2FX4A

Bovine trypsin bound by 4-piperidinebutyrate to make acylenzyme complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trypsin
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx4A02
1TRNA 1O5BB 2BB4A 1OSSA 3UREA 1QJ1B 4I31A 2VIPA 2SGEE 1C9TA 5HM2A 1JRSA 1V2OT 4Y7AA 4I8KA 3PLKA 3PTBA 2UUJB 1TA2A 4D7GA 4JMYA 2VIQA 2VIOA 1P9UA 2G4TA 3LGWA 2VH0A 2NU1E 1AQ7A 3EE0B 4JYTA 8LPRA 2Y82A 1Z8IB 3ZVGA 2BHGA 3LGIA 1UVOA 2W7SA 3P8OA 1K2I1 4ABAA 2AMQA 3M5MA 4CBNA 2OTVA 3NCLA 1QA7A 1A46H 3RU4E 2GV7A 1K21H 1FMGA 1O5CB 3M36A 2BTCE 1A4WH 3QUMP 2BMGB 1RGQA 1C1WH 3SU4A 1H1BA 2C8XB 1Y3UA 6ESTA 4UONA 3P6ZB 3LGTA 3RXUA 1GI1A 4AB9A 2XC5A 2VIWA 5FBEA 4I8HA 1EQ9A 1SR5C 1QJ7B 1AB9B 4AYVB 4FU9A 3UQVA 3FP8E 4WH8A 1RJXB 1TYNA 4X1RU 5DP3A 1DY8A 1BBRH 2FESH 1EP6A 4Q7YA 4CRCA 1NFYA 5DJ7A 4JYVH 3RXQA 1PPGE 4ISLA 3HGNA 1O3BA 2NU0E 5T6FA 4AG1A 4AOQA 4FVBA 3U8TH 3ELAH 3QGNB 4RSPA 1OP8A 4I8LA 2VIDA 1O3AA 2FEQH 4K2YA 2WPLS 1IAUA 2Q6FA 2BLOA 2PGBB 1NS3A 3A7VA 2FODA 1BBRE 1CA0C 1WAYB 1YC0A 4UE7H 3ZZ6A 4IMQA 2B8OH 3SU3A 2FOAA 4H6TA 1BA8B 4ZHAA 1UCYH 3IITA 3A7ZA 3GCNA 1FPCH 4D9RA 8ESTE 1S6FA 1AVWA 1RXPA 1RTKA 1PPHE 3I78A 3GDVA 2V3HH 5A0BA 3CS7A 1ZHPA 1G2LA 3A86A 1W3CA 4U32A 1O3MA 2BD4A 2BVSH 2A4RA 1GG6C 3SUGA 1O3JA 3SJ8A 1HAIH 1PYTD 3SJKA 1T32A 1TNGA 1DFPA 1BRCE 2AGIX 1Y3XA 2OBQA 2ZDMA 3GY8A 4Z0KA 2PLXA 3M5OA 3QGJA 3EA7A 1BUIA 2FS8A 3MFJA 1TBQH 3A8CA 4MPUA 4Q7ZA 2PSXA 2OLGA 4MLFB 1N1LA 1TPAE 2W26A 1BQYA 2IN2A 2XXLA 2G4UA 3MH4A 2VWOA 4ZKSU 2FOGA 1SGEE 4BXWA 2Z3EA 3VB4A 1ACBE 1EP5A 4ISIH 1O33A 4ZUHA 1F5LA 4INKA 1SHHB 3MTYA 2ZDAH 1A5HA 1IQMA 5GXPA 1MCTA 4INHA 1BCUH 1S83A 3GCHB 1GI4A 2QXJA 2ZTYA 1SL3A 1K28D 6CHAC 5LGOA 2H9HA 3A8BA 3E91A 3TU7H 1YPMH 2ZPQA 4YZUA 1GMDF 2VGCC 1D4PB 3UWIA 2TPIZ 4BAQB 2D8WA 1OP0A 1XM1A 4B74A 3GOVB 1YPKH 6GCHF 4X8SH 1GI7B 3Q3YA 3ZZ8A 4CR9A 1O2NA 2CHAB 3U8OH 1O2SA 3MNBA 4ZMAH 4IGDA 1TLDA 4ABDA 2Y7ZA 3D62A 4HTCH 3PO1B 3OX7U 4NIVA 4UD9H 2P95A 1AO5A 2HLCA 2RA0A 3DUXH 2ZGHA 1GHBF 1DE7H 4Y76A 3LC5A 4NGAH 3NXPA 4ABIA 4X6MA 4UDWH 1HAGE 3QN7A 5FHTA 3Q77A 1EASA 2D26C 2GKVE 2J9NA 2AYWA 4WXVA 4AB8A 5CMXH 1DDJA 1MTNB 3KL6A 1P06A 3TLOA 1EAUA 4TY6A 3UQOA 1EAXA 3FANA 5CHAC 1IQGA 1LHEH 1VGCB 2AGEX 1O2LA 2PTNA 3BTQE 1AVXA 3RXRA 2GZ8A 1C5WB 4YOIA 2A2XH 2GMTB 1B7XB 2RG3A 5DK1A 1F7ZA 2BQ7B 2TGAA 1TPPA 1YPJH 3TH4H 3PV4A 1LVYA 1LHDH 2G55A 3A7XA 1QY6A 3MOCA 1O5FH 1F0UA 1ZTLA 1ELVA 5DGJA 3A8DA 1BTUA 4ZXYH 3HKJB 3S69A 3K9XB 4B2CA 3V0XA 3GYMA 1UK2A 2Y7XA 4ABJA 1KY9A 4UEHH 1KLJH 4GPGA 1KDQA 1GI2A 2BYAX 2C90B 3P17H 1TX7A 3TK6A 1ZJKA 3ZZ5A 5DP6A 1TPSA 1FJSA 2SGQE 1CHOF 2Y81A 4DT7B 1O3CA 1YBWA 1EOLA 1W14U 1HAVA 2Z94A 3ZZAA 1BMLA 1KTTB 1O3IA 1GVKB 5I46H 5JDUB 1O3HA 2P3FH 4AYYB 1DM4B 2CV3A 2A5KA 3Q00A 1C1SA 1C5PA 2ZFPH 2ZFSA 2ZHFH 4GAWA 4UFDH 2ZA5A 5FPTA 1GMDG 3RXOA 2H5DA 3E1XB 2ZCHP 2OC8A 4X1PU 1C2DA 4IN1A 1IQKA 1GPZA 1QTFA 6GCHG 2PW8H 1F92A 1BOQA 1N6XA 4OS5A 5J4SA 1QBVH 4K60A 1P8VC 3ODFA 4UFGH 2PUXB 4AFZA 3E3TA 2BLQA 3LDXH 1T8LA 3BTWE 4A92A 1N8OC 2ZQ2A 2QF3A 3UPEA 4J2YB 3M7UA 2PKSC 4TPIZ 1GHBG 3MNXA 5C1YA 1V2TT 1KXEA 2Q6GA 2ZGCA 1T8MA 2HWLB 1TALA 3OYPA 2ZU3A 5C1UA 4GCHF 3BEFB 4CH8B 2JH5D 1AKSB 5EXMA 1BRBE 4OS4A 3UIRA 1O2XA 2F9PA 1C2GA 1O2TA 3MU8A 1TNJA 1W12U 5C67A 2O9QA 2PTCE 4XFQA 1ANCA 3M5NA 1Z8GA 1F0SA 2NU4E 3T28A 3K2UA 1EX3A 1F5RA 1OXGA 2OINA 1AUTC 4JK5A 3BG4C 1O36A 1HRTH 1O3PB 2ESTE 2CF9H 4O97A 1YPLH 3N7OA 3KGPA 4FU8A 3ZZCA 4BAKB 1ZMLA 2RA3A 5A2MH 3G01A 4NCYA 3HK6B 4WMDA 1EUFA 4YM9A 4ZHMU 2A7HA 4YOJA 5HGGA 4ZH8A 2ZU5A 1IQIA 3ZVEA 2FLBH 2GCHF 1GGDB 1T8NA 2CF8H 2XW9A 2OXSA 1IQHA 1HV7A 2ZI2H 2V3OH 1V2JT 3P95A 4BXSA 1DWDH 1Y8TA 2PKAA 1GDQA 1TOCB 2P3TB 1MKWK 1CHOG 4Y8ZA 1GBCA 2BLWA 2CN0H 2ZEBA 1P01A 3T5FH 3VB5A 2H9EH 1YCPH 4XDEA 2F9NA 3UOUA 4CHAC 1BRUP 4Y79A 1OYQA 4NIYA 2BD5A 5PTPA 4R0IA 1AMHA 1TRYA 1GDUA 1Z8JB 3SUFA 3VEQB 3ZV9A 1AFQB 2GVFA 1NRPH 4ZKNU 1HAOH 1WV7H 3B8JA 4O03A 1U6QA 2DUCA 4ABBA 1BB0B 4I33A 3ZZDA 1RRKA 4VGCC 4LZ4B 1HJAC 2VWNA 3AAVA 2ZHWH 1QRXA 3P8GA 1ZPBA 1TPOA 1ANEA 1J9CH 1C5NH 5ESBA 2HGTH 1QL9A 2BZAA 1H8DH 2GZ9A 1Q31A 2FDAA 5IDKA 1CU1A 3RXDA 1NRRH 1YPGH 2H5CA 4X8VH 1Q3XA 1AN1E 1SLXB 1SSXA 2VVCA 2THFB 3K65B 1Y3VA 4MNWA 1ABJH 2XBWA 4GCHG 3V13A 1Y3YA 1C4Y2 3SV9A 4PROA 2J2UA 5A0AE 1NTPA 1ZMJA 4K8YA 1EPTA 1NFWA 3TK9A 2ZECA 2XNIA 1FN8A 1IHSH 1QIXB 4NWLA 4X0WU 1E36B 4CRBA 1HAYB 4NA9H 1RTLA 4MPWA 1CA8B 3NK8A 3SQEE 3Q76A 1Z1JA 2TGTA 2XRCA 3F1SB 1RFNA 1C2KA 4K5ZA 1ZHMA 1ZZZA 4RKOB 1XUJA 3VGCB 2FYQA 1NC6A 1XX9A 3MU4A 3U9AH 3VFEA 4SGAE 5EU8A 3UNQA 2STBE 6LPRA 2BZ6H 1MUEB 3LJJA 1HYLA 1F5KU 2GCHG 1CE5A 3SJOA 2ZDLA 5FAHA 3SNCA 1BBRK 1TRMA 1AHTH 4AFSA 4Y6DA 4B73A 1LQEA 1MU6B 4ZHLU 3PLPA 3A87A 1C5QA 4JZ1A 3UTUH 5L30H 4CRFA 1E38B 1S5SA 1O2MA 3U69H 1TIOA 1D3PB 1BMNH 2QY0B 3B23B 5HYOA 5E0HA 1CT2E 1QA0A 2HRVA 2BDBA 2H9TH 4X2XA 1WBGB 3MHWU 8KME2 1C9PA 1LHGH 3HGPA 2NU3E 4TWYA 3JZ1B 2ZC9H 2ZO3H 1AVGH 3KHVA 1PQ5A 3E6PH 2EEKA 3M5LA 1C2LA 5JB8S 3SI4H 3GY3A 4BTUB 2BD9A 3RXTA 1UTNA 1PFXC 1YKTA 5TJXA 1T31A 3TJOA 1V2PT 4CRAA 1IQEA 3VB7A 3RXGA 