5A 1SKYE 1EAWA 3QWCH 1O3AA 5E0HA 1LVYA 1P2QA 1C5UA 3QZRA 2QF5A 3LGIA 3DSGA 1YP9A 3K6YA 1F92A 1CU1A 2JIZD 1QY6A 5DK1A 2KZ4A 2ZPSA 3M5LA 5TCCA 4Y0YE 1HLTH 5DP4A 5HKKD 2YMSC 2AMQA 4NFFA 2QGRA 1OWKA 5ABWA 3LH1A 5FBIA 3EA9A 4LK4A 1YBWA 5AFZH 3LJOA 1Y3XA 3MU8A 1LHEH 1KYNA 2PUQH 1LMWB 2O8WA 2ZU2A 1SGIB 5DKMA 1O2UA 3E3TA 5A0AE 2FLBH 2ZCHP 2A4OA 1SB1H 1V2PT 1MU6B 3H5CB 2P3UB 1ZSKA 2ANKH 5L2ZH 2SGDE 5T3HA 1OP2A 1WBGB 4Q63A 3WW7A 2O8LA 1O36A 4Z1MD 1ZLRA 3GS9A 1D6WA 3ATLA 2ODPA 1C1VH 1TA6A 2OINA 3KN2A 1S81A 1C1UH 2BY6X 4OS6A 2BOKA 1O2WA 4IBLH 2EA3A 2RG3A 1SQOA 1D9IA 3WWFA 1DXPA 1FJSA 1FMGA 4FUEA 5DP7A 2J2UA 3GISB 5DPAA 2ZZUH 2W5EA 3WY8A 4F55A 4I7YH 3DSPA 1V2KT 2ZU1A 4IGDA 5J4QA 1O33A 1EZUC 1HBTH 3U1JB 3NKKA 1P3EA 1ZJDA 4WH8A 2A4QA 2VB0A 4X1SU 5EW2H 3A82A 4IS5A 4Q7YA 1LHCH 2SNVA 1GHYH 1Y59T 4VGCB 3LIWA 1FZZA 4Y76A 3RLYH 3BTHE 3A8DA 2GMTC 5L2YH 4I33A 1E34B 1FPHH 4Q4LA 4BTUB 4HGCA 1H8ED 1T32A 4YZUA 3GDSA 3ZZCA 4A6LA 1NTPA 1HV7A 3BF6H 4E7NA 1HFDA 3QUMP 3DSOA 4IC5A 4FU8A 3UNQA 4Y7BA 1P2IA 2QF0A 2ULLA 2Y5FA 1HIAA 4H42U 5GCHF 3ZYEA 2B8OH 1O2NA 5K0HA 1F5RA 2BD7A 1EB1H 3FZZA 4JZEH 4K8BA 1LPGB 5DGJA 1BT7A 4YLUA 1UO6A 1ZPCA 2ZTZA 3RXAA 1G9IE 1ZRBA 1SLUB 3C27B 3M5MA 1GG6C 3SNDA 4A1TA 1NFUA 4UFEH 4ABEA 3ODDA 2BLWA 1XUIA 3URDA 2HNTE 1HAGE 3SI3H 4ZKNU 4CHAC 1KIGH 3SU4A 3OY6U 1OX1A 3SJ9A 1FXYA 5C67A 1MQ5A 4MVNA 1LHFH 1AZ8A 3STIA 2ANWA 3MH7A 2OP9A 2VH6A 4Y6DA 4ABFA 2FYRA 1KXEA 1ZRKA 1CT4E 1AU8A 3N99A 1LQEA 4WMFA 2BQWB 1GJCB 3O8DA 4XE4A 2QA9E 1KXCA 1K22H 1EZQA 1QZ8A 3PV4A 1OSSA 2BD2A 4R8TB 1TNHA 3C1KA 1V2JT 1K2I1 1EX3A 1YF4A 1P01A 1ZMLA 1XUGA 4ABIA 2R0KA 3LGVA 2AGIX 3F9GA 1GMDF 2K1QA 1VCPA 1YPLH 2PP6A 3MFJA 2BM2A 3EA7A 6CHAB 3E0PB 1DWDH 4DW2U 4BTIB 5FL7D 3AAUA 1CBWB 2QC2A 2ZTYA 1OPHB 2PKAB 8GCHF 1TOCB 1SGCA 1XUHA 4B74A 3SV6A 5LPEA 4Y71A 1A4WH 1G30B 1N6YA 1QJ7B 4HZHA 1HJ8A 1Z8IB 5B6OA 2F43B 