2FX6A

Bovine trypsin complexed with 2-aminobenzamidazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A02
1FJSA 4NIVA 2JH5D 4OS1A 2W3KA 1RTLA 2C8ZB 1G30B 1OPHB 3RXLA 1K1PA 1TQ7B 1WTGH 2XRCA 3M5NA 2P59A 2J92A 3LGUA 5FPYA 1LO6A 1QNJA 2ZIQH 2GZ7A 1C4V2 5GDSH 3KN2A 4D9RA 1NZQH 3MNSA 2NU1E 1UVOA 1S84A 3IWMA 3LOXA 2Z9LA 1E0FD 1MH0A 1V2RT 3V7TA 1O0DH 4GUXA 1FAXA 1MKWH 1V2OT 4H4FA 3SJ9A 3ZZ6A 3GOVB 1DWEH 1O5FH 3VFEA 3BEIB 4PROA 3LKWA 6CHAB 3HK6B 4NSYA 3BTHE 3H7OA 1VITG 2V3OH 4XOJA 3NCLA 3KQBA 1ELCA 4CRFA 4JZEH 1O2HA 1DWCH 1BTHH 5JBAS 3P17H 2A5AA 4YOGA 2A4GA 3RXQA 1Q3XA 1BTWA 1LPGB 3OTJE 3TGJE 4YZUA 1H9HE 2CJIA 4KGAA 3L3TA 4CHAB 1GHWH 4IW4E 5TCCA 3SU3A 5C20A 4CHAC 1OP2A 5B6OA 3QX5H 1ZOMA 2FXRA 1KY9A 1UHBA 1D3TB 2WPMS 3SJ8A 2W3IA 4NA8A 3A89A 1WBGB 4UFDH 4CR9A 3GCHB 3E8LA 1CT2E 2PKSC 1F5RA 1BIOA 1TNGA 3M7TA 2QCYA 4ZH8A 4CBNA 5LPRA 4NWKA 5DP5A 1TGBA 1WUNH 4MNWA 2HRVA 2OLGA 3OYPA 3BIUH 1AKSB 1BITA 3P8NA 1YC0A 5EOKA 2ZCHP 4X0WU 3ZZ7A 2QN5T 1CO7E 4WVPE 1MAYA 3RU4D 4I7YH 1CGHA 1O2IA 1CA0C 1CA0B 1NO9H 1CQQA 3GCTF 2XWAA 3VGCB 3VGCC 1JOUB 2OP9A 2R0LA 1DXWA 2FX4A 1PYTD 1ETSH 2A32A 3BTTE 4O3TA 1GBEA 2CN0H 1D6RA 4A92A 1QL9A 2HWLB 1W7GH 3NKKA 4NSVA 4CRGA 3MMGA 1GG6B 1GG6C 1S81A 4X1NU 5LH8A 3SU6A 5IYTA 1SGCA 1W0YH 3B8JA 3RLWH 2BDGA 4NFFA 2ANKH 4FXGH 4DT7B 1VGCB 1VGCC 2FZZA 1YPKH 3D65E 1LMWB 1GI6A 1SLWB 5E2OA 4JYVH 2B5TB 1EOJA 4GPGA 1WQVH 1A4WH 1TBQH 5EGMA 4ZHLU 1TNJA 2VWOA 1W7XH 2SGEE 3UNRA 3SJOA 2Y6TA 3ATKA 1YPEH 1GBFA 1GL0E 1N6XA 5C1UA 5JB9S 1N1LA 1T8LA 1CGIE 1O36A 1P0SH 8GCHF 4QT8C 5CE1A 1O5EH 2CF8H 3T29A 2BD5A 4IMQA 4AG1A 1SR5C 2O8MA 1O33A 1WYKA 2OBQA 3A88A 3ZZ4A 3M7QA 2BMGB 2ZU4A 1C5LH 1BJUA 4DVAU 4KTSA 1V2KT 3QZQA 4NIWA 2QXJA 1ZTLA 4WF8A 1ELDE 3MYWA 4INKA 3GY8A 2PV9B 2H1UA 3MHWU 1K2I1 2BOKA 2BXUH 1IHSH 1GMCF 1O3PB 1S6FA 2P3UB 4UONA 3A8CA 1D4PB 1HAIH 1XXFA 4UE7H 1W12U 3HATH 1T8MA 1IQGA 5A2MH 1NRSH 4ABBA 4Q80A 3TVJB 5HXFA 1BTZA 2W7SA 5TJXA 2BZ6H 1GHAF 1XKAC 4X1SU 4ISLA 1UVTH 2HPPH 1F5KU 2XWBI 4ESTE 3TPIZ 5C1YA 1Y3XA 4F49A 1T32A 1A0HB 1FY5A 1O2NA 1RTKA 3MWIU 3PYHA 2ZHQH 2HGTH 1F7ZA 1C2FA 2OC7A 5HM2A 2ZC9H 2ZNKH 1DT2A 1Y59T 2B8OH 3E0NB 1AMHA 1QRZA 1C5VA 1MUEB 2W26A 8GCHG 4K5ZA 4Q2KA 1QHRB 3MOCA 1A46H 1NROH 1H8DH 5JDUB 1ANDA 2BOHB 3MO9A 1P2MA 2GDEH 1H1BA 4CH2B 2DE9A 2GZ8A 1LKAA 3UTUH 1OP0A 1C2HA 4MPWA 2TGAA 4INLA 1Z71A 1G2MA 1GMCG 3AW0A 2V3HH 3LPRA 2A4OA 1BA8B 1HGTH 1TONA 4B73A 4D76A 2BDHA 1UTJA 2OCVB 1K1JA 1K1IA 1TOMH 2ZA5A 1NM6A 1ZTKA 1GHAG 3SQEE 5CMXH 1MQ6A 2FYQA 4FVDA 4Y8YA 2BQ6B 1EATA 2A31A 1GDQA 1NU7B 2EI6A 1ZSLA 1LVYA 4XDEA 1GI0A 2J2UA 3O8RA 2AYWA 1A1RA 1QJ7B 3BIVH 4IBLH 3W94A 2XTTB 3ESTA 2RG3A 2Y5HA 2ALPA 4X6NA 1AU8A 1XM1A 5A8YA 3ZVAA 3MU4A 2Z3EA 2FDAA 2VIQA 4X2VA 2PKAA 3TLOA 4FUIA 1OWEA 5EU8A 3MH7A 1KXBA 1O2RA 2XCNA 1QB1A 3Q3KA 3UREA 5DKMA 1Z8RA 2ODYB 1SFIA 1FPHH 4X6MA 2PW8H 3U9AH 1GMHF 2FLBH 2R3YA 1BMAA 2RCEA 1Z8JB 3OSYA 5EXNA 2CGAA 1EUFA 4O9VA 4Q7XA 1GJAB 1Z1JA 5T6DA 4B2AA 4RKOB 2C93B 1DLKB 1C1RA 3DUXH 2VGCB 2QXGA 3A7TA 5CHAB 5CHAC 