3GCTF 3IG6B 4A7IB 1FXYA 1P2JA 2ZHEH 2ZKSA 1P3CA 1SGFG 1L4DA 1GMCF 2STAE 1ZSLA 3BTHE 2O8TA 4Y0ZE 1O3OA 1UTMA 2RCEA 5SGAE 1NROH 3KEEA 4AZ2B 5DP7A 2HNTE 3TJUA 5H4IB 3S9CA 2B7DH 4X8UH 1ETSH 2G5NA 4LOYH 1TNIA 2JH0D 1SFIA 3PMJA 2FI3E 3ATKA 1ELCA 2GDEH 1V3XA 1A3BH 1XUKA 2AERH 1P02A 3TNSA 3L3TA 2FOFA 4I7YH 4YT7H 1V2QT 3SW2B 4KTCA 4DVAU 2KAIA 2XC4A 4D76A 2OBOA 3RM0H 2XBXA 2VVUA 1EZUC 5JYIA 1KXBA 2ZP0H 1GDNA 1AB9C 1P3EA 3DFLA 1P2NA 1E37B 2ANMH 4B75A 1RIWC 1QQUA 4TY7A 3D65E 2BX4A 3O8RA 3ATWA 1QNJA 3A85A 1LHCH 1SQOA 1GJ6A 3KN2A 3SHAH 2FOHA 1QHRB 1A3EH 4I8JA 4XSKU 3M3SA 1JBUH 2FZZA 1GBEA 2O8WA 2PHBA 3P8NA 1NO9H 3V12A 3ZVCA 2M5TA 1G36A 4X1NU 2TBSA 3MO3A 4M7GA 4YO9A 2G52A 4YLUA 2Y5GA 1YYY1 3RC6A 1UVPA 1FY8E 1DWCH 3E0PB 4B76A 4FXGH 2C8ZB 2ANKH 2C4FH 1L0ZA 1FAXA 1MAYA 1YP9A 2I6QA 1GMHF 1GJ8B 1TONA 3FP7E 1ESAA 2ANWA 1K9OE 1Q2WA 3FP6E 5EPNA 5LH8A 1BMMH 1LO6A 1K1NA 2WPHS 3A7YA 1WSSH 1OWJA 3BSQA 1TNHA 3QZQA 1QJ6B 3GCTG 3D23A 2FOCA 4CR5A 2C3SA 1ZSKA 4NIWA 5FCRA 1AUJA 1MQ5A 4A5TS 1GMCG 3SJ9A 1NU7B 2YNAA 3SI3H 3H5CB 4WY3A 1WTGH 5C2ZA 1DANH 3A82A 1EZXC 1DSUA 1FAKH 1GHZA 1BTYA 3OY5U 4X6OA 3RLWH 1J8AA 2AFQB 1MTSA 1BHXB 1UCYE 1W11U 2CJIA 3F6UH 4ZXXH 9ESTA 9LPRA 1KXAA 4AN7A 1DWEH 1FQ3A 3SU6A 5A0CA 4JZEH 3OTJE 3RXCA 3BTGE 1DT2A 2ZDVH 1XXDA 3SNDA 1MD8A 3SUEA 3MU1A 1LDTT 3D49H 4K1EA 1GHVH 1SGFA 1EB1H 3SGAE 4K69A 1A0LA 3O8CA 3LPRA 4U2WA 5JBTA 1IQLA 4FVDA 1EAIA 2BY9X 4H6SB 1H4WA 1WTHD 3P70B 1SGQE 2Z6BD 1GHWH 4F4OC 2VU8E 1ZGIA 2FX4A 5C5NA 5TCAA 1J14A 2DE9A 2PFEA 2FIRH 1V2VT 3R0FA 2O8LA 5EG4A 1C2FA 1CA0B 3FAOA 1TX6A 1UTLM 5FCKA 1V2UT 4KTSA 1FV9A 1HLTH 4TYDA 2ZDKA 5EW2H 1QBNA 2FTLE 2TIOA 2BD3A 3GICB 1SOTA 1Z1IA 1UTJA 3P92A 4MPXA 1HAXB 1ANBA 1L1GA 1LKAA 2ANYA 4B1TA 4MDSA 4OS1A 2VWLA 2J38A 2C8WB 1GG6B 2ZPRA 1OX1A 3STJA 2H2ZA 1QR3E 2ODYB 1Z6JH 3RXJA 1VCWA 3RMNH 4Y71A 1A7SA 3RM2H 1IQNA 2BX3A 3SU1A 5AF9H 3TPIZ 2J94A 3EA8A 1GBKA 2VINA 3EA9A 4MNYA 1YF4A 1C1PA 1XXFA 1V2MT 1M9UA 1HAHH 4E06H 4X1SU 1GMHG 3LH1A 5FXLA 5I25A 2WPIS 3ZVDA 1G32B 2CGAA 7ESTE 3ESTA 5L2ZH 3ZZ7A 2W5EA 1CGHA 2LPRA 4K1TA 3PLBA 1TBZH 1YLDA 5A09A 2JH6D 2QCYA 4JCNA 1K22H 3TIUA 1MQ6A 1O5EH 2P93A 2XWAA 3F9HA 4KTUA 2QYIA 8GCHF 2BOKA 1TAWA 5EPYA 4E7RG 3AVZA 4O3TA 1XUHA 1Y5UT 2G81E 1HAZB 3RXLA 1ELDE 6CHAB 1KXDA 2ZCKP 3MO9A 4O9VA 4WVPE 1H9HE 2VJ1A 2Z3DA 2VGCB 1K1JA 2QXGA 2GT7A 3CENA 2BD2A 2GDDA 5FX6A 4IW4E 2EI6A 3L33A 1EOJA 1J15A 1JOUB 3VXEH 3MH5A 3GDSA 2A0QB 4NFEA 1XVMA 3B9FH 3QZRA 1YCPK 1TGNA 3DFJA 3PM3A 3HATH 5JBCS 4AGKA 1DICA 1DWBH 1A61H 1D9IA 3RXSA 3EGKH 1ARCA 5LPEA 2GD4B 1O3EA 1SI5H 4DGJA 1FI8A 2OQ5A 2ZIQH 1B0FA 1EATA 2OD3B 2F9BH 5J4QA 1GI5A 1CHGA 1IQFA 1O2RA 1ELGA 4JK6A 1O2VA 4E05H 1RD3B 2XWBI 1DXWA 4IN2A 1ZGVA 1BRAA 5IYTA 1ZOMA 3A7WA 1K1IA 3LJOA 2Z9IA 5CHAB 1IHTH 1SLWB 5DP8A 3RP2A 1H9LB 1V2NT 2SGAA 1QB9A 3KQBA 4FU7A 1W7XH 1O2UA 1EPTC 2NWNA 1TA6A 1P9SA 2QV1A 2R2WU 2G8TA 1FY5A 1HIAA 4Y8XA 1WCZA 7GCHF 1HAPH 1MU8B 4CBOA 4MTBA 1SG8B 3SV7A 1TNKA 3MH7A 2BXTH 1LVBA 1S85A 4Y8YA 3ENSB 2ZU1A 3QWCH 2WYGA 1C5MD 3UR9A 1VJAU 4IS5A 3O8BA 1SGNE 1ZJDA 4FUDA 5T6DA 1THPB 2AEIH 1PPFE 3LIWA 1QFKH 4ABHA 1DY9A 5F8XA 2VB0A 3ZZ4A 4BTIB 2WINI 1W10U 2AS9A 1V2LT 1NY22 1LMWB 1O0DH 1C1TA 3U8RH 3HKIB 4I8GA 4MG3A 2OP9A 3UWJH 3MH6A 4X2YA 5FPYA 3QDZB 1ZRKA 3SN8A 4K1SA 2F9UA 3M35A 1C1QA 2FS9A 1IOEA 4Y0YE 2H1UA 8GCHG 5DP9A 1SLVB 4MVNA 5AVDA 1AWHB 3FFGA 2BOHB 1GGDC 4FUIA 4J1YA 1UVTH 3KCGH 2IOTA 3TH2H 4HI3A 1PPBH 2ZNKH 5LPFA 3GYLB 2C8YB 1XUIA 4X2VA 2QC2A 3H7TA 4AFQA 5EQSA 4AFUA 3LC3A 2PWXA 1T4UH 1W8BH 1L4ZA 1PYTC 3SGBE 2LNCA 1OS8A 3BTDE 1ZSJA 1HXEH 3BTEE 2DE8A 1C1VH 1JIMA 1G3DA 3RU4T 3BTTE 2ZTZA 1C1UH 1DOJA 1UJ1A 3KF2A 2UWPA 1ABIH 5BPEA 3OU0A 1Y59T 5DP5A 4AORA 3U1IB 1NU9A 2AIQA 1GBDA 2A1DB 3A7TA 1ZHRA 1DUEA 1N8OB 4QT8C 3V7TA 2PKSB 1O2PA 5K7RA 2CXVA 5E2PA 2JKHA 1AGJA 2BD8A 3LONA 1FLEE 1UTQA 1PJPA 2NU2E 4IBLH 3RXIA 3RU4D 1HB0B 1OPHB 1MH0A 1CBWC 1XMNB 3NPSA 1PQ7A 1VCPA 1JWTA 1UK4A 2Q6DA 4GHQA 1PPEE 1DXPA 1GJCB 3ITIA 1WU1A 1NPMA 1NM6A 3LGVA 1DUAA 1OYTH 3UOPA 1GI9B 3TK5A 1O3NA 3BG4B 4ZKRU 1C2HA 1KXFA 4THNH 1PPCE 1ZTKA 2GGVB 1W7GH 4ESTE 7GCHG 3S7HB 3A8AA 5C1XA 3MYWA 2RDLA 4AG2A 1KLIH 2P94A 3SORA 3MO6A 3QTOH 3SU2A 1C5VA 1GL1A 3M7TA 3SOSA 3RMOH 3A89A 3I77A 1S82A 1UMAH 1C2MA 2GCTB 1H8IH 4X6PA 2F3CE 4WXIA 4JZIA 3E8LA 3UFAA 4NIXA 1HPGA 2EI8A 3A80A 1FIWA 1BIOA 1DX5M 3GCOA 4SGBE 1AU8A 1LPKB 2FOMB 1SGYE 1TQ7B 3A88A 3QK1A 3VGCC 1FN6A 3EYDA 2SNVA 4CHAB 1SGTA 2OCVB 1XKAC 3GDUA 3ATMA 5E0JA 3RMMH 1FZZA 5HMAA 2BQ6B 1GI3A 1FIZA 1QRZA 1ESBA 1A0HB 3F9FA 1IQJA 3V3MA 1G2MA 1L2EA 3SJIA 1AKSA 1GWAA 3GY7A 1KTSB 3SNBA 1DPOA 5A8ZA 1C5LH 2ZFRH 4VGCB 1P2IA 2W3IA 1W2KH 1O38A 2ZWLH 3T25A 4IC6A 1WYKA 1O3DA 1P2OA 3DA9B 2C93B 1QURH 2P3UB 2UUYA 2R0LA 4XBDA 4NSYA 5TCCA 2F9VA 1LKBA 1TGSZ 3S0NA 1SGDE 3GY6A 1HJ9A 3GY2A 1OOKB 2P59A 3QX5H 2AIPA 5C5OA 3RXAA 1NFUA 1O30A 1Z71A 1O2GH 4TPYA 4GUXA 4DURA 1CSOE 1HJ8A 1QB1A 1RTFB 3PROA 1ZMNA 1UVSH 1LVMA 1VITF 3LGYA 2BY7X 2BLVA 3BIUH 2Z3CA 1SHYA 2AGGX 4Q7XA 5ABWA 2FLRH 1UCYK 2QN5T 2BDGA 1OWDA 1S84A 4A6LA 3SUDA 