1T8NA 1V2NT 2HWLB 1W12U 1HAVB 3HPTB 4CH2B 4DVAU 4JZFH 1T4UH 1LO6A 1TE0A 2CHAB 2UUFB 1BTHH 1N8OB 3NPSA 1ZMJA 2P8OB 5FXLA 3RXGA 1ETSH 5G4BA 2FI4E 3O8RA 1C5WB 1C2KA 1SGPE 2DE9A 4X8VH 1O3GA 3FP8E 1GCTC 3NRLA 1QL8A 2FTMA 3ATKA 1TLDA 4FUCA 3TJOA 3RM2H 1GI3A 1P12E 3GY5A 3I29A 1TOMH 3Q77A 1W10U 4MNYA 4AZ2B 5JYIA 1A5IA 1MBMA 2FOBA 1Q3XA 5L30H 4DY7B 4D9RA 4KTUA 4BAQB 1K1LA 5F53A 1V2QT 1HAXB 3SZEA 5EXNA 4AGJA 1E1QD 2IPHA 5SGAE 2GDDA 1T8MA 1IQIA 2BOHB 2AYWA 1G3BA 2GT7A 1P57B 5F03A 1C5TA 2GT8A 2G00A 1JIRA 1C1RA 1C1NA 2ZU3A 1GHXH 1C1TA 3DFJA 4GSOA 1E37B 2PWXA 2BD9A 2WPHS 3SQHE 1QHRB 1ELTA 2BXTH 3ZVFA 1DSUA 1GBFA 2FI3E 1GBMA 2TPIZ 3SUGA 1C2GA 3PV2A 1TQ7B 5CMXH 1AQ7A 5FCKA 1UTMA 2P94A 1O3HA 1YLDA 4GPGA 1EPTB 1SGYE 3SQEE 3M35A 1GI2A 2R0LA 3DT0H 2C4FH 4D7GA 3S0NA 1GCDA 3KL6A 3LOXA 4CR5A 5JBAS 2OTVA 2HGTH 2OBOA 7LPRA 4NA9H 1SQRA 1ELDE 4YT6H 1P11E 2V3MA 1C1QA 3GCHC 4OS5A 2BD8A 3A89A 5DN6D 4B6EA 4RKOB 2VWOA 3RU4E 3SBKA 5GCHG 4ZUHA 2P93A 3MU5A 5EXMA 5EQSA 3FZDA 3TGKE 2V7QD 3UPEA 4ZXYH 2OC1A 3RXLA 1O5DH 1O3LA 1Z6EA 1DT2A 4GHTA 1TYNA 2A31A 4HTCH 3H09A 1C5PA 1QRZA 1LVOA 2UUYA 4X2XA 4OS4A 1DE7H 4OM9A 5BRRE 3RXHA 2YMSB 3S7HB 5IDKA 3RXRA 5FHTA 1EQ9A 1GBCA 3H7TA 3TK9A 3SJIA 3MU4A 1MCVA 1SQTA 2VVCA 3R3GB 1IAUA 2BXUH 1BTYA 5BPEA 1FN6A 1TBRH 4NG9H 4NWLA 1GDQA 3EE0B 1BMAA 3PWBA 1C5SA 1NESE 5HIYA 1S82A 2F3CE 3D23A 4NIYA 3STJA 5JPMH 1ZSJA 3RC6A 3ITIA 1IHTH 5EU8A 2XNIA 4X1RU 1ORFA 1G3CA 3RC5A 4BANB 2A45B 2ZDVH 3TNSA 2CN0H 1Z71A 4IN2A 2BVRH 1O3PB 2BDAA 4BXWA 1GBLA 3A7TA 1A46H 8LPRA 1YYY1 1S85A 2XC4A 3TJNA 3GYMA 1PQ8A 8GCHG 3OY5U 2VIQA 1J17T 1KLTA 1EFRD 1GHBF 1SC8U 1OKXA 2G52A 1F0UA 5TJXA 3RM0H 3V3MA 2PLXA 2K8IA 2LPRA 3GY6A 1TBZH 1PQ7A 3V0XA 3L3TA 2W6ID 3A83A 1F0TA 1AUTC 4OS2A 2W6JD 2DUCA 3DUXH 1A7SA 1LQDB 1ELCA 4WXIA 4TWWA 1J14A 3AVZA 3MH4A 1AUJA 3PRBA 3T29A 1MD7A 5KECA 5EQQA 3SGBE 2F9BH 2GMTB 