1J16A 1UK3A 1VR1H 1YCPK 2ZU1A 1GJBB 3BEFB 5JBBS 1G3CA 3D62A 4LZ4B 1IQIA 1G37A 2Z9JA 3ATIA 4K60A 1LVOA 1ZGIA 4WJG2 4MNYA 1UCYH 1TGCA 1C1NA 1JXPA 2P95A 5K7RA 1MZDA 1P09A 3H7TA 4TPIZ 3GYLB 1KXEA 3KL6A 2B9LA 2UUFB 1E34B 2EI7A 1NPMA 3K65B 3K6YA 4KP0A 1NU9A 2AFQB 2AS9A 2BY6X 3M5MA 5AFZH 3NUMA 2O8WA 4AFSA 3RMOH 1VZQH 1IQLA 3RXCA 3F1SB 1QL8A 4CRAA 2QY0B 4ZKRU 3TK5A 1K1LA 4A1XA 1TMBH 4MPVA 2A7CA 2FOFA 4BNRA 1EZXC 4MDSA 1XUIA 1ZRKA 3A83A 1FPCH 3SV8A 4BANB 1DWBH 2JETB 2JETC 1ETRH 2P3TB 3BSQA 2C4FH 1GL1A 3SJIA 3B9FH 4HZHA 2PSXA 1HCGA 4AN7A 2OINA 1SGFA 1ABIH 1LHCH 3RXOA 1TPOA 3UWIA 4CRDA 3ELAH 3S9CA 3E16B 1GBKA 4MLFB 5TCAA 1IQJA 2XNIA 1KTTB 1ZRBA 1O2MA 3ZZ9A 1TIOA 2EI8A 1VCQA 3SU0A 1DS2E 3K2UA 1DANH 2BD2A 1H9IE 2BHGA 3V0XA 1O37A 5FBIA 1TRYA 1YYY1 2IPHA 3GDUA 2PGBB 3JZ1B 2NU3E 5T6FA 2PHBA 1Y3VA 2P94A 4X2XA 2BVSH 7GCHF 3SNDA 3PO1C 3PO1B 1E36B 1AN1E 1O2VA 2BDYA 1HFDA 7LPRA 1BMNH 1GJ5H 1Z6JH 2FYRA 1ZSJA 1CHOG 2FOHA 1HDTH 2HNTF 1LPZB 1GBTA 2Y82A 4FU8A 2PTNA 1TNIA 1Z6EA 2F9VA 5T6GA 5A0CA 2ANWA 1QY6A 1TRNA 2BD7A 2K1QA 1KLTA 1ARCA 4AYVB 4BAQB 2V6NA 3ZVEA 4D9QA 2QAAA 2SGPE 4BTIB 1MKXK 1AWHB 2EA3A 5JYIA 2VJ1A 4GCHG 2QGRA 2XCFA 1HYLA 1PQ8A 3TITA 4LZ1H 1HB0B 2BDCA 1H4WA 2XBYA 1RGQA 1XVMA 4A5TS 4ABJA 1HAZB 2OBOA 2FMJA 1AFEH 1B5GH 2GT8A 1OKXA 2BVRH 1LVMA 3LGYA 3QN7A 3PM3A 4KELA 1O35A 1OXGA 1O3HA 4A1VA 3QO6A 1IQHA 1P02A 3A80A 4X1PU 4YM9A 3VPKA 2A7JA 2JH6D 1SGEE 1TABE 5DJ7A 5DGJA 3M61U 4DIIH 2O8TA 3VXFH 2HVXA 1C4Y2 2SFAA 3W95A 2CHAB 1ETTH 4GSOA 1C2KA 5GJ4B 3RM2H 2R3UA 2J34A 3ODDA 1ELVA 2UUKB 1GBHA 1P01A 2VIOA 1O39A 3EGKH 2STAE 1AO5A 1TB6H 3TJNA 1DXPA 1P9SA 4ZXXH 1B7XB 1BTPA 2Z3CA 4Q7ZA 5EPYA 2VNTA 3O8DA 4BTUB 1C5NH 2IJOB 2Z9IA 3MU5A 4NFEA 1UTKA 5AVDA 2RA0A 1DM4B 1DSUA 4DGJA 2NU2E 1AZ8A 1NRRH 1EJMA 1TAWA 2DE8A 2QV1A 4K2YA 2GCTB 1QB9A 1ANCA 3HKJB 4X6PA 1P12E 1HV7A 4FUJA 2FLRH 4FUHA 3BG8A 4A7IB 2Q6DA 3MU0A 2AEIH 1LVBA 2BLWA 1A0LA 1GI1A 1BMMH 1CHGA 3S7HB 3E0PB 1AD8H 1GHYH 1WSSH 1QJ6B 1AUJA 1VITF 2XYAA 1T31A 1BRAA 1CSOE 2G4UA 1M9UA 3KEEA 3H5CB 1BDAA 1YPJH 6GCHG 1PPFE 3LIWA 3ZZDA 1CA8B 2PKAB 2ZFPH 2GT7A 5AFYH 2G5NA 3NPSA 4FUBA 1MCTA 2BD3A 1DDJA 1GJ4H 4NG9H 1C5OH 2OQUA 3KIDU 5DP8A 2PUXB 1W3CA 3GCNA 3RUOA 2XC4A 2FI5E 1IQKA 1YLCA 4ZROA 2AMQA 4Y6DA 3M3SA 1VCWA 1HAYB 3VB3A 1BMLA 1C1TA 1SLUB 1NESE 1EXFA 2ESTE 3T28A 1S5SA 2SGQE 1LHDH 1O3MA 3GICB 3V13A 3V3MA 2BTCE 4X8SH 1KTSB 2A4QA 5EPNA 3A85A 1UTOA 5L30H 1V2MT 1GI3A 3TH4H 1C5TA 2BQWB 1C5ZB 3QZRA 3SBKA 5JB8S 1QR3E 2JH0D 6CHAC 1EOLA 5FCKA 1O2ZA 1O2TA 1O5CB 2F91A 1C5RA 1AVWA 4ISNA 2A5IA 1SGDE 2QXHA 3BV9B 3MH6A 5BRRE 1XUFA 3URCA 3ZVCA 3GY4A 2SGDE 1AE5A 1XKBC 4Z6AH 2AGEX 8ESTE 2AMDA 1FY8E 4M7GA 1ELEE 2WINI 2D1JA 2SNVA 1GBBA 1O3DA 2ZTYA 4AFQA 3QUMP 1EPTB 1QL7A 1YGCH 4SGBE 3GDSA 1QRXA 1T8NA 2BYAX 5J4QA 2H5DA 2HALA 1V2TT 1Y5BT 2GKVE 3GCHC 4UFEH 3M37A 1DUAA 1P2OA 2VIDA 1GHXH 4U30A 2P3FH 1QGFA 1TGSZ 1KDQB 3N7OA 2ZHDA 1TNLA 1EQ9A 4WH8A 3DA9B 2STBE 1BTXA 3SV9A 4UFGH 3F9FA 1W13U 1XUJA 5F8ZA 3FANA 5HYOA 6ESTA 1T7CA 1J17T 1CT0E 