1P0SH 3RUOA 1Y5BT 3UUZA 3SZNA 1ETTH 3SGQE 2FOBA 3SO3A 1THRH 4NSVA 1NRSH 2A7CA 1TQ0B 4FUHA 2AH4X 2VIVA 2JETB 3T27A 3AASA 1TMTH 3PTNA 4CH2B 1JIRA 4NZLA 1MKWH 2FP7B 5ESTE 4A1VA 1C5OH 1GBBA 2GX4A 5JPMH 1D3QB 1BHXF 1OWKA 2V6NA 3OY6U 1ELAA 2G51A 1BJVA 1Z8RA 1UTKA 5FBIA 1A1RA 1QL8A 2WPJS 3PMAB 1D3TB 2QXIA 2SGFE 1F0RA 1ESTA 1UTPA 4XE4A 1E35B 1FONA 2P8OB 1BTPA 3MNCA 1K1MA 1V2RT 3BTFE 4JZDH 4TWWA 3SQHE 4D9QA 1ELBA 2PR3A 3LGUA 2EA3A 1NESE 2ULLA 2J92A 3UNSA 1GBHA 2BDHA 1GCDA 1LVOA 5T3HA 1OWIA 1UHBA 3STIA 2ALVA 5AFZH 2BVRH 1RS0A 1GBMA 1P2QA 2BY6X 1YPEH 3TGKE 1VITH 4Y11E 3ZZ3A 1BTWA 2Y80A 1P03A 1GHXH 2A7JA 3F9EA 1D3DB 1F2SE 1O37A 3NWUA 4OS2A 1BT7A 1TB6H 3JZ2B 1C2IA 2A4GA 1INCA 1A5GH 2OUAA 1MTUA 3AW0A 1VZQH 2QGRA 3LOXA 1C2EA 1GL0E 1GCTB 1BTXA 1O34A 2IJOB 1GVZA 3PMHB 4H42U 3PB1E 1O5AB 1VITG 2BY8X 2QXHA 4KELA 4OS6A 1QBOA 2W7UA 3SNAA 4FUCA 4CRDA 1GJ4H 1VR1H 1GJBB 4LK4A 5EW1H 1AZZA 1MZDA 1B5GH 1ZTJA 5GIBA 1C5SA 2CMYA 1TBRH 1GVLA 3LU9B 4XBBA 1C1RA 1BZXE 3WY8A 2W3KA 1OWEA 2FX6A 3DHKH 3U1JB 1QRWA 1J17T 1EKBB 4ASHA 2Y5FA 2PSYA 4IMZA 3SHCH 1CVWH 3ZZ9A 3BF6H 5LPRA 3T62A 1RIWB 4GHTA 3S7KB 1C4V2 5E0GA 5E8EH 1F0TA 2AMPA 4GVUA 1BMAA 1ELFA 1P12E 2FXRA 2UWLA 1C1OA 4U30A 1CGIE 3VXFH 3FVFB 4YT6H 1SC8U 2ZG0H 3PWCA 5GWZA 5DG6A 3MU0A 4RKJB 3MMGA 1HXFH 1OP2A 1YGCH 1EJNA 1O5GH 1ZRBA 1P2MA 4U01A 1MTWA 2XTTB 1MBMA 1L1NA 1ZR0A 3BTME 4NFFA 1PQAA 2BM2A 3GCHC 1MKXH 3RC5A 1TABE 3ZVFA 1GI0A 1C5ZB 4NZQA 2Z9KA 1O2IA 5C3NA 5FPSA 1ZYOA 1GJAB 2ZGXH 2XCFA 4ISNA 3FZDA 4BAMB 5A8XA 4NA8A 1EAWA 3BEIB 4JZFH 1KDQB 4WJG2 1FUJA 2D2DA 1HBTH 2VH6A 1SGCA 2YOLA 2CHAC 5DKMA 2R9PA 1ARBA 3T29A 2HVXA 3F9GA 3RXMA 4WH6A 1HAVB 3MU5A 3ATLA 4MNVA 4DG4A 1G3BA 3IWMA 1O39A 2HPQH 3PO1C 4GSOA 2QIQA 1S0QA 1FY1A 5F8TA 3DT0H 1DSTA 1LCYA 3RXPA 2GTBA 2ZQ1A 2IPHA 1AZ8A 1O3LA 2OC1A 3BEUA 1BITA 3A84A 4HZHA 1HIAB 3KQCA 1MTNC 1LQDB 3ZV8A 1EB2A 2TGPZ 1O2OA 1L1JA 5EODA 2BDYA 3NKKA 4YLQH 4X2WA 1YLCA 5EGMA 1VGCC 5T6GA 4K3JA 1C5RA 3ZYEA 2WV5A 1CT0E 3KQEA 2P16A 1EXFA 1AFEH 2G00A 1PPZA 3SV8A 1NFXA 3EAJA 1T7CA 3CP7A 2V35A 3PYHA 2GMTC 1O3GA 3RXHA 3TGJE 1VJ9U 3EQ0H 2R2MB 2VNTA 3ATIA 4BAOB 2Z9JA 1V2ST 1P09A 1MTVA 1SFQB 1S81A 1TX8A 1SBWA 2A31A 2QAAA 4LZ1H 3UY9A 4Q80A 4ABFA 4NG9H 4DIIH 3L6PA 1P11E 2OC0A 1SGRE 2ZGJA 1ZLRA 1HFDA 3BIVH 3E90B 3MWIU 4WMEA 2FI4E 1WOFA 4DJZB 5HXFA 2A5IA 2F83A 1K1PA 4B71A 1JXPA 2ODQA 1OWHA 5AFYH 1XVOA 4KP0A 3UR6A 1HDTH 1UVUH 1GBAA 2ZTXA 1GBLA 1QCPA 2ILNA 1NRNH 1O2ZA 1KXCA 4ZROA 2ZFQH 3NZIA 4DOQA 2ZU2A 1P2KA 5GJ4B 2ZHQH 1BTZA 1MZAA 3TNTA 3M37A 2SGPE 3ODDA 1GJDB 4IC5A 5F8ZA 3LKWA 3RXFA 4R8TB 1TE0A 1AIXH 4ZKOU 2PKAB 1BJUA 1W13U 4Y7BA 4INLA 1O2WA 1MBQA 4BOHA 3A83A 3S9AA 2GV6A 1ANDA 1V2KT 4WF8A 1AI8H 3TITA 3MI4A 1AE8H 1FY4A 4XOJA 4YOGA 2TGDA 1JMOH 1UTOA 4DCDA 1O5DH 7KMEH 1G3EA 1ORFA 1KLTA 3TGIE 1UK3A 2XC0A 4ABEA 2SGDE 1Y5AT 4D8NA 2OC7A 1FY3A 1MCVA 3W95A 4FUBA 2OQUA 3SBKA 5F03A 2HOBA 1LHFH 3T2NA 1GJ9B 1O2KA 5EXNA 1SGPE 2O8UA 2XCNA 3R3GB 2PUQH 4KKDA 4AGJA 2HPPH 5GDSH 3CS0A 5AHGH 1EJMA 1EJAA 1GHAF 4Z6AH 1ID5H 1P04A 2FMJA 1O2YA 2FO9A 3URDA 1G3CA 1O32A 3HK3B 2TRMA 1ZPCA 2BVXH 1VCQA 4FUJA 4MPVA 1DITH 1QQ4A 2BDCA 1K1LA 1MMJN 4ISOA 4LXBH 2A2QH 3K6YA 1O2QA 4ABGA 1QGFA 3ZZBA 2F9OA 2BDIA 2XBVA 1N6YA 1W0YH 4K8BA 1GBJA 3O8DA 1C5XB 2UUFB 1TGTA 1EPTB 4UFFH 1LPZB 1FDPA 2FTMA 5JBAS 1SB1H 4CRGA 1GI6A 1T4VH 3GY5A 3SV2H 4MQAA 3C27B 3PWBA 4JYUH 4NWKA 2GZ7A 1ELEE 2G5VA 4YTAA 1SGIB 2QA9E 1J16A 2ZU4A 1CQQA 2WV4A 4WMFA 1C1NA 2ZCLP 3KQDA 5DPAA 1SQTA 4HFPB 1V6DA 1AFQC 1EZSC 1AD8H 1KIGH 1WQVH 3QLPH 1O2HA 2ZF0H 3VPKA 3OSYA 1FNIA 4BAHB 1DS2E 4D7FA 1QB6A 1WUNH 1HGTH 2AMDA 2J95A 2EC9H 4F49A 5G4BA 1K1OA 2A4QA 2I6SA 1CO7E 1EZQA 1TNLA 2PGQB 1O2JA 5EOKA 3RXEA 5K0HA 4XBCA 2GCTC 3BN9A 1O31A 1S6HA 1GBIA 2A4OA 4X8TH 2BXUH 1XUGA 1G37A 1C5TA 3H7OA 3FZZA 2WUBA 4X1QU 5GCHF 4CREA 1UO6A 1HCGA 2A45B 5FX5A 2R3UA 4BTTB 1TWXB 1YPHC 4GLYA 1O35A 3AAUA 1G9IE 2Z9GA 4DY7B 3SU5A 3RXBA 1TFXA 2FWWA 3K6ZA 2GP9B 2B0FA 1GBTA 3C1KA 2B9LA 3NUMA 1WQSA 1GHYH 5CE1A 1GI8B 1DVAH 3T26A 1SOZA 3BG8A 1GHAG 2SNWA 4FUEA 1GJ5H 3URCA 1YPHE 5L2YH 5JBBS 2B5TB 4YESB 3VB3A 2PV9B 1NN6A 4NA7A 2VWMA 3TH3H 1JRTA 4Q2KA 4E7NA 4O3UA 1ETRH 1CBWB 5F6MA 3MNSA 1MD7A 5ETXA 2WUCA 3M3VA 3BTKE 1KSNA 3E16B 5EXLA 1B0EA 2ASUB 1TMBH 2ZZUH 1A2CH 3S9BA 3LH3A 2FM2A 2FOEA 1Y3WA 3SNEA 1KYNA 2O8MA 3U98H 5L6NH 3EDXB 1C4U2 3M61U 4OGXA 2EI7A 2ZPSA 2HNTF 4H4FA 3RXVA 1SPJA 1HJAB 3I29A 1W0ZU 1A0JA 1MAXA 1AY6H 2BY5X 4I32A 2BQWB 3M7QA 1FPHH 4KGAA 2D1JA 1UHBB 2QF0A 3GISB 3QTVH 1NZQH 3ZYDA 2KAIB 1T8OA 1LTOA 3TVJB 3E0NB 2WPKS 4RN6A 2Z9LA 3Q3KA 2UWOA 2HALA 1S0RA 2ZGBH 4HGCA 2ALPA 3ZVBA 5JB9S 2ZFFH 3P8FA 4A1XA 1D6RA 1P57B 1NT1A 1TGBA 1D6WA 1XKBC 1Z6EA 1SVPA 1QL7A 2K1QA 3HPTB 4ZAEA 5EQQA 4X6NA 2XBYA 2FYRA 1NRQH 1C5UA 2JETC 1ZPZA 2ZDNA 2XYAA 2FI5E 3W94A 4AX9H 1X7AC 5GCHG 5B6OA 4BNRA 1XUFA 3ZVAA 5E2OA 3TJVA 1AE5A 2V0BA 2FPZA 3AW1A 3TJNA 1AWFH 1SQAA 2A32A 1SMFE 3A81A 1TMUH 1V2WT 3KIDU 3RMLH 1HNEE 2A5AA 1C2JA 4Y10E 1A5IA 2GT8A 4B2BA 2ZFTA 5DP4A 2P8OC 1LPGB 2ZHDA 2SFAA 4B2AA 1O3KA 1C1MA 4OGYA 4FUFA 4UFEH 2ODPA 1OKXA 2Y5HA 4DIHH 1P10A 1MKXK 1Z7KA 3KNXA 5A8YA 1HUTH 4BANB 3UNRA 2WPMS 1DLKB 1TOMH 1PQ8A 3M3TA 3VB6A 4DW2U 1TGCA 4MNXA 3RLYH 4FUGA 4ISHH 2VVVA 1P05A 4A1TA 2HNTC 2J4IA 2R0KA 1C5YB 1GBFA 5HM9A 1GJ7B 1SLUB 2H6MA 2BD7A 3BV9B 1H9IE 1DLEA 5EQRA 2UUKB 7LPRA 3SU0A 1E0FD 1ELTA 3PMBB 2R3YA 4WWYA 3Q3XA 1O3FA 2J34A 1E34B 3DD2H 5C20A 5DO4H 1G30B 1YM0A 3QO6A 2Q1JA 1CT4E 2BDAA 5GPIB 1GCTC 3RDZA 1BDAA 1BTHH 1THSH 2YNBA 3F68H 2Y6TA 3GY4A 3LT3A 2Z7FE 3RC4A 1YCPM 1CGJE 5BRRE 2F91A 4OS7A 3SV6A 2WYJA 3RXKA