2BQ7B 3SU5A 1Y3YA 2KAIB 4CRCA 2A4GA 4ISLA 1VR1H 1EJMA 4U32A 2XNDD 5EJZA 2AEIH 1QBOA 5AF9H 1O2HA 3A86A 5A0BA 4FOUC 3TGIE 3ZVCA 3SNEA 3CENA 1GHZA 4P00A 1ABJH 2OXSA 1SGFG 2PFEA 1MZDA 1KXBA 4JZIA 5C0TA 1E38B 1F0RA 3SU1A 3BEIB 1GHAF 2PV9B 3D65E 3E16B 2BD4A 1GI0A 1GJ4H 3E1XB 4M9FA 4ASUD 3BTDE 1GG6B 1HB0B 1OHHD 3GCNA 3KEEA 4B6FA 5AHGH 3TH2H 2AMPA 1TB6H 2G81E 1C4V2 5T6GA 5E2OA 1UVPA 2BHGA 4TSFD 4CHAB 1GI7B 2D8WA 3P8NA 1MKWK 4U2WA 1B7XB 1BMFD 2KFWA 5GXPA 3RC4A 3V7TA 2O8TA 2HVYB 1O3OA 1XKBC 1O34A 4H4FA 2ZKSA 2WPDD 4Y79A 3F9HA 3UWJH 1UCYE 2JETC 2ZGCA 1WAYB 4KELA 4BAHB 1V3XA 1W8BH 2VNTA 4MPUA 7GCHG 1RTLA 3E6PH 1NC6A 4XOJA 4AFZA 1MAXA 3A7ZA 3SU6A 3BN9A 4F48B 5EPNA 1SFQB 3ZZ6A 1O3KA 2P16A 2Y80A 4AB9A 1BRAA 1UVTH 1V2WT 1O3CA 2ZHFH 2YNBA 1DXWA 2H9TH 1RTKA 4H6SB 4TPYA 3ZVAA 4I8KA 1THSH 1AWHB 2NU0E 1HNEE 1ZJKA 2Z94A 3PMJA 1FI8A 2AGGX 4K1SA 1CGJE 3NWUA 1A1RA 1GBBA 1K1MA 1O3JA 3TH3H 2XYAA 1KDQB 1VCWA 3A8CA 1H8HD 4A1XA 5DP8A 4CRGA 2ZFQH 3MH5A 5GDSH 2JH6D 1GJ5H 5EQRA 2Y5HA 1PYTC 1TONA 4X6NA 2PTNA 1H9IE 3PO1C 3NK8A 4NA8A 2V3OH 1H8DH 3AAVA 1GMCG 3OU0A 2FOAA 2SGQE 1G3DA 1TX7A 4FUJA 4DT4A 3A7YA 5GJ4B 8ESTE 3FOAA 1TNLA 1O0DH 1ZZZA 3Q76A 4X2YA 1GCTB 1NZQH 4ZXXH 5C20A 3UQVA 3S9AA 4CBNA 3M7TA 1O5CB 2CF8H 1K1PA 4OS1A 1YY3A 1DWBH 1C5XB 2KX4A 2J5UA 2F9PA 2WPJS 2WSSD 5JBBS 3FAOA 3LU9B 2KM0A 1EAUA 3PTBA 3ZIAD 1W0KD 2HALA 3Q3XA 2GTBA 4NCYA 2D26C 3A7XA 2FODA 1GI6A 2ZFRH 1S0QA 1MU8B 1FPCH 3TJUA 1UJ1A 2BLQA 3A88A 1O2KA 2SGAA 4RSPA 1P0SH 1XKAC 3VGCC 5EOKA 2ZEBA 4K1EA 3NUMA 3ODFA 1EJAA 3RXTA 2F9OA 2HLDD 2J9NA 2RA3A 1SBWA 1MTSA 3UB0A 4ABHA 1WQVH 1GBDA 2ZU5A 1S6LA 1L0ZA 3SOSA 3D49H 2GZ7A 1BB0B 4YESB 2VWLA 2BTCE 1TPSA 3W94A 1O30A 2L6OA 1FQ3A 1UCYH 2J4IA 4B75A 1O38A 1C5VA 1P09A 1GBIA 1C2IA 1XVMA 4MNXA 3E0NB 1BTPA 3OSYA 3PB1E 1MAYA 2Q6FA 4D76A 1RGQA 4FUIA 2XBXA 3P70B 2GCTC 1GBKA 1DUEA 3ATIA 4THNH 3BSQA 