1U6QA 4E7RG 1PPZA 4R0IA 1QJ1B 1PYTC 3ODFA 1C5SA 1KXAA 1FN8A 3PROA 3FFGA 3I77A 2NU0E 2O8LA 5AHGH 3T25A 2FODA 4U01A 2UWPA 3STJA 3T26A 4HFPB 3TIUA 3F9GA 5FAHA 4GLYA 4DW2U 1ANEA 5L2ZH 3WY8A 1C5QA 1GBDA 1ZPBA 1C5WB 1C1OA 1O2XA 1BRCE 3RC4A 1OWIA 2VU8E 1GI8B 1VCPA 2FO9A 3EQ0H 4GHTA 4B74A 3UFAA 4A1TA 2FTMA 3G01A 3RC5A 3UNQA 1OSSA 3BF6H 1OWHA 2B0FA 3BTWE 4JZDH 1PQ5A 2VH0A 1RFNA 2VWMA 3SUDA 1P8VC 2F3CE 2GV7A 4BAKB 1O2QA 3TK9A 4ZMAH 1GPZA 1YCPM 4WWYA 5GIBA 2H9TH 2PR3A 1WCZA 3LU9B 2LNCA 3JZ2B 2VVUA 3RXMA 1NFYA 1IAUA 1D6WA 5HMAA 3SU1A 4GAWA 2FOGA 4CRBA 1IOEA 4TY7A 1TBRH 5FXLA 2HNTE 4UEHH 3ZV9A 3TJVA 4RN6A 4KKDA 2WYJA 4YT6H 1AFQB 1AFQC 1EB2A 3RU4E 3F68H 4I32A 2C8YB 1O3GA 2FOAA 1TE0A 3RXVA 1VJ9U 1A3BH 2PFEA 2VB0A 3Q76A 2ASUB 3FVFB 1V2LT 2UUJB 4HGCA 4ZKOU 5G4BA 1S85A 1FY1A 1C1MA 5A8ZA 4LXBH 2A2XH 1ANBA 1O3FA 3FP8E 4O3UA 4FUDA 3ZZ3A 2WUBA 1WAYB 1FAKH 1A61H 2BB4A 3FZZA 1AUTC 2D2DA 2OQ5A 4Y76A 3SO3A 8KME2 1L4DA 2RDLA 2AGGX 1LHFH 1O38A 3NZIA 4U32A 2ZZUH 5F6MA 1GWAA 3PMBB 1ESAA 1EB1H 1FIWA 4HTCH 1HJ9A 4RSPA 1XUKA 4ABAA 2P16A 3RP2A 1T4UH 4K8YA 1LQDB 2CXVA 4AX9H 1S83A 3SJKA 3RXBA 3L33A 3STIA 1GBAA 2O9QA 2FOBA 3DD2H 2BX3A 2ZHFH 1XUGA 2ZU5A 1MU8B 1TRMA 2BLOA 1QIXB 1C2DA 2ANYA 2BD9A 4X8TH 1TA6A 3DHKH 3RXTA 3QLPH 3UPEA 1C5XB 3SW2B 3CENA 2AH4X 2ZHWH 2IN2A 2VWLA 1D3DB 1FY3A 4SGAE 3SZNA 3O8CA 2FESH 3EDXB 3B23B 5F03A 1DY8A 1SGTA 1A7SA 4AFUA 1YF4A 1ESBA 4CH8B 3C1KA 1AI8H 3F9HA 4FUFA 1O3LA 3ZZ8A 5IDKA 1ARBA 1F0TA 1A0JA 1F92A 1YPGH 3OY5U 1GJ7B 2Y81A 1BB0B 1F5LA 1GI4A 4UD9H 3PB1E 1ZHPA 2FEQH 1C5YB 3NWUA 1SQTA 1YCPH 3VB5A 1OOKB 3MNXA 2F9NA 3LJOA 1BBRE 1FMGA 5DPAA 2ZGHA 1IQEA 3UOPA 1E37B 1D3PB 3DFLA 1RJXB 3RXAA 4CBOA 1G36A 3MTYA 1QB6A 3LGVA 1EJNA 2Q6FA 1XVOA 1PPBH 2Y7XA 5PTPA 1DVAH 2C8WB 5E0JA 1LDTT 3RXPA 3GY7A 1FV9A 1GHBG 1GHZA 4WXIA 1AY6H 2VGCC 5I25A 1PPEE 3CS0A 1YLDA 2ZG0H 5EODA 1ZR0A 1Z1IA 3PMJA 4Q7YA 1YP9A 3RXEA 1CBWB 5DG6A 1SGIB 1UK2A 3SGQE 2DUCA 3LC5A 1ZLRA 5EQQA 3BTGE 1O30A 1PPGE 2KAIB 2TRMA 4B71A 3M36A 1JMOH 1GDNA 2YNAA 5SGAE 3PWCA 1JWTA 1RS0A 2ZF0H 3TJUA 1V2JT 1GI7B 3S69A 3TNSA 3HKIB 5EXLA 1F0SA 3SNEA 1EZUC 1A5GH 4NWLA 4H6SB 4ABIA 2GMTB 1WQSA 4OS5A 3RXIA 3SOSA 4X8VH 1CHOF 4JZFH 2VVVA 3T2NA 2Z6BD 1HJAB 1HJAC 3EA8A 1EAWA 1VITH 1A5HA 2ZFRH 1KLIH 4IMZA 1GVZA 4Y71A 3Q00A 4K1EA 4H6TA 1P2QA 1O32A 1P03A 4NCYA 1O2GH 1O2JA 3UIRA 2V35A 2SGAA 1C9PA 4FUCA 2C8XB 3OX7U 1EPTA 3ZYEA 4MPUA 1AQ7A 1PFXC 5A0AE 1C2LA 1TX6A 4JK6A 4YESB 1O5BB 1H8IH 1HLTH 3M5LA 1FLEE 1KXCA 1O2OA 3T27A 3UWJH 2BD4A 4IGDA 3ZVDA 1ELFA 3EA9A 1K9OE 4ABGA 2THFB 3SQHE 1G3BA 1ORFA 3GY6A 5C3NA 3GDVA 1FQ3A 4GCHF 3KCGH 1KDQA 2SNWA 1XMNB 3LGIA 1QQUA 1IQFA 5C5OA 1DUEA 3HK3B 4E7NA 1O5AB 2A1DB 1O3IA 4B1TA 1B0FA 1BBRK 3GY2A 5C5NA 3AAVA 1MTSA 1HXEH 2G81E 1ABJH 3QTVH 1SOTA 5DP6A 2WYGA 2UWOA 4Y11E 4WMEA 2P93A 1CE5A 4K1SA 2D8WA 4UFFH 1V2QT 3MU1A 3VB6A 1PQ7A 1TA2A 5EG4A 2Q6GA 1GJ9B 1HAHH 1MKXH 1H9LB 2SGFE 4NIYA 4A6LA 2ZTXA 2GZ9A 5E2PA 5E0HA 3P95A 3KQCA 1YKTA 3ATWA 2VIPA 1Y5UT 3LC3A 5GCHF 3RC6A 4F4OC 4OS2A 2Z3DA 1F0UA 