chains in the Genus database with same CATH superfamily
3UB0A 1TRNA 5GNDA 1O5BB 2BB4A 1OSSA 3UREA 1QJ1B 4I31A 2VIPA 2SGEE 1C9TA 1EFRD 5HM2A 1JRSA 1V2OT 1MABB 4Y7AA 4I8KA 3PLKA 3PTBA 2UUJB 1TA2A 4D7GA 4JMYA 2VIQA 2VIOA 1P9UA 2G4TA 3LGWA 2VH0A 2NU1E 1AQ7A 3EE0B 3GS9A 4JYTA 2Y82A 8LPRA 1Z8IB 3ZVGA 2BHGA 3LGIA 1UVOA 2W7SA 3P8OA 1K2I1 4ABAA 2AMQA 3M5MA 4CBNA 2OTVA 5EJLA 3NCLA 1QA7A 1A46H 3RU4E 2GV7A 1K21H 1FMGA 1O5CB 3M36A 2BTCE 1A4WH 3QUMP 2BMGB 1RGQA 1C1WH 3SU4A 1H1BA 2C8XB 3DSPA 5C0TA 1Y3UA 6ESTA 4UONA 3P6ZB 3LGTA 3RXUA 5C17A 1GI1A 4AB9A 2XC5A 2VIWA 5FBEA 4I8HA 1EQ9A 1SR5C 1QJ7B 1AB9B 4AYVB 4FU9A 3UQVA 3FP8E 4WH8A 1RJXB 1TYNA 4X1RU 5DP3A 1DY8A 1BBRH 2FESH 1EP6A 4Q7YA 4CRCA 1NFYA 5DJ7A 4JYVH 3RXQA 1PPGE 4ISLA 3HGNA 5EIYA 1O3BA 2NU0E 5T6FA 4AG1A 4AOQA 4FVBA 3U8TH 3ELAH 3QGNB 4RSPA 1OP8A 4I8LA 2L6OA 2VIDA 5EJZA 1O3AA 2FEQH 4K2YA 2WPLS 1IAUA 2Q6FA 2BLOA 2PGBB 1NS3A 3A7VA 2FODA 1BBRE 1CA0C 1WAYB 1YC0A 4UE7H 3ZZ6A 4IMQA 2B8OH 3SU3A 2FOAA 4H6TA 1BA8B 4ZHAA 1UCYH 1E1RD 3IITA 3A7ZA 3GCNA 1FPCH 4D9RA 8ESTE 1S6FA 1AVWA 1RXPA 1RTKA 1PPHE 3I78A 3GDVA 2V3HH 5A0BA 3CS7A 1ZHPA 1G2LA 3A86A 1W3CA 4U32A 1O3MA 2BD4A 2BVSH 2A4RA 1GG6C 3SUGA 1O3JA 3SJ8A 1HAIH 1PYTD 3SJKA 1T32A 1TNGA 1DFPA 1BRCE 2AGIX 1Y3XA 2OBQA 2ZDMA 3GY8A 4Z0KA 2PLXA 3M5OA 3QGJA 3EA7A 1BUIA 2FS8A 3MFJA 1TBQH 3A8CA 4MPUA 4Q7ZA 2PSXA 2OLGA 4MLFB 1N1LA 1TPAE 3KQ5A 2W26A 1BQYA 2IN2A 5F53A 2XXLA 2G4UA 3MH4A 2VWOA 4ZKSU 2FOGA 1SGEE 4BXWA 2Z3EA 5DSFA 3VB4A 1ACBE 1EP5A 4ISIH 1O33A 4ZUHA 1F5LA 4INKA 1SHHB 3MTYA 2ZDAH 1A5HA 1IQMA 5GXPA 4Q63A 1MCTA 4INHA 1BCUH 1S83A 3GCHB 1GI4A 2QXJA 2ZTYA 1SL3A 1K28D 6CHAC 5LGOA 2H9HA 3A8BA 3E91A 3TU7H 2WZQA 1YPMH 2ZPQA 4YZUA 1GMDF 2VGCC 1D4PB 3UWIA 2TPIZ 4BAQB 3KYGA 2D8WA 1OP0A 1XM1A 4B74A 3GOVB 1YPKH 6GCHF 4X8SH 1GI7B 3Q3YA 3ZZ8A 4CR9A 1O2NA 2CHAB 3U8OH 2K0QA 1O2SA 1UW7A 3MNBA 2HVYB 4ZMAH 4IGDA 1TLDA 4ABDA 2Y7ZA 3D62A 4HTCH 3PO1B 3OX7U 4NIVA 4UD9H 2P95A 1AO5A 2HLCA 2RA0A 3DUXH 2ZGHA 1GHBF 1DE7H 4Y76A 3LC5A 4NGAH 3NXPA 4ABIA 4X6MA 4UDWH 1HAGE 3QN7A 5FHTA 3Q77A 1EASA 2D26C 2GKVE 2J9NA 2AYWA 4WXVA 4AB8A 5CMXH 1DDJA 1MTNB 3KL6A 1P06A 3TLOA 1EAUA 4TY6A 3UQOA 1EAXA 4Z1MD 3FANA 5CHAC 1IQGA 1LHEH 1VGCB 2AGEX 1O2LA 2PTNA 3BTQE 1AVXA 3RXRA 5HIYA 2GZ8A 1C5WB 4YOIA 2A2XH 2GMTB 1B7XB 2RG3A 5DK1A 1F7ZA 2BQ7B 2TGAA 1TPPA 1YPJH 3TH4H 3PV4A 1LVYA 1LHDH 2G55A 3A7XA 1QY6A 3MOCA 1O5FH 1F0UA 1ZTLA 1ELVA 2KR7A 5DGJA 1FX0B 3A8DA 1BTUA 4ZXYH 3HKJB 3S69A 3K9XB 4B2CA 3V0XA 3GYMA 1UK2A 2Y7XA 4ABJA 1KY9A 4UEHH 1KLJH 4GPGA 1KDQA 1GI2A 2BYAX 2C90B 3P17H 1TX7A 3TK6A 1ZJKA 3ZZ5A 5DP6A 1TPSA 1FJSA 2SGQE 1CHOF 2Y81A 4DT7B 1O3CA 1YBWA 1EOLA 1W14U 1HAVA 2Z94A 3ZZAA 3AK5A 1BMLA 1KTTB 1O3IA 1GVKB 5I46H 5JDUB 1O3HA 2P3FH 4AYYB 1DM4B 2CV3A 2A5KA 3Q00A 1C1SA 1C5PA 2L74A 2ZFPH 2ZFSA 2ZHFH 4GAWA 4UFDH 2ZA5A 5FPTA 1E79D 1GMDG 3RXOA 2H5DA 3E1XB 2ZCHP 2OC8A 4X1PU 1C2DA 4IN1A 1IQKA 1GPZA 1QTFA 6GCHG 2PW8H 1F92A 1BOQA 1N6XA 4OS5A 5J4SA 1QBVH 4K60A 1P8VC 3ODFA 4UFGH 2PUXB 4AFZA 3E3TA 2BLQA 3LDXH 1T8LA 3BTWE 4I86A 4A92A 1N8OC 2ZQ2A 2QF3A 3UPEA 4J2YB 3M7UA 2PKSC 4TPIZ 1GHBG 3MNXA 5C1YA 1V2TT 1KXEA 2Q6GA 2ZGCA 1T8MA 2HWLB 1TALA 3OYPA 2ZU3A 5C1UA 4GCHF 3BEFB 4CH8B 2JH5D 1AKSB 5EXMA 1BRBE 4OS4A 3UIRA 1O2XA 2F9PA 1C2GA 1O2TA 3MU8A 1TNJA 1W12U 5C67A 2O9QA 2PTCE 4XFQA 1ANCA 3M5NA 1Z8GA 1F0SA 2NU4E 3T28A 3K2UA 1EX3A 1F5RA 1OXGA 2OINA 1AUTC 4JK5A 3BG4C 1O36A 1HRTH 1O3PB 2ESTE 2CF9H 4O97A 1YPLH 4TT3D 3N7OA 3KGPA 4FU8A 3ZZCA 4BAKB 1ZMLA 2RA3A 5A2MH 3G01A 4NCYA 3HK6B 4WMDA 1EUFA 4YM9A 4ZHMU 2A7HA 4YOJA 5HGGA 4ZH8A 2ZU5A 1IQIA 3ZVEA 2FLBH 2GCHF 1GGDB 1T8NA 2CF8H 2XW9A 1IQHA 1HV7A 2OXSA 2ZI2H 2V3OH 1V2JT 3P95A 4BXSA 1DWDH 1Y8TA 2PKAA 1GDQA 1TOCB 2P3TB 1MKWK 1CHOG 4Y8ZA 1GBCA 2BLWA 2CN0H 2ZEBA 1P01A 3T5FH 3VB5A 2H9EH 1YCPH 4XDEA 2F9NA 3UOUA 4CHAC 1BRUP 4Y79A 1OYQA 4NIYA 2BD5A 5PTPA 4R0IA 4ACAA 1AMHA 1TRYA 1GDUA 1Z8JB 3SUFA 3VEQB 3ZV9A 1AFQB 2GVFA 1NRPH 4ZKNU 1HAOH 1WV7H 3B8JA 4O03A 1U6QA 5EJ1A 2DUCA 4ABBA 1BB0B 3WW7A 4I33A 3ZZDA 1RRKA 4VGCC 4LZ4B 1HJAC 2VWNA 3AAVA 2ZHWH 1QRXA 3P8GA 1ZPBA 1TPOA 1ANEA 3PV2A 1J9CH 1C5NH 2KZ4A 5ESBA 2HGTH 1QL9A 2BZAA 1H8DH 3OE7D 2GZ9A 3ZIAD 1Q31A 2KM0A 2FDAA 5IDKA 5B6LA 1CU1A 3RXDA 1NRRH 1YPGH 2H5CA 4X8VH 1Q3XA 1AN1E 1SLXB 3UAIC 1SSXA 2VVCA 2THFB 3K65B 1Y3VA 4MNWA 1ABJH 2XBWA 5T1VA 4GCHG 3V13A 1Y3YA 1C4Y2 3SV9A 4PROA 2J2UA 5A0AE 1NTPA 1ZMJA 2W6ID 1EPTA 1NFWA 4K8YA 2ZECA 3TK9A 2XNIA 1FN8A 1IHSH 1QIXB 4NWLA 2QF5A 4X0WU 1E36B 4CRBA 1HAYB 4NA9H 1RTLA 4MPWA 