3D62A 3FVFB 3A80A 3GCHB 4WMDA 4QT8C 4D7FA 4KKDA 5DP9A 5F6MA 3GCOA 2RFKC 1RS0A 1C5NH 2R3YA 4B73A 1YPHC 1UCYK 3SHAH 4WY3A 1VZQH 4JK6A 4AFQA 1G32B 2GV6A 1P02A 1GHAG 1W0ZU 3EA8A 5EIYA 1OWHA 2D1JA 1CHGA 1CT2E 3GY3A 2PKAA 3VXFH 1IHSH 1O5GH 3GCTF 1G2LA 1W3CA 4ISHH 1K28D 3F1SB 1FY8E 1O35A 3Q00A 1V2OT 4RI0A 1KXFA 2G4TA 2FX6A 4X6PA 4I8JA 1HAVA 1C9TA 5LH8A 2W3IA 5E8EH 1Z8JB 1GGDC 1P2NA 3AASA 3P8OA 1IQHA 2C8WB 3ZVDA 1DY9A 1GI1A 2AERH 3BG4C 4ISNA 1PPZA 3DHKH 3PLPA 1ANBA 3RXUA 4CRDA 5JDUB 3OAAD 5KGOA 2I6QA 3MU1A 2ALPA 2QY0B 4NIXA 2ZG0H 2VIOA 5HIZA 1GI5A 1QURH 2BDHA 1TQ0B 2PUXB 1C1OA 2RA0A 4YTAA 1TMTH 1CSOE 2ZQ1A 4CH8B 1DLEA 2BZAA 3VXEH 1E35B 5DP3A 4AX9H 3S7KB 1Y5AT 3SO3A 1C2FA 4Y11E 2XBVA 1QNJA 1BA8B 1YGCH 2Z3CA 3H7OA 3NZIA 2H2ZA 2C93B 2EI7A 4WVPE 1AE5A 2F9NA 3M3TA 1TALA 3QLPH 3MQKC 5FPYA 4JYTA 1AO5A 2HLCA 2Q1JA 1EASA 1AFQC 4INHA 5C1YA 1O2VA 2PGBB 5HXFA 2XC0A 4Y7AA 1DVAH 1Z8GA 3UNSA 2Z7FE 4J2YB 2FM2A 1BMMH 1HDTH 2OQ5A 4MDSA 1FDPA 4U30A 1ZTJA 3A8BA 1GMHG 2FOCA 1IOEA 1DY8A 1ZHRA 2PHBA 2FIRH 1ARBA 1AGJA 1AKSB 4NIWA 3BEFB 3ZVEA 1BTXA 3F0OA 3WWBA 2BX3A 4IC6A 1F7ZA 3SORA 2A2XH 1MMJN 2GGVB 2VGCC 1W0YH 1EPTA 1MZAA 1O2RA 2A5KA 1RFNA 1GBEA 3PYHA 5PTPA 2BY8X 3FO8D 1O2IA 2EQNA 3M37A 4P02A 4DIIH 4X8TH 1FV9A 1V6DA 1O3NA 2ZFTA 2C8ZB 2QCYA 1Z1JA 1L2EA 4Y0ZE 4FU7A 3URCA 2FS8A 1NRPH 1VCQA 4E06H 2P3TB 4JK5A 3FN8A 5CHBA 1Z7KA 4ABDA 4I8HA 1O2JA 5ETXA 2AHME 1UTNA 3TK6A 3BTGE 2RDLA 2HPQH 4WH6A 5E0GA 2H5CA 4FUFA
chains in the Genus database with same CATH topology
1BRCE 3O8CA 1OS8A 1Y3WA 1BBRH 3UUZA 2FOFA 3SJKA 1HAYB 1C9PA 1TABE 1KTTB 1SGFA 1BHXF 1UTQA 4GCHG 3LGUA 1DUAA 2JETB 3TPIZ 1IQJA 1O2TA 1C1WH 1UK3A 2JKHA 3T28A 2HOBA 3T26A 5IYTA 4IMZA 3VFEA 1HJAC 1DITH 2A4RA 3GY7A 4O97A 1GVLA 2G5NA 3ZV8A 2BMGB 3BG8A 1TRNA 3EYDA 2PSXA 1XMNB 1D3QB 1B5GH 1DWCH 1NU9A 1E36B 4K1TA 2XC5A 1GDNA 5DJ7A 3KQDA 2VIDA 