1SG8B 1UTPA 3DFJA 3PLKA 5ESBA 1YPLH 1G9IE 1O34A 1RD3B 1UTQA 1ZHRA 1SGYE 2AGIX 1NRQH 1GBJA 4TPYA 1O2KA 2HPQH 3UR6A 1BT7A 3GCOA 3SGBE 1TYNA 3LDXH 3UQVA 1J14A 1Z8IB 5L6NH 1SSXA 1ZTJA 1DOJA 5FCRA 3MU8A 4LOYH 2ZU3A 3I29A 2BDIA 2WPIS 1S0QA 3PMAB 4NGAH 1S6HA 4JMYA 1V2PT 4H42U 2VIVA 1GI9B 3QTOH 3SHCH 3OY6U 3S9BA 1TX8A 4B2BA 3RMMH 1G2LA 1PPCE 3P8GA 3PWBA 6GCHF 1JIRA 2FS8A 1FDPA 2ZGJA 3E90B 2BDAA 2IOTA 3TU7H 5F8XA 3BTKE 1HUTH 3TGIE 1RXPA 1THRH 1ZPCA 4NIXA 1FY4A 3LT3A 1J8AA 2ZU2A 1IHTH 2CHAC 3Q3YA 4IN1A 2BVXH 1C2EA 1EASA 1O3EA 1CU1A 1BHXB 1DWDH 3URDA 2G4TA 1L1NA 1WU1A 5GCHG 1UMAH 2XBXA 3SV7A 1C2MA 1Q31A 4DCDA 1MTWA 1DLEA 1GCDA 2J4IA 4Y7BA 3TH3H 3MH4A 2O8UA 1HAOH 1LCYA 2WPHS 1YBWA 1BUIA 1P2KA 1JBUH 1QQ4A 1W0ZU 2GCHG 4YLUA 3SUGA 3A7YA 3DT0H 5L2YH 1HAVA 3IG6B 1C4U2 2GCTC 3QK1A 3KNXA 4ZUHA 2VINA 3RXRA 4BTTB 1TBZH 4TYDA 1KYNA 4AYYB 3BTEE 2UUYA 2ZQ2A 2G55A 3BEUA 1AWFH 5C2ZA 1T4VH 4I8HA 1PJPA 1O2LA 1V2VT 4MTBA 1SB1H 3TJOA 2ZDMA 1O3JA 4ZHMU 3RLYH 2ODQA 1SL3A 4ZXYH 2ZGXH 1FNIA 2QYIA 3A86A 4K69A 4Y0YE 4MNVA 3SU5A 1TPSA 2GGVB 5I46H 3I78A 1YPHE 1LTOA 1O3BA 3SNBA 1GJ8B 1P2IA 4X8UH 3GYMA 1L1JA 1THSH 1ZSKA 1FI8A 2ZPQA 1MTNB 1OYQA 5ABWA 1A3EH 1G3DA 4B76A 2C3SA 4MG3A 2GDDA 5DO4H 1GBIA 2HOBA 4IN2A 1SQOA 4X6OA 2M5TA 1ELBA 2ZI2H 2PSYA 1GI5A 1MAXA 5HM9A 2AMPA 1XX9A 1P2JA 4X1QU 1ELTA 1O3OA 4ZKNU 4XBDA 1EKBB 1AVXA 1O5GH 1BTYA 1UTLM 2QF0A 1NRPH 1UTMA 1E38B 1GBCA 2ZWLH 4X2YA 2BY7X 1TLDA 2OUAA 4NA7A 4XBBA 5DP9A 1GBLA 1QBOA 3C27B 4VGCB 4VGCC 1LKBA 1BRBE 1G32B 4OGXA 3A7XA 1O2YA 2ZFFH 1GCTB 1GCTC 2BLVA 1TGNA 1DSTA 3ITIA 3PTBA 4MPXA 1QBNA 2BZAA 4FUGA 1K1MA 4KTCA 1C1SA 1NT1A 4K1TA 4XSKU 3SGAE 1Y3WA 3BTFE 4Y10E 4E06H 4FVBA 3L6PA 1N6YA 3P70B 4GVUA 1BOQA 3SNAA 2B7DH 2JKHA 4Y0ZE 1Y3UA 2CMYA 2WUCA 1BCUH 3QWCH 4YT7H 2XW9A 3UR9A 1Y8TA 1ZMNA 4ABEA 3UY9A 1HXFH 1EPTC 1Q2WA 4WMFA 4I33A 3SNCA 1SHYA 2H5CA 3P8FA 1TX7A 1AGJA 1J15A 3QGJA 4JCNA 2BX4A 1FIZA 1J9CH 2ZGBH 3A7WA 1SMFE 3ZVFA 2KAIA 2ZCLP 5E8EH 3FP7E 4DURA 4YO9A 3RXSA 2G51A 3LJJA 1W14U 2HNTC 2VVCA 2FOCA 3MFJA 2TGTA 1BZXE 1HNEE 2Z7FE 5EW2H 3BG4C 3BG4B 1C5PA 2FX6A 1ZGVA 2OC8A 1MKWK 5C67A 7KMEH 4YLQH 1HRTH 2A45B 1O31A 5FPSA 1P10A 3TNTA 2WPJS 1IQMA 1NY22 2FWWA 2WV5A 1LHGH 4YOIA 4I8JA 9ESTA 3T62A 1SGNE 2VWNA 2WPLS 1FN6A 3MO6A 5AF9H 5DP7A 1ZPZA 1AVGH 4DJZB 1C1UH 4NA9H 3U1IB 5J4SA 1P2NA 1P9UA 4BAMB 2PKSB 4FUEA 2F9UA 1QA0A 2OXSA 3U8TH 4NZLA 1DE7H 2NWNA 4X1RU 3OU0A 3UUZA 1AHTH 1L1GA 1EAUA 5H4IB 1MBQA 2OD3B 4AGKA 4FU7A 2BM2A 1BRUP 1O2WA 3KQEA 3RXGA 4RKJB 2PGQB 1GJCB 2G00A 3QDZB 1UTNA 2FTLE 2FS9A 1QTFA 1UO6A 2J95A 4JYTA 1UVUH 3U98H 3P6ZB 2QIQA 1MCVA 2BY8X 2H6MA 2ZDLA 2TBSA 3FZDA 1KXDA 3EAJA 4LK4A 2PTCE 1ZHMA 1ZYOA 2VH6A 1A2CH 3LONA 2ZDVH 3QGNB 3ATLA 1SGRE 1VJAU 1K22H 1O3AA 2CV3A 2PLXA 1TQ0B 3Q77A 1NC6A 2BDBA 3TGKE 1OP8A 2ZFSA 3P8OA 2CF9H 1P3CA 3AVZA 2FIRH 1IQNA 2QXIA 4JYUH 5EQRA 1C1WH 1TMTH 1O2UA 3F6UH 1W11U 4IS5A 4YTAA 3MNBA 1ZJKA 1SBWA 4ABFA 4AGJA 1INCA 5F8TA 1THPB 2PUQH 5DP4A 1DICA 2I6QA 1N8OB 1N8OC 3AASA 1HAGE 2ZDKA 3M35A 3KGPA 