1CA8B 3NK8A 3SQEE 3Q76A 1Z1JA 2TGTA 1YWUA 2XRCA 3F1SB 1RFNA 1C2KA 4K5ZA 1ZHMA 1ZZZA 4RKOB 1XUJA 3VGCB 2FYQA 1NC6A 1XX9A 3MU4A 3U9AH 3VFEA 4SGAE 5EU8A 3UNQA 2STBE 6LPRA 2OK5A 2BZ6H 1MUEB 3LJJA 1HYLA 3DSGA 3KYFA 1F5KU 2GCHG 2IJD1 1CE5A 3SJOA 2ZDLA 5FAHA 3SNCA 1BBRK 2KFWA 1TRMA 1AHTH 4AFSA 4Y6DA 4B73A 1LQEA 1MU6B 4ZHLU 3PLPA 3A87A 1C5QA 4JZ1A 3UTUH 5L30H 4CRFA 1E38B 1S5SA 1O2MA 3U69H 2EY4C 4B6EA 1TIOA 1D3PB 1BMNH 2QY0B 3B23B 5HYOA 5E0HA 2XNDD 1CT2E 1QA0A 2HRVA 2BDBA 2H9TH 4X2XA 1WBGB 3MHWU 8KME2 1C9PA 1LHGH 3HGPA 2KCAA 2NU3E 4TWYA 3JZ1B 2ZC9H 4XD7D 2ZO3H 1AVGH 3KHVA 1PQ5A 3E6PH 2EEKA 3M5LA 1C2LA 5JB8S 3SI4H 3GY3A 4BTUB 2BD9A 3RXTA 1UTNA 1PFXC 1YKTA 5TJXA 1T31A 3TJOA 1V2PT 4CRAA 1IQEA 3VB7A 3RXGA 3GCTF 3IG6B 4A7IB 1FXYA 1P2JA 2ZHEH 2ZKSA 1P3CA 1SGFG 1L4DA 1GMCF 2STAE 1ZSLA 3BTHE 2O8TA 4Y0ZE 1O3OA 1UTMA 2RCEA 5SGAE 1NROH 3F2GA 3KEEA 5DP7A 2HNTE 3TJUA 5H4IB 4AZ2B 3S9CA 2B7DH 4X8UH 1ETSH 2G5NA 4LOYH 1TNIA 2JH0D 1SFIA 3PMJA 2FI3E 3ATKA 1ELCA 2GDEH 1V3XA 1A3BH 1XUKA 2AERH 3PRDA 1P02A 3TNSA 4DT4A 3L3TA 2FOFA 4I7YH 4YT7H 1V2QT 3SW2B 4KTCA 4DVAU 2KAIA 2XC4A 4D76A 2OBOA 3RM0H 2XBXA 2VVUA 4B6FA 1EZUC 5JYIA 1KXBA 2ZP0H 1GDNA 1AB9C 1P3EA 3DFLA 1P2NA 2JJ2D 1E37B 2ANMH 4B75A 1RIWC 1QQUA 4TY7A 3D65E 2BX4A 3O8RA 3ATWA 1E1QD 1QNJA 2QE7D 3A85A 1LHCH 1SQOA 2LELA 1GJ6A 3KN2A 3SHAH 2FOHA 1QHRB 1A3EH 4I8JA 4XSKU 3M3SA 1JBUH 2FZZA 4M9FA 1GBEA 2O8WA 2PHBA 3P8NA 1NO9H 3V12A 3ZVCA 2M5TA 1G36A 4X1NU 2TBSA 1OHHD 3MO3A 4M7GA 4YO9A 2G52A 4YLUA 2Y5GA 1YYY1 3RC6A 1UVPA 5C0UA 1FY8E 1DWCH 3E0PB 4B76A 4FXGH 2C8ZB 2ANKH 2C4FH 1L0ZA 1FAXA 1MAYA 1YP9A 2I6QA 1GMHF 1GJ8B 1TONA 3FP7E 1ESAA 2ANWA 1K9OE 1Q2WA 2WPDD 3FP6E 5EPNA 5LH8A 1H8HD 1BMMH 1LO6A 1K1NA 2WPHS 3A7YA 3F3BA 1WSSH 1OWJA 3BSQA 1TNHA 3QZQA 1QJ6B 3GCTG 3D23A 1YLNA 2FOCA 4CR5A 2C3SA 1ZSKA 4NIWA 5FCRA 1AUJA 1MQ5A 4A5TS 2M2AA 1GMCG 3SJ9A 1NU7B 2J98B 2YNAA 3SI3H 3H5CB 4WY3A 1WTGH 5C2ZA 1DANH 3A82A 1EZXC 1DSUA 1FAKH 1GHZA 1BTYA 3OY5U 4X6OA 3RLWH 1J8AA 2AFQB 1MTSA 1BHXB 1UCYE 1W11U 2CJIA 3F6UH 4ZXXH 9ESTA 9LPRA 1KXAA 4AN7A 1DWEH 1FQ3A 3SU6A 5A0CA 4JZEH 3OTJE 3RXCA 3BTGE 4ACBA 4YXWD 1DT2A 2ZDVH 1XXDA 3SNDA 1MD8A 3SUEA 3MU1A 1LDTT 3D49H 4K1EA 1GHVH 1SGFA 1EB1H 3SGAE 2KCPA 4K69A 1A0LA 2KCOA 3O8CA 3LPRA 4U2WA 5JBTA 1IQLA 4FVDA 1EAIA 2BY9X 4H6SB 2PP6A 1H4WA 1WTHD 3P70B 1SGQE 2Z6BD 1GHWH 3FOAA 4F4OC 2VU8E 1NBMD 1ZGIA 2FX4A 5C5NA 5TCAA 1J14A 2DE9A 2PFEA 2V7QD 2FIRH 1V2VT 3R0FA 2O8LA 5EG4A 1C2FA 1CA0B 5KGOA 3FAOA 1TX6A 1UTLM 5FCKA 1V2UT 4KTSA 1FV9A 1HLTH 4TYDA 2ZDKA 4OM9A 5EW2H 1QBNA 2FTLE 2TIOA 2BD3A 3GICB 1SOTA 1Z1IA 1UTJA 3P92A 4MPXA 1HAXB 2AHME 1SQRA 1ANBA 1L1GA 1LKAA 2ANYA 4B1TA 4MDSA 4OS1A 2VWLA 2J38A 2JJ1D 2C8WB 1GG6B 2ZPRA 1OX1A 3STJA 2H2ZA 1QR3E 1Z6JH 2ODYB 3RXJA 1VCWA 3RMNH 4Y71A 1A7SA 3RM2H 1IQNA 2BX3A 3SU1A 5AF9H 3TPIZ 2J94A 3EA8A 1GBKA 2VINA 3EA9A 4MNYA 1YF4A 1C1PA 1XXFA 1V2MT 1M9UA 1HAHH 4E06H 4X1SU 1GMHG 3LH1A 1W0JD 5FXLA 5I25A 2WPIS 3ZVDA 1G32B 2CGAA 7ESTE 3ESTA 3FN8A 5L2ZH 3ZZ7A 2W5EA 1CGHA 2LPRA 4K1TA 3PLBA 1TBZH 1YLDA 5A09A 2JH6D 2QCYA 4JCNA 1K22H 3TIUA 1MQ6A 1O5EH 2P93A 2XWAA 3F9HA 4KTUA 2QYIA 8GCHF 2BOKA 1TAWA 5EPYA 4E7RG 3AVZA 4O3TA 1XUHA 1Y5UT 2G81E 1HAZB 3RXLA 1ELDE 6CHAB 1KXDA 2ZCKP 3MO9A 4O9VA 4WVPE 1H9HE 2VJ1A 2Z3DA 2VGCB 1K1JA 2QXGA 2GT7A 3CENA 2BD2A 2GDDA 5FX6A 4IW4E 2EI6A 3L33A 1EOJA 2J5UA 1J15A 1JOUB 3VXEH 3MH5A 3GDSA 2A0QB 4NFEA 1XVMA 3B9FH 3QZRA 1YCPK 1TGNA 3DFJA 3PM3A 3HATH 5JBCS 4AGKA 1DICA 4RT1A 1DWBH 1A61H 1D9IA 3RXSA 3EGKH 1ARCA 5LPEA 2GD4B 1O3EA 1SI5H 4DGJA 1FI8A 2OQ5A 2ZIQH 1B0FA 1EATA 3N7DA 2OD3B 2F9BH 5J4QA 1GI5A 1CHGA 1IQFA 1O2RA 1ELGA 4JK6A 1O2VA 4E05H 1RD3B 2XWBI 1DXWA 4IN2A 1ZGVA 1BRAA 5IYTA 1ZOMA 3A7WA 1K1IA 3LJOA 2Z9IA 5CHAB 1IHTH 1SLWB 5DP8A 3RP2A 1H9LB 1V2NT 2SGAA 1QB9A 4FETA 5HIZA 3KQBA 4FU7A 1W7XH 1O2UA 1EPTC 2NWNA 1TA6A 1P9SA 2QF4A 2QV1A 2R2WU 2G8TA 1FY5A 1HIAA 3DCLA 4Y8XA 1WCZA 7GCHF 1HAPH 1MU8B 4CBOA 4MTBA 1SG8B 3SV7A 1TNKA 3MH7A 2BXTH 1LVBA 1S85A 4Y8YA 3ENSB 2ZU1A 3QWCH 3N7EA 2WYGA 1C5MD 3UR9A 1VJAU 4IS5A 3O8BA 1SGNE 1ZJDA 4FUDA 5T6DA 1THPB 2AEIH 1PPFE 3LIWA 1QFKH 4ABHA 1DY9A 3PRBA 5F8XA 2VB0A 3ZZ4A 4BTIB 2WINI 1W10U 2AS9A 1V2LT 1NY22 1LMWB 1O0DH 1C1TA 3U8RH 3HKIB 4I8GA 4MG3A 2OP9A 3UWJH 3MH6A 4X2YA 5FPYA 3QDZB 1ZRKA 3SN8A 4K1SA 2F9UA 3M35A 1C1QA 2FS9A 1IOEA 4Y0YE 2H1UA 8GCHG 5DP9A 1SLVB 4MVNA 5AVDA 1AWHB 3FFGA 2BOHB 1GGDC 4FUIA 4J1YA 1UVTH 3KCGH 2IOTA 3TH2H 4HI3A 1PPBH 2ZNKH 5LPFA 3GYLB 2C8YB 1XUIA 4X2VA 2QC2A 3H7TA 4AFQA 5EQSA 4AFUA 3LC3A 2PWXA 1T4UH 1W8BH 1L4ZA 1PYTC 3SGBE 2LNCA 1OS8A 3BTDE 1ZSJA 1HXEH 3BTEE 2DE8A 1C1VH 1JIMA 1G3DA 3RU4T 3BTTE 2ZTZA 1C1UH 2RDEA 1DOJA 1UJ1A 3KF2A 2UWPA 1ABIH 5BPEA 3OU0A 1Y59T 5DP5A 4AORA 3U1IB 4HG6A 1NU9A 2AIQA 1GBDA 2A1DB 3A7TA 1ZHRA 1DUEA 1N8OB 4QT8C 3V7TA 2PKSB 1O2PA 5K7RA 2CXVA 5E2PA 2JKHA 1AGJA 2BD8A 3LONA 1FLEE 1UTQA 1PJPA 2NU2E 4IBLH 3RXIA 3RU4D 1HB0B 1OPHB 1MH0A 1CBWC 1XMNB 3NPSA 1PQ7A 1VCPA 1JWTA 1UK4A 2Q6DA 4GHQA 1PPEE 1DXPA 1GJCB 3ITIA 1WU1A 1NPMA 1NM6A 3LGVA 1DUAA 1OYTH 3UOPA 1GI9B 3TK5A 