1BUIA 3UWIA 3RXFA 1B0EA 1LVMA 3UR6A 3MMGA 1P9UA 3QX5H 2GVFA 2W3KA 1GI9B 1EAIA 1NU7B 1XUJA 2F9UA 2WPLS 2ZDKA 1K1OA 1SHHB 1J9CH 1UHBB 2V3HH 1NFYA 4O9VA 1VGCC 3MOCA 1L4DA 1P2JA 3E8LA 2F83A 1MTWA 2H9HA 3BTFE 3ZZ8A 1O5BB 1JOUB 2ZHQH 3GCTG 3LONA 1ZGIA 1NFXA 3PO1B 3M7QA 4INLA 4X2VA 2G8TA 3IITA 1CHOG 1S6HA 2I6SA 1QJ6B 3VPKA 3MI4A 1YM0A 4JMYA 4ABJA 1W2KH 4AYYB 2Z9GA 5I46H 2Q6DA 4FU9A 1V2LT 1J15A 1BIOA 1O2LA 2PKSC 1SGNE 2KAIA 3UOPA 1BHXB 1QIXB 2IN2A 3UQOA 2VINA 1PPEE 1N1LA 1YPKH 1EP5A 1TNGA 1V2VT 1YCPM 1C2MA 7GCHF 1EZSC 2VIPA 2VVVA 1QL9A 1HAPH 1CT0E 3BTWE 3LT3A 1JRTA 1PFXC 2TBSA 4FUGA 4I32A 1JWTA 3FFGA 3PMBB 5HYOA 1MTUA 2EI8A 4IMQA 3VGCB 2GCHF 2ZI2H 4NZQA 5H4IB 1WQSA 2XXLA 1C2JA 1A5GH 2BVSH 4UFGH 1HCGA 1P06A 3QGJA 3BIUH 4A5TS 3GY2A 4ABAA 1G37A 1O31A 3OYPA 4A1VA 3TU7H 1ETTH 2OLGA 4ASHA 2R9PA 4GUXA 4CR9A 1GMCF 1BTZA 1LCYA 3SUEA 1O2PA 2GCTB 1OYTH 1ARCA 2ZDNA 4H6TA 2STAE 1K1NA 1V2RT 4M7GA 3HATH 2FP7B 4AORA 1NROH 4B71A 3TJVA 2QV1A 1QJ1B 2UWOA 2BX4A 1W13U 4Y10E 1RJXB 1IQKA 4K5ZA 5A8ZA 3RXQA 1C5LH 5FAHA 4MTBA 2J38A 3U1IB 4E05H 1P9SA 3BTKE 1YPEH 5FPSA 4XDEA 3FP6E 2VIVA 3K2UA 3SNCA 1ELEE 1GDUA 2XBYA 1WV7H 1KDQA 3S69A 3VB3A 1X7AC 3A85A 3LPRA 3KQBA 4KTSA 1DSTA 1GBJA 1J16A 1JBUH 3AW0A 1KLJH 1ZHMA 5A8XA 2STBE 3PLKA 1A2CH 2Z9KA 5HM9A 1GGDB 4INKA 2XWAA 5EG4A 4MLFB 1JXPA 5JBTA 2C8YB 3BG4B 4X2WA 2UUJB 1CA0C 1K1JA 1FAXA 3G01A 4JYUH 2ESTE 1GJDB 1D6RA 3RLWH 3UREA 4X1PU 4LZ1H 2VJ1A 2TGTA 2EEKA 4NSVA 5C1XA 1BZXE 1L1JA 4ZROA 2BLOA 1QTFA 1XUKA 1SI5H 2BDGA 2FYQA 2QXIA 2G55A 3NXPA 1IQMA 2RCEA 5CHAC 1FY4A 4KP0A 1OP0A 2C3SA 1LDTT 3FANA 2DE8A 1H9LB 4BNRA 4UEHH 2Z6BD 3E91A 1AFQB 1P05A 2TIOA 3RU4D 3EGKH 1N6XA 1WUNH 4FVDA 3M5NA 5LPFA 3SW2B 4CBOA 1QRWA 1OOKB 1DDJA 1TX8A 3LKWA 1P03A 3RXVA 2NU2E 2QXJA 1AY6H 4HFPB 4KGAA 1TBQH 1HAHH 9ESTA 3RXBA 4ABGA 4B2CA 2CJIA 1BDAA 3GICB 2ALVA 1QQ4A 1UTKA 1SSXA 1T4VH 