3GISB 3UOUA 2H9HA 4IC6A 1HPGA 4OS4A 5EXMA 5FHTA 1QCPA 1LPKB 2C90B 5A0BA 1GVLA 3D49H 1E35B 1TFXA 3GCTG 3R3GB 3SUEA 1HIAA 4AOQA 4AB8A 1B0EA 1MBMA 1Z8GA 5GWZA 4DIHH 3ATMA 1ACBE 2Z94A 1UVSH 2F9BH 2XBWA 1BTUA 3PTNA 4FU9A 2VIWA 3S7KB 1NTPA 4ABDA 2ULLA 1MZAA 2G8TA 3LH3A 3A8AA 2FP7B 1HAVB 4ASHA 3ZZ5A 1V2WT 2ILNA 1RIWC 1RIWB 1W10U 1EP5A 5JBCS 1P57B 1TPPA 1OWKA 2FPZA 5FX6A 2ANMH 1L0ZA 3LH1A 4WMDA 2UWLA 5A09A 1EZQA 1OS8A 2ZDAH 3A8BA 3RU4T 3MI4A 1O5DH 1SHHB 1HBTH 3U8OH 2OC1A 2R2MB 3NK8A 3V12A 2FOMB 2ZFTA 1MQ5A 1UJ1A 1QBVH 3HGNA 1ZMLA 2ZP0H 5BPEA 5GXPA 3RXFA 3HGPA 1XUHA 2A7HA 1MMJN 3TH2H 1GHBF 2EC9H 1T8OA 1V2UT 4E05H 1DY9A 1C9TA 1CVWH 4TY6A 1A5IA 3UNSA 3ZVBA 3SI3H 2BY5X 3E6PH 3A87A 3ENSB 2HLCA 1C2IA 4INHA 2XBVA 1C1QA 1P11E 2G5VA 4B75A 4O97A 3O8BA 1DITH 3EYDA 4O03A 4U2WA 1X7AC 4THNH 3S0NA 1NS3A 2Y7ZA 1GHVH 3ZV8A 2WPKS 2V0BA 3FAOA 3TK6A 1BHXF 3PMHB 1GDUA 1UCYE 4JZIA 4ZAEA 3MO3A 2J9NA 4ISOA 1S82A 1F2SE 1XXDA 1EJAA 2F83A 1NFUA 3RXJA 4JK5A 3M3VA 1JIMA 3HPTB 3S9AA 3FP6E 2GV6A 3U69H 1NRNH 1FUJA 1SQAA 3GY3A 4B2CA 2A0QB 4NZQA 3SORA 2ZEBA 2W7UA 1GI2A 2F9OA 1DX5M 4TWWA 1ELAA 3UQOA 1WOFA 1QA7A 3RXHA 1V6DA 5A8XA 2ZPRA 2D26C 1EAIA 1KSNA 3ZVGA 2QF3A 1QFKH 2FM2A 3K9XB 1TWXB 2XC0A 4Y8ZA 2I6SA 4CR5A 4Z0KA 1HAPH 1GVKB 5T3HA 1L2EA 1MD8A 3RXDA 1CBWC 4WXVA 3F9EA 1AZZA 2Z9KA 1MTUA 4OS7A 4DY7B 3GY5A 2P8OB 1SGQE 2P8OC 4CREA 2H9EH 1SC8U 4ABHA 4Y79A 4Y8XA 3MNCA 1CT4E 4WY3A 1SGPE 3BTQE 2BY9X 1EZSC 5LGOA 1EX3A 1UHBB 1K1NA 3T5FH 4BAOB 4I8GA 2GMTC 3VXEH 3SI4H 3D23A 1ID5H 2NU4E 3E1XB 8LPRA 2FI3E 1FONA 1HJ8A 4DOQA 1MD7A 1AE8H 3AW1A 2ZQ1A 1TNKA 2FOEA 2R9PA 2ZO3H 1OX1A 1BBRH 1SFQB 3EA7A 3Q3XA 1WTHD 2Y5FA 2GTBA 1D3QB 5DP3A 3P92A 4MNXA 4CRCA 4AFZA 3RM0H 2GX4A 1AB9B 1AB9C 3A7VA 1MTVA 1PQAA 4BXSA 5LPFA 2A5KA 1GBMA 1UCYK 3A8DA 9LPRA 2ZDNA 4XBCA 5E0GA 4IC5A 1GMHG 1YM0A 1O3NA 1BQYA 1SLXB 2G52A 2H2ZA 1EAXA 4GHQA 1LHEH 1WV7H 2AIPA 3KQDA 1UVPA 5FBEA 3A84A 4JZ1A 1C2GA 3RDZA 2GD4B 5FX5A 4D8NA 1F0RA 3A7ZA 2ODPA 4Y7AA 1FXYA 2BQ7B 4YOJA 1OWDA 1SOZA 1P04A 4I8KA 6LPRA 2A2QH 3SV2H 1AKSA 2Y5GA 2XXLA 3ZZAA 2J38A 7ESTE 2A4RA 2AIQA 2BD8A 1GGDC 1GGDB 3E3TA 2ZPSA 2Z9GA 1C5MD 4R8TB 1ELGA 3BTDE 2ZCKP 3RMNH 4BAHB 5GPIB 1K1OA 2BXTH 3LGWA 2OTVA 3SV6A 2XC5A 4WH6A 1L4ZA 1W2KH 1SPJA 2Q1JA 5C1XA 1YPMH 3U1JB 1Y3YA 3SUFA 5FPTA 1O3CA 2YOLA 1SVPA 3VEQB 1SI5H 1OYTH 3LGTA 2ZTZA 4AB9A 1TMUH 2GCHF 2AERH 1V2NT 1K21H 1HIAB 2PWXA 1CGJE 5ETXA 1C1PA 3M7UA 4D7FA 3IITA 1TOCB 1YPHC 2BLQA 1C5UA 4ISHH 3U8RH 2QA9E 4I8LA 1LQEA 2F9PA 2EEKA 1KXFA 4ZKSU 4XFQA 2R0KA 2ALVA 5JPMH 3E91A 5JBTA 3VB7A 3ZZBA 5EW1H 1HAXB 3RXKA 3EE0B 3NXPA 2LPRA 1TNHA 1P06A 3PLPA 2TIOA 1QURH 4BOHA 2TGPZ 2RA3A 4UDWH 3SU4A 1Z7KA 2WV4A 1FZZA 5DK1A 1G3EA 1W8BH 4I31A 7GCHG 2J94A 1ZMJA 1D9IA 4MVNA 3A81A 1TALA 2ZKSA 1KLJH 2FI4E 3CS7A 1MU6B 4AORA 1SGFG 3KHVA 4OGYA 3RXUA 2QC2A 3CP7A 3KF2A 1NFWA 1S0RA 3SHAH 4K8BA 2Y80A 4DG4A 1O2SA 1GMDF 4MQAA 4X2WA 2R2WU 3BTME 5HGGA 3SN8A 1O2PA 1AIXH 1V2ST 4ISIH 1NN6A 3BN9A 5K0HA 1GJ6A 1Y5AT 1K28D 1NFXA 1P05A 1JRTA 3A82A 4K3JA 4KTUA 1O3KA 3RMLH 1ZJDA 1ESTA 3R0FA 1DPOA 1P3EA 3VB4A 4ZHAA 2GP9B 1QRWA 1C1VH 1UK4A 1PPHE 1V3XA 1JRSA 3PLBA 1OWJA 4BXWA 1TGTA 2ZGCA 1DFPA 2OC0A 4D7GA 4AZ2B 1MTNC 3ZZCA 2YNBA 1RRKA 2GVFA 2TGDA 5ESTE 2ZECA 1RTFB 1C2JA 3K6ZA 4OS6A 5LPEA 4J1YA 2ZFQH 4XE4A 3AAUA 5EQSA 1TPAE 4J2YB 3MH5A 1ZZZA 3SU2A 2W5EA 1BJVA 3PV4A 4AG2A 4HI3A 1SLVB 2TPIZ 2ZHEH 1GMDG 3ZYDA 3M5OA 1GJDB 1EP6A 1KIGH 3M3TA 4TWYA