1O3NA 3BG4B 4ZKRU 1C2HA 1KXFA 4THNH 1PPCE 1ZTKA 2GGVB 1W7GH 4ESTE 7GCHG 3S7HB 3A8AA 5C1XA 3MYWA 2RDLA 4AG2A 1KLIH 2P94A 3SORA 3MO6A 3QTOH 3SU2A 1C5VA 1GL1A 3M7TA 3SOSA 3RMOH 3A89A 3I77A 1S82A 1UMAH 1C2MA 2GCTB 1H8IH 4X6PA 2F3CE 4WXIA 4JZIA 3E8LA 3UFAA 4NIXA 2YMSB 1HPGA 2EI8A 3A80A 1FIWA 1BIOA 1DX5M 3CNRA 3GCOA 4SGBE 1AU8A 1LPKB 2FOMB 3WWFA 1SGYE 1TQ7B 3A88A 3QK1A 2WV9A 3VGCC 1FN6A 3EYDA 2SNVA 4CHAB 1SGTA 2OCVB 1XKAC 3GDUA 3ATMA 5E0JA 3RMMH 1FZZA 5HMAA 2BQ6B 1GI3A 1FIZA 1QRZA 1ESBA 2VBCA 1A0HB 3F9FA 1IQJA 3V3MA 1G2MA 1L2EA 3SJIA 1AKSA 1GWAA 3GY7A 1KTSB 3SNBA 1DPOA 5A8ZA 1C5LH 2ZFRH 4VGCB 1P2IA 2W3IA 1W2KH 1O38A 5KEDA 2ZWLH 3T25A 4IC6A 1WYKA 1O3DA 1P2OA 1K0HA 3DA9B 2C93B 1QURH 2P3UB 2UUYA 2R0LA 4XBDA 4NSYA 5TCCA 2F9VA 3OTPA 1LKBA 1TGSZ 4AC9A 3S0NA 1SGDE 3GY6A 3DSOA 2XOKD 1VKYA 1HJ9A 3GY2A 1OOKB 2P59A 3QX5H 2AIPA 5C5OA 3RXAA 3F2HA 1NFUA 1O30A 1Z71A 1O2GH 4TPYA 4GUXA 3WWBA 4DURA 1CSOE 1HJ8A 1QB1A 1RTFB 3PROA 1ZMNA 1UVSH 1LVMA 1VITF 3LGYA 2BY7X 2BLVA 3BIUH 2Z3CA 1SHYA 2AGGX 4Q7XA 5ABWA 2FLRH 1UCYK 2LP6A 2QN5T 2BDGA 1OWDA 1S84A 4A6LA 3SUDA 1P0SH 3RUOA 1Y5BT 2J97A 3UUZA 3SZNA 1ETTH 3SGQE 2FOBA 3SO3A 1THRH 4NSVA 4ZCNA 1NRSH 2A7CA 1TQ0B 4FUHA 2AH4X 2VIVA 2JETB 3T27A 3AASA 1TMTH 2JDID 3PTNA 4CH2B 1JIRA 4NZLA 1MKWH 2FP7B 5ESTE 4A1VA 3PV5A 1C5OH 1GBBA 2GX4A 5JPMH 1D3QB 1BHXF 1OWKA 2V6NA 3OY6U 1ELAA 2G51A 1BJVA 1Z8RA 1UTKA 5FBIA 5C94A 1A1RA 1QL8A 2WPJS 3PMAB 1D3TB 2QXIA 2SGFE 1F0RA 1ESTA 1UTPA 4XE4A 3MQKC 1E35B 1FONA 2P8OB 1BTPA 3MNCA 1K1MA 1V2RT 3BTFE 4JZDH 4TSFD 4TWWA 3SQHE 4D9QA 1ELBA 2PR3A 3LGUA 2EA3A 1NESE 2ULLA 2J92A 1COWD 3UNSA 1GBHA 2BDHA 1GCDA 3F0PA 1LVOA 5T3HA 1OWIA 1UHBA 3STIA 2ALVA 5AFZH 2BVRH 1RS0A 1GBMA 1P2QA 2BY6X 1YPEH 3TGKE 1VITH 4Y11E 3ZZ3A 1BTWA 2Y80A 1P03A 1GHXH 2A7JA 3F9EA 1D3DB 1F2SE 1O37A 3NWUA 4OS2A 1BT7A 1TB6H 3JZ2B 1C2IA 2A4GA 1INCA 1A5GH 2OUAA 1MTUA 3AW0A 1VZQH 2QGRA 3LOXA 1C2EA 1GL0E 1GCTB 1BTXA 1O34A 2IJOB 1GVZA 3PMHB 4H42U 3PB1E 1O5AB 1VITG 2BY8X 2QXHA 4KELA 4OS6A 1QBOA 2W7UA 3SNAA 4FUCA 4CRDA 1GJ4H 1VR1H 1GJBB 1WXRA 4LK4A 5EW1H 1AZZA 1MZDA 1B5GH 1ZTJA 5GIBA 1C5SA 2IPQX 2CMYA 1TBRH 1GVLA 3LU9B 4XBBA 1C1RA 1BZXE 3WY8A 2W3KA 1OWEA 2FX6A 3DHKH 3U1JB 1QRWA 1J17T 1EKBB 4ASHA 2Y5FA 2PSYA 4IMZA 3SHCH 1CVWH 3ZZ9A 3BF6H 5LPRA 3T62A 1RIWB 4GHTA 3S7KB 1C4V2 5E0GA 5E8EH 1F0TA 2AMPA 5CDFE 4GVUA 1BMAA 1ELFA 1P12E 2FXRA 2UWLA 1C1OA 4U30A 1CGIE 3VXFH 3FVFB 4YT6H 1SC8U 2ZG0H 3PWCA 5GWZA 5DG6A 3MU0A 4RKJB 3MMGA 1HXFH 1OP2A 1YGCH 1EJNA 1O5GH 2HLDD 1ZRBA 1P2MA 4U01A 2RFKC 1MTWA 2XTTB 1MBMA 1L1NA 1ZR0A 3BTME 4NFFA 1PQAA 2BM2A 3GCHC 1MKXH 3RC5A 1TABE 3ZVFA 1GI0A 1C5ZB 4NZQA 2Z9KA 1O2IA 5C3NA 5FPSA 1ZYOA 1GJAB 2ZGXH 2XCFA 5IK2D 4ISNA 3FZDA 4BAMB 5A8XA 4NA8A 1EAWA 3BEIB 4JZFH 1KDQB 4WJG2 1FUJA 2D2DA 1HBTH 2VH6A 1SGCA 2YOLA 2CHAC 5DKMA 2R9PA 1ARBA 3T29A 4P02A 2HVXA 3F9GA 3RXMA 4WH6A 1HAVB 3MU5A 3ATLA 4MNVA 4XRNA 4DG4A 1G3BA 3IWMA 1O39A 2HPQH 3PO1C 4GSOA 2QIQA 1S0QA 1FY1A 5F8TA 2YMSD 3DT0H 1DSTA 1LCYA 3RXPA 2GTBA 3OEHD 2ZQ1A 2IPHA 1AZ8A 3F0OA 1O3LA 2OC1A 3BEUA 1BITA 3A84A 4HZHA 1HIAB 3KQCA 1MTNC 1LQDB 3ZV8A 2EQNA 1EB2A 2TGPZ 1O2OA 1L1JA 5EODA 2BDYA 3NKKA 4YLQH 4X2WA 1YLCA 5EGMA 1VGCC 5T6GA 4K3JA 1C5RA 3ZYEA 2WV5A 1CT0E 3KQEA 1BMFD 2P16A 1EXFA 1AFEH 2G00A 1PPZA 3SV8A 1NFXA 3EAJA 1T7CA 3CP7A 2V35A 3PYHA 2GMTC 1O3GA 3RXHA 3TGJE 1VJ9U 3EQ0H 2CK3D 2R2MB 2VNTA 3ATIA 4BAOB 2K8IA 2Z9JA 1V2ST 1P09A 1MTVA 1YY3A 1SFQB 1S81A 1TX8A 1SBWA 2A31A 4F55A 2QAAA 4LZ1H 3UY9A 4Q80A 4ABFA 4NG9H 4DIIH 3L6PA 1P11E 2OC0A 1SGRE 2ZGJA 1ZLRA 1HFDA 3BIVH 3E90B 3MWIU 4WMEA 2FI4E 1WOFA 4DJZB 5HXFA 2A5IA 2F83A 1K1PA 4B71A 1JXPA 2ODQA 1OWHA 5AFYH 1XVOA 4KP0A 3UR6A 1HDTH 1UVUH 1GBAA 2ZTXA 1GBLA 2J98A 1QCPA 2ILNA 1NRNH 1O2ZA 1KXCA 4ZROA 2ZFQH 3NZIA 4DOQA 2ZU2A 1P2KA 4ASUD 5GJ4B 2ZHQH 3FO8D 1BTZA 1MZAA 3OFND 3TNTA 3M37A 2SGPE 3ODDA 1GJDB 4IC5A 5F8ZA 3LKWA 3RXFA 4R8TB 1TE0A 1AIXH 4ZKOU 2PKAB 1BJUA 1W13U 4Y7BA 4INLA 1O2WA 1MBQA 4BOHA 3A83A 3S9AA 2GV6A 1ANDA 1V2KT 4WF8A 1AI8H 5CHBA 3TITA 3MI4A 1AE8H 1FY4A 4XOJA 4YOGA 2TGDA 1JMOH 1UTOA 4DCDA 1O5DH 7KMEH 1G3EA 1ORFA 1KLTA 3TGIE 1UK3A 2XC0A 4ABEA 2SGDE 1Y5AT 4D8NA 2OC7A 1FY3A 1MCVA 3W95A 4FUBA 2OQUA 3SBKA 5F03A 2HOBA 1LHFH 3T2NA 1GJ9B 1O2KA 5EXNA 1SGPE 2O8UA 2XCNA 3R3GB 2PUQH 4KKDA 4AGJA 2HPPH 5GDSH 3CS0A 5AHGH 1EJMA 1EJAA 1GHAF 4Z6AH 1ID5H 1P04A 2FMJA 1O2YA 2FO9A 3URDA 1G3CA 1O32A 3HK3B 2TRMA 1ZPCA 3SYJA 2BVXH 1VCQA 4FUJA 4MPVA 5FL7D 1DITH 1QQ4A 2BDCA 1K1LA 1MMJN 4ISOA 4LXBH 3H09A 2A2QH 3K6YA 1O2QA 4ABGA 1QGFA 3ZZBA 2F9OA 2BDIA 2XBVA 1N6YA 1W0YH 4K8BA 3VG8A 1GBJA 3O8DA 1C5XB 2UUFB 1TGTA 1EPTB 4UFFH 1LPZB 1FDPA 2FTMA 5JBAS 1SB1H 4CRGA 1GI6A 1T4VH 3GY5A 3SV2H 4MQAA 3C27B 1H8ED 3PWBA 4JYUH 4NWKA 2GZ7A 1ELEE 2G5VA 1S6LA 4YTAA 1SGIB 2QA9E 2GJGA 1J16A 2ZU4A 1CQQA 2WV4A 4WMFA 1C1NA 2ZCLP 3KQDA 5DPAA 3NRLA 1SQTA 4HFPB 1V6DA 1AFQC 1EZSC 1AD8H 1KIGH 1WQVH 3QLPH 1O2HA 2ZF0H 4Q4LA 3VPKA 3OSYA 1FNIA 4BAHB 1DS2E 4D7FA 1QB6A 1WUNH 1HGTH 2AMDA 2J95A 2EC9H 4F49A 5G4BA 1K1OA 2A4QA 1NBME 2I6SA 1CO7E 1EZQA 