3I78A 3UY9A 3AW1A 1DFPA 5C5NA 1C2EA 3A87A 1TGNA 1P3CA 3PMAB 1O32A 4X0WU 2H6MA 2Z3DA 1KXDA 2FI5E 2VGCB 3DD2H 2VVUA 1FLEE 2A5IA 1GJ9B 1UTPA 1ETRH 1FAKH 4LOYH 2G5VA 2W7UA 2O9QA 4A92A 3RMMH 1NN6A 1TRMA 4GAWA 1Z1IA 3BTTE 1IQNA 1L4ZA 2BY9X 2HVXA 3RXKA 1SLXB 2QXGA 4ISOA 1O5FH 3GOVB 1H1BA 3K65B 2R2MB 3SJOA 4UFFH 1NT1A 1LHGH 1LPKB 3SZNA 1HYLA 5DP6A 4GHQA 2WPKS 3VB7A 1V2MT 1AMHA 3W95A 3RUOA 5ESBA 1U6QA 4Q7XA 1QL7A 4WWYA 3VB5A 1LHDH 1TNJA 3TGJE 2GCHG 3LDXH 4ZKSU 2NU3E 1NRSH 3RXIA 1SPJA 2ASUB 2PGQB 1O3EA 3DFLA 2VU8E 1BMNH 5T6FA 3RXCA 1HXFH 1C1MA 4HI3A 1UTJA 1UK2A 1TPAE 4MPXA 1YCPH 4JZDH 4ZKOU 5F8XA 3P95A 1QA7A 1O5AB 1SOZA 4ZMAH 3T27A 4NA7A 4NWKA 1HJAB 1UVSH 3PWCA 5EGMA 1F0SA 1YKTA 2ZIQH 3SI4H 1ACBE 3BV9B 1SGTA 1WOFA 5F8TA 2H9EH 1GMHF 2BDIA 4R0IA 4X6OA 4NSYA 1CQQA 1O2GH 4FUHA 3HK3B 2V6NA 1QA0A 4X6MA 3KQCA 1ESBA 1BMLA 1ESAA 3A7VA 3U98H 4I8LA 4CRFA 1KLIH 1PQAA 2PR3A 3SU3A 3A8AA 4NGAH 3IG6B 4ESTE 2A0QB 1SG8B 2B9LA 4B76A 1UK4A 3ZZ4A 3E90B 4D8NA 1EOJA 2FOHA 4BAKB 1HRTH 1PPCE 4ZAEA 1HAOH 5EODA 1BTWA 3Q3KA 3QTVH 3LGTA 2QAAA 1VGCB 1Y3VA 2TGPZ 1JRSA 4UFDH 2AGEX 1A0JA 3TH4H 4JCNA 2BY7X 2EC9H 2OC7A 3OTJE 3EDXB 2WYJA 1EXFA 1T31A 4DURA 4IN1A 1ZMNA 3NCLA 2FESH 3JZ1B 1GJ7B 3QGNB 2XWBI 2WUCA 1AVWA 1F5KU 1C2LA 2R2WU 1DPOA 1FY1A 1HJ9A 1O3BA 4WJG2 4YT7H 5FBEA 1AKSA 1S0RA 3P8FA 1YLCA 4GCHF 2BYAX 4TY7A 1PJPA 2D2DA 2PKSB 5HM2A 2OD3B 3LC3A 3MHWU 3U9AH 3SV8A 1BRUP 2OQUA 3TLOA 4ABBA 3ZVBA 2BD3A 2GKVE 3L33A 4Y8XA 4ZKRU 1MTNC 2ZGXH 1GI4A 2Y7ZA 3ZZ9A 1G36A 3F6UH 3GY8A 3GDUA 1S83A 5LPRA 1DANH 3U8OH 3SGQE 2ZC9H 5AVDA 3CS0A 1SGEE 1YPHE 1ANCA 5L6NH 4JYVH 4Q2KA 1P8VC 2ZNKH 1SHYA 2Z9IA 1SQAA 1D3PB 2R3UA 2A32A 2PSYA 3B23B 2J92A 3ATWA 1UMAH 2GX4A 3P8GA 3R0FA 4J1YA 1AWFH 1VJ9U 1PYTD 4IW4E 3MNXA 4X8SH 4BAMB 1Z8RA 3KHVA 3RXSA 3T5FH 1O2SA 2ZHWH 1TMBH 1NFWA 3HGNA 5F8ZA 2ZCLP 1B0FA 1VITG 2ZTXA 1SFIA 2ZF0H 1FY5A 2ZECA 