chains in the Genus database with same CATH superfamily
1FJSA 4NIVA 2JH5D 4OS1A 2W3KA 1RTLA 2C8ZB 1G30B 1OPHB 3RXLA 1K1PA 1TQ7B 1WTGH 2XRCA 3M5NA 2P59A 2J92A 3LGUA 5FPYA 1LO6A 1QNJA 2ZIQH 2GZ7A 1C4V2 5GDSH 3KN2A 4D9RA 1NZQH 3MNSA 2NU1E 1UVOA 1S84A 3IWMA 3LOXA 2Z9LA 1E0FD 1MH0A 1V2RT 3V7TA 1O0DH 1NBMD 4GUXA 1FAXA 1MKWH 1V2OT 4H4FA 3SJ9A 3ZZ6A 3GOVB 1DWEH 1O5FH 3VFEA 3BEIB 4PROA 3LKWA 6CHAB 3HK6B 4NSYA 3BTHE 1VKYA 3H7OA 1VITG 2V3OH 4XOJA 3NCLA 3KQBA 1ELCA 4CRFA 4JZEH 1O2HA 1DWCH 1BTHH 5JBAS 4B6FA 3P17H 2A5AA 4YOGA 2A4GA 3RXQA 1Q3XA 1BTWA 1LPGB 3OTJE 3TGJE 4YZUA 1H9HE 2CJIA 4KGAA 3L3TA 4CHAB 1GHWH 4IW4E 5TCCA 3SU3A 5C20A 4CHAC 1OP2A 5B6OA 3QX5H 1ZOMA 2FXRA 1KY9A 1UHBA 1D3TB 2WPMS 3SJ8A 2W3IA 3F0PA 4NA8A 3A89A 1WBGB 4UFDH 4CR9A 3GCHB 3E8LA 1CT2E 2PKSC 1F5RA 1BIOA 1TNGA 3M7TA 2QCYA 4ZH8A 4CBNA 5LPRA 4NWKA 5DP5A 1TGBA 1WUNH 4MNWA 2HRVA 2OLGA 3OYPA 3BIUH 1AKSB 1BITA 3P8NA 1YC0A 5EOKA 2ZCHP 4X0WU 3ZZ7A 5EIYA 2QN5T 1CO7E 4WVPE 1MAYA 2OK5A 3RU4D 4I7YH 1CGHA 1O2IA 1CA0C 1CA0B 1NO9H 1CQQA 3GCTF 2XWAA 3VGCB 3VGCC 1JOUB 2OP9A 2R0LA 1DXWA 2FX4A 1PYTD 1ETSH 2A32A 3BTTE 4O3TA 1GBEA 2CN0H 1D6RA 4A92A 1QL9A 2HWLB 1W7GH 3NKKA 4NSVA 4CRGA 3MMGA 1GG6B 1GG6C 1S81A 4X1NU 5LH8A 3SU6A 3ZIAD 5IYTA 2IJD1 1SGCA 1W0YH 3B8JA 3RLWH 2BDGA 4NFFA 1YY3A 2ANKH 4FXGH 2RFKC 3F0OA 3CNRA 4DT7B 1VGCB 1VGCC 2FZZA 1YPKH 4Q63A 3D65E 1LMWB 1GI6A 1SLWB 2F43B 5E2OA 4JYVH 2B5TB 1EOJA 4GPGA 3VG8A 1WQVH 1A4WH 1TBQH 5EGMA 4ZHLU 5C17A 1TNJA 2VWOA 1W7XH 2SGEE 3UNRA 3SJOA 2Y6TA 3ATKA 1YPEH 1GBFA 1GL0E 1N6XA 5C1UA 5JB9S 1N1LA 1T8LA 1CGIE 1O36A 1P0SH 8GCHF 4QT8C 5CE1A 1O5EH 2CF8H 3T29A 2BD5A 4IMQA 4AG1A 1SR5C 2O8MA 1O33A 1WYKA 2OBQA 3A88A 3ZZ4A 3M7QA 2BMGB 2ZU4A 1C5LH 1BJUA 4DVAU 4KTSA 1V2KT 3QZQA 4NIWA 2QXJA 1ZTLA 4WF8A 1ELDE 3MYWA 4INKA 3GY8A 2PV9B 2H1UA 3MHWU 1K0HA 1K2I1 2BOKA 2BXUH 1IHSH 1GMCF 1O3PB 1S6FA 2P3UB 4UONA 3A8CA 1D4PB 1HAIH 1XXFA 4UE7H 1W12U 3HATH 1T8MA 1IQGA 5F53A 5A2MH 1NRSH 4ABBA 4Q80A 3TVJB 5HXFA 1BTZA 2W7SA 5TJXA 2BZ6H 1GHAF 1XKAC 4X1SU 3DSOA 4ISLA 1UVTH 2HPPH 1F5KU 2XWBI 4ESTE 3TPIZ 5C1YA 1Y3XA 4F49A 1T32A 1A0HB 1FY5A 1O2NA 1RTKA 3MWIU 3PYHA 2ZHQH 2HGTH 1F7ZA 1C2FA 2OC7A 5HM2A 2ZC9H 2ZNKH 1DT2A 1Y59T 2B8OH 3E0NB 1AMHA 1QRZA 1C5VA 1MUEB 2W26A 8GCHG 4K5ZA 4Q2KA 1QHRB 3MOCA 1A46H 1NROH 2WV9A 1H8DH 5JDUB 1ANDA 2BOHB 3MO9A 1P2MA 2GDEH 1H1BA 4CH2B 2DE9A 2GZ8A 1LKAA 3UTUH 4FOUC 1OP0A 1C2HA 4MPWA 2YMSD 2TGAA 4INLA 1Z71A 1G2MA 1GMCG 3AW0A 2V3HH 3LPRA 2A4OA 1BA8B 1HGTH 1TONA 4B73A 4D76A 2BDHA 3KYGA 1UTJA 1MABB 2OCVB 1K1JA 1K1IA 1TOMH 2ZA5A 1NM6A 1ZTKA 1GHAG 3SQEE 5CMXH 1MQ6A 2FYQA 4FVDA 