1TNLA 2PGQB 1O2JA 5EOKA 3RXEA 5K0HA 2F43B 4XBCA 2GCTC 3BN9A 1O31A 1S6HA 1WDIA 1GBIA 2A4OA 2YMSC 4X8TH 2BXUH 1XUGA 1G37A 1C5TA 3H7OA 3FZZA 2WUBA 4X1QU 5GCHF 4CREA 1UO6A 1HCGA 2A45B 5FX5A 2R3UA 4BTTB 1TWXB 1QZ8A 1YPHC 1O35A 4GLYA 3AAUA 1G9IE 2JIZD 2Z9GA 4DY7B 3SU5A 3OAAD 3RXBA 1TFXA 2FWWA 3K6ZA 2GP9B 1KMHB 1GBTA 2B0FA 3C1KA 2B9LA 3NUMA 3OEED 1WQSA 1GHYH 5CE1A 1GI8B 3W1EA 1DVAH 3T26A 1SOZA 3BG8A 3U28C 1GHAG 2SNWA 4FUEA 1GJ5H 3URCA 1YPHE 5L2YH 5JBBS 2B5TB 4YESB 3VB3A 2PV9B 1NN6A 4NA7A 2VWMA 3TH3H 1JRTA 4Q2KA 4E7NA 4O3UA 1ETRH 1CBWB 5F6MA 2F4LA 3MNSA 1MD7A 5ETXA 2WUCA 3M3VA 3BTKE 1KSNA 3E16B 5EXLA 1B0EA 2ASUB 1TMBH 2ZZUH 4RT0A 1A2CH 3S9BA 3LH3A 2FM2A 2FOEA 1Y3WA 3SNEA 1KYNA 2O8MA 3U98H 5L6NH 3EDXB 4RI0A 1C4U2 3M61U 4OGXA 2EI7A 2ZPSA 2HNTF 4H4FA 3RXVA 1SPJA 1HJAB 3I29A 5HKKD 1W0ZU 1A0JA 1MAXA 2WHXA 1AY6H 2BY5X 4I32A 2BQWB 3M7QA 1FPHH 4KGAA 2D1JA 1UHBB 2QF0A 3GISB 3QTVH 1NZQH 3ZYDA 2KAIB 1T8OA 1LTOA 2KCYA 3TVJB 3E0NB 2WPKS 4RN6A 2Z9LA 3Q3KA 2UWOA 2HALA 1S0RA 2ZGBH 4HGCA 5KECA 2ALPA 1W0KD 3ZVBA 5JB9S 2ZFFH 3P8FA 4A1XA 1D6RA 2V3MA 1P57B 1NT1A 1TGBA 1D6WA 1XKBC 4FOUC 1Z6EA 1SVPA 1QL7A 2K1QA 3HPTB 4ZAEA 5EQQA 4X6NA 2XBYA 2FYRA 1NRQH 1C5UA 3N99A 2JETC 5DN6D 1ZPZA 2ZDNA 2KX4A 2XYAA 2FI5E 3W94A 4AX9H 4P00A 1X7AC 5GCHG 5B6OA 4BNRA 1XUFA 3ZVAA 5E2OA 3TJVA 1AE5A 2V0BA 2FPZA 3AW1A 3TJNA 2W6JD 1AWFH 1SQAA 2A32A 1SMFE 3A81A 1TMUH 1V2WT 3KIDU 3RMLH 1HNEE 2A5AA 1C2JA 4Y10E 1A5IA 2GT8A 4B2BA 2ZFTA 5DP4A 2P8OC 1LPGB 2ZHDA 2SFAA 4F48B 4B2AA 1O3KA 1C1MA 4OGYA 4FUFA 3EE7A 4UFEH 2ODPA 1OKXA 2Y5HA 4DIHH 1P10A 1MKXK 1Z7KA 3KNXA 5A8YA 1HUTH 4BANB 3UNRA 2WPMS 1DLKB 1TOMH 1PQ8A 3M3TA 3VB6A 4DW2U 1TGCA 3SZEA 4MNXA 3RLYH 4FUGA 4ISHH 2VVVA 1P05A 4A1TA 2HNTC 3F2FA 2J4IA 2R0KA 1C5YB 1GBFA 5HM9A 1GJ7B 1SLUB 2H6MA 2BD7A 3BV9B 1H9IE 1DLEA 5EQRA 2UUKB 7LPRA 3SU0A 1E0FD 1ELTA 1SKYE 3PMBB 2R3YA 4WWYA 3Q3XA 1O3FA 2J34A 1E34B 3DD2H 5C20A 5DO4H 1G30B 1YM0A 3QO6A 2Q1JA 1CT4E 2WSSD 2BDAA 5GPIB 1GCTC 3RDZA 1BDAA 1BTHH 1THSH 2YNBA 3F68H 3FKSD 2Y6TA 3GY4A 3LT3A 2Z7FE 3RC4A 1YCPM 1CGJE 5BRRE 2F91A 4OS7A 3SV6A 2WYJA 3RXKA
chains in the Genus database with same CATH topology
1TRNA 1O5BB 2BB4A 1OSSA 3UREA 1QJ1B 4I31A 2VIPA 2SGEE 1C9TA 5HM2A 1JRSA 1V2OT 4Y7AA 4I8KA 3PLKA 3PTBA 2UUJB 1TA2A 4D7GA 4JMYA 2VIQA 2VIOA 1P9UA 2G4TA 3LGWA 2VH0A 2NU1E 1AQ7A 3EE0B 4JYTA 8LPRA 2Y82A 1Z8IB 3ZVGA 2BHGA 3LGIA 1UVOA 2W7SA 3P8OA 1K2I1 4ABAA 2AMQA 3M5MA 4CBNA 2OTVA 3NCLA 1QA7A 1A46H 3RU4E 2GV7A 1K21H 1FMGA 1O5CB 3M36A 2BTCE 1A4WH 3QUMP 2BMGB 1RGQA 1C1WH 3SU4A 1H1BA 2C8XB 1Y3UA 6ESTA 4UONA 3P6ZB 3LGTA 3RXUA 1GI1A 4AB9A 2XC5A 2VIWA 5FBEA 4I8HA 1EQ9A 1SR5C 1QJ7B 1AB9B 4AYVB 4FU9A 3UQVA 3FP8E 4WH8A 1RJXB 1TYNA 4X1RU 5DP3A 1DY8A 1BBRH 2FESH 1EP6A 4Q7YA 4CRCA 1NFYA 5DJ7A 4JYVH 3RXQA 1PPGE 4ISLA 3HGNA 1O3BA 2NU0E 5T6FA 4AG1A 4AOQA 4FVBA 3U8TH 3ELAH 3QGNB 4RSPA 1OP8A 4I8LA 2VIDA 1O3AA 2FEQH 4K2YA 2WPLS 1IAUA 2Q6FA 2BLOA 2PGBB 1NS3A 3A7VA 2FODA 1BBRE 1CA0C 1WAYB 1YC0A 4UE7H 3ZZ6A 4IMQA 2B8OH 3SU3A 2FOAA 4H6TA 1BA8B 4ZHAA 1UCYH 3IITA 3A7ZA 3GCNA 1FPCH 4D9RA 8ESTE 1S6FA 1AVWA 1RXPA 1RTKA 1PPHE 3I78A 3GDVA 2V3HH 5A0BA 3CS7A 1ZHPA 1G2LA 3A86A 1W3CA 4U32A 1O3MA 2BD4A 2BVSH 2A4RA 1GG6C 3SUGA 1O3JA 3SJ8A 1HAIH 1PYTD 3SJKA 1T32A 1TNGA 1DFPA 1BRCE 2AGIX 1Y3XA 2OBQA 2ZDMA 3GY8A 4Z0KA 2PLXA 3M5OA 3QGJA 3EA7A 1BUIA 2FS8A 3MFJA 1TBQH 3A8CA 4MPUA 4Q7ZA 2PSXA 2OLGA 4MLFB 1N1LA 1TPAE 2W26A 1BQYA 2IN2A 2XXLA 2G4UA 3MH4A 2VWOA 4ZKSU 2FOGA 1SGEE 4BXWA 2Z3EA 3VB4A 1ACBE 1EP5A 4ISIH 1O33A 4ZUHA 1F5LA 4INKA 1SHHB 3MTYA 2ZDAH 1A5HA 1IQMA 5GXPA 1MCTA 4INHA 1BCUH 1S83A 3GCHB 1GI4A 2QXJA 2ZTYA 1SL3A 1K28D 6CHAC 5LGOA 2H9HA 3A8BA 3E91A 3TU7H 1YPMH 2ZPQA 4YZUA 1GMDF 2VGCC 1D4PB 3UWIA 2TPIZ 4BAQB 2D8WA 1OP0A 1XM1A 4B74A 3GOVB 1YPKH 6GCHF 4X8SH 1GI7B 3Q3YA 3ZZ8A 4CR9A 1O2NA 2CHAB 3U8OH 1O2SA 3MNBA 4ZMAH 4IGDA 1TLDA 4ABDA 2Y7ZA 3D62A 4HTCH 3PO1B 3OX7U 4NIVA 4UD9H 2P95A 1AO5A 2HLCA 2RA0A 3DUXH 2ZGHA 1GHBF 1DE7H 4Y76A 3LC5A 4NGAH 3NXPA 4ABIA 4X6MA 4UDWH 1HAGE 3QN7A 5FHTA 3Q77A 1EASA 2D26C 2GKVE 2J9NA 2AYWA 4WXVA 4AB8A 5CMXH 1DDJA 1MTNB 3KL6A 1P06A 3TLOA 1EAUA 4TY6A 3UQOA 1EAXA 3FANA 5CHAC 1IQGA 1LHEH 1VGCB 2AGEX 1O2LA 2PTNA 3BTQE 1AVXA 3RXRA 2GZ8A 1C5WB 4YOIA 2A2XH 2GMTB 1B7XB 2RG3A 5DK1A 1F7ZA 2BQ7B 2TGAA 1TPPA 1YPJH 3TH4H 3PV4A 1LVYA 1LHDH 2G55A 3A7XA 1QY6A 3MOCA 1O5FH 1F0UA 1ZTLA 1ELVA 5DGJA 3A8DA 1BTUA 4ZXYH 3HKJB 3S69A 3K9XB 4B2CA 3V0XA 3GYMA 1UK2A 2Y7XA 4ABJA 1KY9A 4UEHH 1KLJH 4GPGA 1KDQA 1GI2A 2BYAX 2C90B 3P17H 1TX7A 3TK6A 1ZJKA 3ZZ5A 5DP6A 1TPSA 1FJSA 2SGQE 1CHOF 2Y81A 4DT7B 1O3CA 1YBWA 1EOLA 1W14U 1HAVA 2Z94A 3ZZAA 1BMLA 1KTTB 1O3IA 1GVKB 5I46H 5JDUB 1O3HA 2P3FH 4AYYB 1DM4B 2CV3A 2A5KA 3Q00A 1C1SA 1C5PA 2ZFPH 2ZFSA 2ZHFH 4GAWA 4UFDH 2ZA5A 5FPTA 1GMDG 3RXOA 2H5DA 3E1XB 2ZCHP 2OC8A 4X1PU 1C2DA 4IN1A 1IQKA 1GPZA 1QTFA 6GCHG 2PW8H 1F92A 1BOQA 1N6XA 4OS5A 5J4SA 1QBVH 4K60A 1P8VC 3ODFA 4UFGH 2PUXB 4AFZA 3E3TA 2BLQA 3LDXH 1T8LA 3BTWE 4A92A 1N8OC 2ZQ2A 2QF3A 3UPEA 4J2YB 3M7UA 2PKSC 4TPIZ 1GHBG 3MNXA 5C1YA 