1BBRE 4OGYA 3VB4A 1QBNA 3ELAH 2NWNA 2CXVA 2EI6A 1CHOF 2OUAA 1TNKA 4K60A 1P2MA 2O8MA 2AS9A 5K7RA 1QRXA 2BD5A 1TAWA 3EQ0H 3HGPA 1CO7E 1Y5BT 3SHCH 3SN8A 2VWNA 4XFQA 5FCRA 1RD3B 4YOJA 2BQ6B 1LTOA 1GJAB 3F9EA 3SV9A 5C3NA 2B7DH 3SNAA 1DX5M 1VJAU 2FZZA 4MPWA 1EAXA 1NRNH 3ZZDA 4X1QU 2Q6GA 1RIWC 4FXGH 3UNRA 1AVGH 1WSSH 1NS3A 1ZOMA 1LKBA 1UHBA 2J34A 1LPZB 4XBCA 8KME2 3MWIU 4XBDA 1MD8A 2ZFSA 1GJBB 1RTFB 2WUBA 4OGXA 4DGJA 2XW9A 2QN5T 1O2XA 1A0HB 4JZ1A 4ZHLU 3TITA 1P04A 2QF3A 3ZZ3A 1SLWB 1W7XH 1ELAA 2XRCA 1BQYA 4AG1A 1XVOA 5GWZA 2GZ8A 3ZZBA 1CA0B 6ESTA 1AI8H 2TGAA 1WYKA 1YPGH 3RU4T 1QFKH 3B9FH 1TGBA 2Z9JA 1GJ8B 1DOJA 1ELBA 1CGIE 2ODYB 4RKJB 3Q3YA 4NFEA 4DT7B 1BJVA 3RP2A 1HXEH 1FIZA 1NM6A 1GBAA 2THFB 1IQEA 5CHAB 3I77A 5FX5A 4Y8ZA 3GDVA 2C90B 2F9VA 5J4SA 1HUTH 1G2MA 1G3EA 3OX7U 2Y6TA 2GD4B 3PROA 3CS7A 4XSKU 5TCAA 3P17H 3RMNH 2ZHEH 1HPGA 1LKAA 3RXEA 3VEQB 1C4U2 2B5TB 2ZHDA 1TMUH 2J94A 1J8AA 5LGOA 2CMYA 2Y5GA 5CE1A 2Z3EA 1CVWH 3LJJA 1AB9C 2GV7A 3LH3A 4PROA 3V12A 2ZGHA 3BTQE 2HNTC 4F49A 4MNVA 1GBHA 5DG6A 2Y7XA 4B1TA 1BOQA 1K9OE 3KQEA 1Q2WA 1C1SA 4RN6A 1TPOA 2QYIA 1EZXC 1TA2A 4D9QA 1FNIA 2O8UA 1MCTA 2ZDMA 3A7WA 1SGDE 3MTYA 5JB8S 1A61H 1SR5C 3ENSB 1T8LA 5C1UA 3ZVGA 2BDYA 2ODQA 4YOGA 2UWLA 1O2ZA 2G51A 1EOLA 4Z0KA 4SGAE 1AN1E 4ZHMU 3QN7A 4LZ4B 1ELFA 1Q31A 3F68H 2ZO3H 1BBRK 3PMHB 1EP6A 3RXPA 1XM1A 4KTCA 4XBBA 2A5AA 1ABIH 3KCGH 1QBVH 3SU0A 2BDBA 2OBQA 2IOTA 5JB9S 1V2ST 2ZPRA 2B0FA 2CV3A 1L1GA 2ZWLH 3RXOA 1A0LA 1BITA 3IWMA 1Y8TA 3QDZB 3T2NA 4AYVB 2IJOB 1UTOA 1AVXA 1DS2E 3BTEE 3U8TH 1S84A 4FUDA 4DJZB 4TWYA 2FOMB 1WCZA 4ZH8A 2OCVB 1DICA 7KMEH 1L1NA 4A7IB 2ANMH 1O3DA 1GBTA 1UTLM 1ELGA 2BLVA 2FEQH 3LGYA 4YO9A 1QB1A 3UR9A 2TRMA 2ILNA 1NO9H 1K1IA 1HIAB 4NIVA 2H1UA 2NU4E 2AIQA 1ANDA 1ZTLA 1AIXH 2BVXH 3RXMA 4AG2A 3U8RH 5EW1H 3QK1A 1O39A 2J95A 1O37A 1QCPA 4B2AA 2ZDAH 1INCA 4UE7H 1XXFA 9LPRA 