4Y8YA 2BQ6B 1EATA 2A31A 1GDQA 1NU7B 2EI6A 2KCOA 1ZSLA 1LVYA 4XDEA 1COWD 1GI0A 2J2UA 3O8RA 2AYWA 4P00A 1A1RA 1QJ7B 3BIVH 4IBLH 2EY4C 3W94A 2XTTB 3ESTA 2RG3A 2Y5HA 2ALPA 1S6LA 4X6NA 2K0QA 1AU8A 1XM1A 1WDIA 5A8YA 3ZVAA 3MU4A 2Z3EA 2FDAA 2VIQA 4X2VA 2PKAA 3TLOA 4FUIA 1OWEA 5EU8A 2AHME 1KXBA 3MH7A 1O2RA 2XCNA 1QB1A 3Q3KA 3UREA 5DKMA 1Z8RA 2ODYB 1SFIA 1FPHH 4X6MA 2PW8H 3U9AH 1GMHF 2FLBH 2R3YA 1BMAA 2RCEA 1Z8JB 3OSYA 5EXNA 2CGAA 1EUFA 4O9VA 4Q7XA 1GJAB 1Z1JA 5T6DA 4B2AA 4RKOB 2C93B 1DLKB 1C1RA 3DUXH 2VGCB 2QXGA 3A7TA 5CHAB 5CHAC 1J16A 1UK3A 1VR1H 1YCPK 2ZU1A 1GJBB 3BEFB 5JBBS 1G3CA 3D62A 4LZ4B 3DCLA 1IQIA 1G37A 2Z9JA 3ATIA 4K60A 1LVOA 1ZGIA 4ASUD 4WJG2 4MNYA 1UCYH 1TGCA 1C1NA 1JXPA 2P95A 5K7RA 1MZDA 2V3MA 1P09A 3H7TA 4TPIZ 3GYLB 1KXEA 3KL6A 2B9LA 2UUFB 1E34B 2EI7A 1NPMA 3K65B 3K6YA 4KP0A 1NU9A 2AFQB 2AS9A 2BY6X 3FO8D 3M5MA 5AFZH 3NUMA 2O8WA 4AFSA 3RMOH 1VZQH 1IQLA 3RXCA 3F1SB 1QL8A 4CRAA 2QY0B 4ZKRU 3TK5A 1K1LA 4A1XA 1TMBH 4MPVA 2A7CA 2FOFA 4BNRA 1EZXC 4MDSA 1XUIA 1ZRKA 3A83A 1FPCH 3SV8A 4BANB 1DWBH 2JETB 2JETC 2KCYA 1ETRH 2P3TB 3BSQA 2C4FH 1GL1A 3SJIA 3B9FH 5KEDA 4HZHA 2PSXA 1HCGA 4AN7A 2OINA 1SGFA 1ABIH 1LHCH 3RXOA 1TPOA 3UWIA 4CRDA 3ELAH 3S9CA 3E16B 1GBKA 4MLFB 5TCAA 1IQJA 2XNIA 1KTTB 1ZRBA 1O2MA 3ZZ9A 1TIOA 2EI8A 1VCQA 3SU0A 1DS2E 3K2UA 1DANH 2BD2A 1H9IE 2BHGA 3V0XA 1O37A 5FBIA 1TRYA 1YYY1 2IPHA 3GDUA 2V7QD 2PGBB 2RDEA 3JZ1B 2NU3E 5T6FA 2PHBA 1Y3VA 2P94A 4X2XA 2BVSH 7GCHF 3SNDA 3PO1C 3PO1B 1E36B 1AN1E 1O2VA 2BDYA 1HFDA 7LPRA 1BMNH 1KMHB 3WWBA 1GJ5H 1Z6JH 2FYRA 1ZSJA 1CHOG 2FOHA 1HDTH 2HNTF 1LPZB 1GBTA 2Y82A 4FU8A 2PTNA 1TNIA 1Z6EA 2F9VA 5T6GA 5A0CA 2ANWA 1QY6A 1TRNA 2BD7A 2K1QA 1KLTA 1E1RD 5KGOA 1ARCA 4AYVB 4BAQB 2V6NA 3ZVEA 4D9QA 2QAAA 2SGPE 4BTIB 1MKXK 1AWHB 2XOKD 2EA3A 5HIYA 2VJ1A 4GCHG 2QGRA 5JYIA 2XCFA 1HYLA 1PQ8A 3TITA 4LZ1H 1HB0B 2BDCA 1H4WA 2XBYA 1RGQA 1XVMA 4A5TS 4ABJA 1HAZB 2OBOA 2FMJA 1AFEH 1W0KD 1B5GH 2GT8A 1OKXA 5GNDA 2BVRH 1LVMA 3OAAD 3LGYA 3QN7A 3PM3A 4KELA 1O35A 1OXGA 1O3HA 4A1VA 3QO6A 1IQHA 1P02A 3A80A 4X1PU 4YM9A 3VPKA 2A7JA 2JH6D 2M2AA 1SGEE 2W6ID 1TABE 5DJ7A 5DGJA 3M61U 4DIIH 2O8TA 3VXFH 2HVXA 1C4Y2 2SFAA 3W95A 2CHAB 1ETTH 4GSOA 1C2KA 3EE7A 5GJ4B 3RM2H 2R3UA 2J34A 3ODDA 1ELVA 2UUKB 1GBHA 1P01A 2VIOA 1O39A 3EGKH 2JIZD 2STAE 1AO5A 1TB6H 3TJNA 1DXPA 1P9SA 4ZXXH 1B7XB 1BTPA 2Z3CA 4Q7ZA 5EPYA 2VNTA 3O8DA 4BTUB 1C5NH 2IJOB 2Z9IA 3MU5A 4NFEA 1UTKA 5AVDA 2RA0A 1DM4B 1DSUA 4DGJA 2NU2E 1AZ8A 1NRRH 1EJMA 1TAWA 1OHHD 2DE8A 2QV1A 4K2YA 3W1EA 2GCTB 4XD7D 1QB9A 1ANCA 3HKJB 4X6PA 1P12E 1HV7A 4FUJA 2FLRH 4FUHA 5HIZA 3BG8A 4A7IB 2Q6DA 3MU0A 2AEIH 1LVBA 2BLWA 1A0LA 1GI1A 1BMMH 1CHGA 3S7HB 3E0PB 1AD8H 1GHYH 1WSSH 1QJ6B 1AUJA 1VITF 2XYAA 1T31A 1BRAA 1CSOE 2G4UA 1M9UA 3KEEA 3H5CB 1BDAA 1YPJH 6GCHG 1PPFE 3LIWA 3ZZDA 1CA8B 2PKAB 2ZFPH 2GT7A 5AFYH 2G5NA 3NPSA 4FUBA 1MCTA 2BD3A 1DDJA 1GJ4H 4NG9H 1C5OH 2OQUA 2CK3D 3KIDU 5DP8A 2PUXB 1W3CA 3GCNA 3RUOA 2QF4A 2XC4A 2FI5E 1IQKA 1YLCA 4YXWD 4ZROA 2AMQA 4Y6DA 3M3SA 3UAIC 1VCWA 1HAYB 3VB3A 1BMLA 