1V2TT 1KXEA 2Q6GA 2ZGCA 1T8MA 2HWLB 1TALA 3OYPA 2ZU3A 5C1UA 4GCHF 3BEFB 4CH8B 2JH5D 1AKSB 5EXMA 1BRBE 4OS4A 3UIRA 1O2XA 2F9PA 1C2GA 1O2TA 3MU8A 1TNJA 1W12U 5C67A 2O9QA 2PTCE 4XFQA 1ANCA 3M5NA 1Z8GA 1F0SA 2NU4E 3T28A 3K2UA 1EX3A 1F5RA 1OXGA 2OINA 1AUTC 4JK5A 3BG4C 1O36A 1HRTH 1O3PB 2ESTE 2CF9H 4O97A 1YPLH 3N7OA 3KGPA 4FU8A 3ZZCA 4BAKB 1ZMLA 2RA3A 5A2MH 3G01A 4NCYA 3HK6B 4WMDA 1EUFA 4YM9A 4ZHMU 2A7HA 4YOJA 5HGGA 4ZH8A 2ZU5A 1IQIA 3ZVEA 2FLBH 2GCHF 1GGDB 1T8NA 2CF8H 2XW9A 2OXSA 1IQHA 1HV7A 2ZI2H 2V3OH 1V2JT 3P95A 4BXSA 1DWDH 1Y8TA 2PKAA 1GDQA 1TOCB 2P3TB 1MKWK 1CHOG 4Y8ZA 1GBCA 2BLWA 2CN0H 2ZEBA 1P01A 3T5FH 3VB5A 2H9EH 1YCPH 4XDEA 2F9NA 3UOUA 4CHAC 1BRUP 4Y79A 1OYQA 4NIYA 2BD5A 5PTPA 4R0IA 1AMHA 1TRYA 1GDUA 1Z8JB 3SUFA 3VEQB 3ZV9A 1AFQB 2GVFA 1NRPH 4ZKNU 1HAOH 1WV7H 3B8JA 4O03A 1U6QA 2DUCA 4ABBA 1BB0B 4I33A 3ZZDA 1RRKA 4VGCC 4LZ4B 1HJAC 2VWNA 3AAVA 2ZHWH 1QRXA 3P8GA 1ZPBA 1TPOA 1ANEA 1J9CH 1C5NH 5ESBA 2HGTH 1QL9A 2BZAA 1H8DH 2GZ9A 1Q31A 2FDAA 5IDKA 1CU1A 3RXDA 1NRRH 1YPGH 2H5CA 4X8VH 1Q3XA 1AN1E 1SLXB 1SSXA 2VVCA 2THFB 3K65B 1Y3VA 4MNWA 1ABJH 2XBWA 4GCHG 3V13A 1Y3YA 1C4Y2 3SV9A 4PROA 2J2UA 5A0AE 1NTPA 1ZMJA 4K8YA 1EPTA 1NFWA 3TK9A 2ZECA 2XNIA 1FN8A 1IHSH 1QIXB 4NWLA 4X0WU 1E36B 4CRBA 1HAYB 4NA9H 1RTLA 4MPWA 1CA8B 3NK8A 3SQEE 3Q76A 1Z1JA 2TGTA 2XRCA 3F1SB 1RFNA 1C2KA 4K5ZA 1ZHMA 1ZZZA 4RKOB 1XUJA 3VGCB 2FYQA 1NC6A 1XX9A 3MU4A 3U9AH 3VFEA 4SGAE 5EU8A 3UNQA 2STBE 6LPRA 2BZ6H 1MUEB 3LJJA 1HYLA 1F5KU 2GCHG 1CE5A 3SJOA 2ZDLA 5FAHA 3SNCA 1BBRK 1TRMA 1AHTH 4AFSA 4Y6DA 4B73A 1LQEA 1MU6B 4ZHLU 3PLPA 3A87A 1C5QA 4JZ1A 3UTUH 5L30H 4CRFA 1E38B 1S5SA 1O2MA 3U69H 1TIOA 1D3PB 1BMNH 2QY0B 3B23B 5HYOA 5E0HA 1CT2E 1QA0A 2HRVA 2BDBA 2H9TH 4X2XA 1WBGB 3MHWU 8KME2 1C9PA 1LHGH 3HGPA 2NU3E 4TWYA 3JZ1B 2ZC9H 2ZO3H 1AVGH 3KHVA 1PQ5A 3E6PH 2EEKA 3M5LA 1C2LA 5JB8S 3SI4H 3GY3A 4BTUB 2BD9A 3RXTA 1UTNA 1PFXC 1YKTA 5TJXA 1T31A 3TJOA 1V2PT 4CRAA 1IQEA 3VB7A 3RXGA 3GCTF 3IG6B 4A7IB 1FXYA 1P2JA 2ZHEH 2ZKSA 1P3CA 1SGFG 1L4DA 1GMCF 2STAE 1ZSLA 3BTHE 2O8TA 4Y0ZE 1O3OA 1UTMA 2RCEA 5SGAE 1NROH 3KEEA 4AZ2B 5DP7A 2HNTE 3TJUA 5H4IB 3S9CA 2B7DH 4X8UH 1ETSH 2G5NA 4LOYH 1TNIA 2JH0D 1SFIA 3PMJA 2FI3E 3ATKA 1ELCA 2GDEH 1V3XA 1A3BH 1XUKA 2AERH 1P02A 3TNSA 3L3TA 2FOFA 4I7YH 4YT7H 1V2QT 3SW2B 4KTCA 4DVAU 2KAIA 2XC4A 4D76A 2OBOA 3RM0H 2XBXA 2VVUA 1EZUC 5JYIA 1KXBA 2ZP0H 1GDNA 1AB9C 1P3EA 3DFLA 1P2NA 1E37B 2ANMH 4B75A 1RIWC 1QQUA 4TY7A 3D65E 2BX4A 3O8RA 3ATWA 1QNJA 3A85A 1LHCH 1SQOA 1GJ6A 3KN2A 3SHAH 2FOHA 1QHRB 1A3EH 4I8JA 4XSKU 3M3SA 1JBUH 2FZZA 1GBEA 2O8WA 2PHBA 3P8NA 1NO9H 3V12A 3ZVCA 2M5TA 1G36A 4X1NU 2TBSA 3MO3A 4M7GA 4YO9A 2G52A 4YLUA 2Y5GA 1YYY1 3RC6A 1UVPA 1FY8E 1DWCH 3E0PB 4B76A 4FXGH 2C8ZB 2ANKH 2C4FH 1L0ZA 1FAXA 1MAYA 1YP9A 2I6QA 1GMHF 1GJ8B 1TONA 3FP7E 1ESAA 2ANWA 1K9OE 1Q2WA 3FP6E 5EPNA 5LH8A 1BMMH 1LO6A 1K1NA 2WPHS 3A7YA 1WSSH 1OWJA 3BSQA 1TNHA 3QZQA 1QJ6B 3GCTG 3D23A 2FOCA 4CR5A 2C3SA 1ZSKA 4NIWA 5FCRA 1AUJA 1MQ5A 4A5TS 1GMCG 3SJ9A 1NU7B 2YNAA 3SI3H 3H5CB 4WY3A 1WTGH 5C2ZA 1DANH 3A82A 1EZXC 1DSUA 1FAKH 1GHZA 1BTYA 3OY5U 4X6OA 3RLWH 1J8AA 2AFQB 1MTSA 1BHXB 1UCYE 1W11U 2CJIA 3F6UH 4ZXXH 9ESTA 9LPRA 1KXAA 4AN7A 1DWEH 1FQ3A 3SU6A 5A0CA 4JZEH 3OTJE 3RXCA 3BTGE 1DT2A 2ZDVH 1XXDA 3SNDA 1MD8A 3SUEA 3MU1A 1LDTT 3D49H 4K1EA 1GHVH 1SGFA 1EB1H 3SGAE 4K69A 1A0LA 3O8CA 3LPRA 4U2WA 5JBTA 1IQLA 4FVDA 1EAIA 2BY9X 4H6SB 1H4WA 1WTHD 3P70B 1SGQE 2Z6BD 1GHWH 4F4OC 2VU8E 1ZGIA 2FX4A 5C5NA 5TCAA 1J14A 2DE9A 2PFEA 2FIRH 1V2VT 3R0FA 2O8LA 5EG4A 1C2FA 1CA0B 3FAOA 1TX6A 1UTLM 5FCKA 1V2UT 4KTSA 1FV9A 1HLTH 4TYDA 2ZDKA 5EW2H 1QBNA 2FTLE 2TIOA 2BD3A 3GICB 1SOTA 1Z1IA 1UTJA 3P92A 4MPXA 1HAXB 1ANBA 1L1GA 1LKAA 2ANYA 4B1TA 4MDSA 4OS1A 2VWLA 2J38A 2C8WB 1GG6B 2ZPRA 1OX1A 3STJA 2H2ZA 1QR3E 2ODYB 1Z6JH 3RXJA 1VCWA 3RMNH 4Y71A 1A7SA 3RM2H 1IQNA 2BX3A 3SU1A 5AF9H 3TPIZ 2J94A 3EA8A 1GBKA 2VINA 3EA9A 4MNYA 1YF4A 1C1PA 1XXFA 1V2MT 1M9UA 1HAHH 4E06H 4X1SU 1GMHG 3LH1A 5FXLA 5I25A 2WPIS 3ZVDA 1G32B 2CGAA 7ESTE 3ESTA 5L2ZH 3ZZ7A 2W5EA 1CGHA 2LPRA 4K1TA 3PLBA 1TBZH 1YLDA 5A09A 2JH6D 2QCYA 4JCNA 1K22H 3TIUA 1MQ6A 1O5EH 2P93A 2XWAA 3F9HA 4KTUA 2QYIA 8GCHF 2BOKA 1TAWA 5EPYA 4E7RG 3AVZA 4O3TA 1XUHA 1Y5UT 2G81E 1HAZB 3RXLA 1ELDE 6CHAB 1KXDA 2ZCKP 3MO9A 4O9VA 4WVPE 1H9HE 2VJ1A 2Z3DA 2VGCB 1K1JA 2QXGA 2GT7A 3CENA 2BD2A 2GDDA 5FX6A 4IW4E 2EI6A 3L33A 1EOJA 1J15A 1JOUB 3VXEH 3MH5A 3GDSA 2A0QB 4NFEA 1XVMA 3B9FH 3QZRA 1YCPK 1TGNA 3DFJA 3PM3A 3HATH 5JBCS 4AGKA 1DICA 1DWBH 1A61H 1D9IA 3RXSA 3EGKH 1ARCA 5LPEA 2GD4B 1O3EA 1SI5H 4DGJA 1FI8A 2OQ5A 2ZIQH 1B0FA 1EATA 2OD3B 2F9BH 5J4QA 1GI5A 1CHGA 1IQFA 1O2RA 1ELGA 4JK6A 1O2VA 4E05H 1RD3B 2XWBI 1DXWA 4IN2A 1ZGVA 1BRAA 5IYTA 1ZOMA 3A7WA 1K1IA 3LJOA 2Z9IA 5CHAB 1IHTH 1SLWB 5DP8A 3RP2A 1H9LB 1V2NT 2SGAA 1QB9A 3KQBA 4FU7A 1W7XH 1O2UA 1EPTC 2NWNA 1TA6A 1P9SA 2QV1A 2R2WU 2G8TA 1FY5A 1HIAA 4Y8XA 1WCZA 7GCHF 1HAPH 1MU8B 4CBOA 4MTBA 1SG8B 3SV7A 1TNKA 3MH7A 2BXTH 1LVBA 1S85A 4Y8YA 3ENSB 2ZU1A 3QWCH 2WYGA 1C5MD 3UR9A 1VJAU 4IS5A 3O8BA 1SGNE 1ZJDA 4FUDA 5T6DA