1GL0E 1S5SA 3TVJB 3VB6A 2YOLA 3SUFA 1IQGA 2FLRH 3ZZ7A 1YPJH 1KSNA 2GDEH 2HPPH 1KY9A 5I25A 1MUEB 2P3FH 3LGWA 4WXVA 1EJNA 6GCHF 4LXBH 4AOQA 3K6ZA 3SJ8A 4CRAA 1TGCA 4GVUA 2HRVA 4DCDA 3SU2A 3QO6A 5HMAA 2PW8H 3P6ZB 4DG4A 1SOTA 2ZU4A 1HGTH 1MKXH 4AFSA 2JH0D 3M5OA 4DOQA 2WYGA 3K9XB 1GVKB 4DIHH 1MTNB 5DO4H 1FY3A 3MU0A 3KGPA 1TPPA 1W14U 2UWPA 2NU1E 3TNTA 1CGHA 5E2PA 1FN8A 3GY4A 3T62A 4TYDA 1VITH 2QXHA 2ZGJA 1THPB 3ZV9A 2M5TA 1C1PA 1P2OA 4AN7A 1WTGH 4I8GA 4ISIH 1MKXK 4O03A 4Y8YA 5FPTA 3ZYDA 1EKBB 4TPIZ 4CREA 1F5LA 1RRKA 3UOUA 5C5OA 2JH5D 1E0FD 1C5ZB 1FIWA 2BDCA 1OYQA 2FX4A 2GP9B 2P59A 1Y5UT 2ZPQA 1XX9A 4K69A 2V35A 4ZHAA 3SGAE 1W7GH 4AGKA 4Q80A 1GJ6A 1AE8H 2OC0A 2FXRA 5FX6A 2XCNA 1BCUH 4AFUA 4UDWH 3B8JA 1D3DB 4AB8A 1Z6JH 1MTVA 5HGGA 4U01A 1PQ5A 1GL1A 1AZZA 5A2MH 1ZHPA 1S6FA 1UVUH 3SNBA 1ID5H 1C5QA 1AHTH 2LNCA 2AIPA 4Z6AH 1OWIA 1DLKB 4BOHA 1KTSB 1GMDG 1SLVB 1PPFE 2WINI 2Z9LA 4VGCC 3KNXA 2ZA5A 5DP5A 1CE5A 3BIVH 1ZR0A 3SUDA 1TRYA 5E0JA 1EB2A 1F2SE 1K21H 2OC8A 1D4PB 2HNTF 3F9FA 1C4Y2 1T7CA 4K2YA 1GPZA 2FOGA 3L6PA 1RIWB 1OP8A 4MQAA 7ESTE 4B2BA 1TWXB 3MO3A 4MPVA 1A3EH 4UONA 1DM4B 4Q7ZA 4FUBA 5GIBA 1O2YA 2V0BA 2FO9A 2PTCE 1W11U 6LPRA 5AFYH 5A0CA 1T8OA 4MNWA 1UVOA 1AFEH 2XBWA 1SGRE 1SVPA 5T6DA 4E7RG 1ZPZA 2TGDA 2SNWA 3HKJB 4UD9H 1CA8B 1P10A 3TIUA 1BRBE 1ZYOA 1ZGVA 4WF8A 1O2MA 4X1NU 1HAIH 2A7CA 3ATMA 2A7JA 3FP7E 5A8YA 1MBQA 1P2KA 4O3UA 1NY22 1H9HE 1H8IH 1HAZB 1THRH 1D3TB 1VITF 2ZFPH 3RMLH 1RXPA 1XXDA 3UIRA 3PM3A 1MKWH 1PPBH 3M3VA 2C8XB 3PLBA 1GHWH 4YLQH 4YM9A 1V2TT 1EATA 1NRQH 2VWMA 2ZDLA 1O3MA 1TIOA 2YNAA 2XCFA 1H4WA 1Y3UA 2FTLE 3MNBA 2FWWA 1QGFA 2FDAA 2CF9H 4YOIA 3RMOH 4K8YA 2A2QH 1C2HA 3HK6B 4BTTB 6CHAC 3P92A 1GHVH 1DWEH 3A84A 1AB9B 1OWEA 4F4OC 3S9BA 1CBWC 2AMDA 3A81A 2ZGBH 1ESTA 2SGFE 3V13A 1O3FA 2ANYA 4BXSA 3M36A 3RXJA 2SGEE 2XTTB 1GWAA 2BY5X 2FOEA 5JBCS 1PPGE 1ZTKA 1A5HA