1C1TA 1SLUB 1NESE 1EXFA 2ESTE 3T28A 1S5SA 2SGQE 1LHDH 1O3MA 2L6OA 3GICB 3V13A 3V3MA 2BTCE 4X8SH 1KTSB 1EFRD 2A4QA 5EPNA 3A85A 1UTOA 5L30H 1V2MT 1GI3A 3TH4H 1C5TA 2BQWB 1C5ZB 3QZRA 3SBKA 5JB8S 1QR3E 2JH0D 6CHAC 1EOLA 5FCKA 1O2ZA 1O2TA 1O5CB 2F91A 1C5RA 1AVWA 4ISNA 2A5IA 1SGDE 2QXHA 3BV9B 3MH6A 1SKYE 5BRRE 1XUFA 3URCA 3ZVCA 5CDFE 2KR7A 3FN8A 3GY4A 2SGDE 1AE5A 1XKBC 4Z6AH 2AGEX 8ESTE 2AMDA 1FY8E 4M7GA 1ELEE 4OM9A 2WINI 2D1JA 2SNVA 1GBBA 1O3DA 2ZTYA 4AFQA 3QUMP 1EPTB 1QL7A 1YGCH 4SGBE 3GDSA 1QRXA 1T8NA 2BYAX 5J4QA 2H5DA 2HALA 1V2TT 1Y5BT 2GKVE 3GCHC 4UFEH 3M37A 1DUAA 1P2OA 2VIDA 1GHXH 4U30A 2P3FH 1QGFA 1TGSZ 1FX0B 1KDQB 3N7OA 2ZHDA 1TNLA 1EQ9A 4WH8A 3DA9B 2STBE 1BTXA 3SV9A 4UFGH 2WZQA 3F9FA 1W13U 1XUJA 5F8ZA 3FANA 2KX4A 6ESTA 5HYOA 1T7CA 1J17T 1CT0E 2QF5A 1U6QA 4E7RG 1PPZA 4R0IA 1QJ1B 1PYTC 3ODFA 1C5SA 1KXAA 1FN8A 3PROA 3FFGA 3I77A 2NU0E 2O8LA 5AHGH 3T25A 2FODA 4U01A 2UWPA 3STJA 3T26A 4HFPB 3TIUA 3F9GA 1NBME 5FAHA 4GLYA 4DW2U 1ANEA 5L2ZH 3WY8A 1C5QA 1GBDA 1ZPBA 5C94A 1C5WB 1C1OA 1O2XA 1BRCE 2J98A 3RC4A 1OWIA 2VU8E 1GI8B 1VCPA 2FO9A 3EQ0H 4GHTA 4B74A 3UFAA 4A1TA 2FTMA 3G01A 3RC5A 3UNQA 3WW7A 1OSSA 3BF6H 3U28C 1OWHA 2B0FA 3BTWE 4JZDH 1PQ5A 2VH0A 1RFNA 2VWMA 3SUDA 1P8VC 2F3CE 2GV7A 4BAKB 1O2QA 3TK9A 4ZMAH 1GPZA 1YCPM 4WWYA 5GIBA 2H9TH 2PR3A 1WCZA 3LU9B 2LNCA 3JZ2B 2VVUA 3RXMA 1NFYA 1IAUA 1D6WA 5HMAA 3SU1A 4GAWA 2FOGA 4CRBA 1IOEA 4TY7A 1H8HD 1TBRH 5FXLA 2HNTE 4UEHH 3ZV9A 3TJVA 4RN6A 4KKDA 2WYJA 4YT6H 1AFQB 1AFQC 1EB2A 3RU4E 3F68H 4I32A 2C8YB 1O3GA 2FOAA 3FOAA 1TE0A 2J5UA 1VJ9U 1A3BH 3RXVA 2PFEA 2VB0A 3Q76A 2ASUB 3FVFB 1V2LT 2UUJB 4HGCA 4ZKOU 5G4BA 1S85A 1FY1A 1C1MA 5A8ZA 4LXBH 2A2XH 1ANBA 1O3FA 3FP8E 4O3UA 4FUDA 3ZZ3A 2WUBA 1WAYB 1FAKH 1A61H 2BB4A 3FZZA 1AUTC 2D2DA 2OQ5A 4Y76A 3SO3A 8KME2 1L4DA 2RDLA 2AGGX 1LHFH 1O38A 5EJLA 3NZIA 4M9FA 4U32A 2ZZUH 5F6MA 1GWAA 3PMBB 1ESAA 1EB1H 1FIWA 4HTCH 2HVYB 1HJ9A 4RSPA 1XUKA 4ABAA 2P16A 3RP2A 1T4UH 4K8YA 1LQDB 2CXVA 4AX9H 1S83A 2YMSB 2YMSC 3SJKA 3RXBA 3L33A 3STIA 1GBAA 2O9QA 2FOBA 3DD2H 2BX3A 2ZHFH 1XUGA 2ZU5A 4FETA 1MU8B 3DSGA 1TRMA 3OEHD 2BLOA 1QIXB 3F2HA 1C2DA 2ANYA 2BD9A 4X8TH 1TA6A 3DHKH 2W6JD 3DSPA 3RXTA 3QLPH 3UPEA 1C5XB 3SW2B 3CENA 2AH4X 2ZHWH 2IN2A 2VWLA 1D3DB 1FY3A 4SGAE 3SZNA 3O8CA 2FESH 3EDXB 3B23B 1E79D 5F03A 1DY8A 1SGTA 1A7SA 4AFUA 1YF4A 1ESBA 4CH8B 3C1KA 1AI8H 3F9HA 4FUFA 1O3LA 3ZZ8A 5IDKA 1ARBA 1F0TA 1A0JA 1F92A 1YPGH 3OY5U 1GJ7B 2Y81A 1BB0B 1F5LA 1GI4A 4UD9H 3F2FA 3PB1E 1ZHPA 2FEQH 1C5YB 3OTPA 3NWUA 1SQTA 1YCPH 3VB5A 1OOKB 3MNXA 2F9NA 3LJOA 1BBRE 1FMGA 5DPAA 2ZGHA 1IQEA 3UOPA 1E37B 1D3PB 3DFLA 1RJXB 3RXAA 4CBOA 1G36A 3MTYA 1QB6A 3LGVA 1EJNA 2Q6FA 1XVOA 1PPBH 5EJ1A 2Y7XA 5PTPA 1DVAH 2C8WB 5E0JA 1LDTT 3RXPA 3GY7A 1W0JD 1FV9A 4B6EA 1GHBG 1GHZA 4WXIA 1AY6H 2VGCC 5I25A 1PPEE 3CS0A 1YLDA 2ZG0H 5EODA 1ZR0A 1Z1IA 3PMJA 4Q7YA 1YP9A 3RXEA 1CBWB 5DG6A 1SGIB 1UK2A 3SGQE 2DUCA 3LC5A 1ZLRA 5EQQA 3BTGE 1O30A 1PPGE 2KAIB 2TRMA 4B71A 3M36A 1JMOH 1GDNA 2YNAA 5SGAE 3PWCA 1JWTA 1RS0A 2ZF0H 3TJUA 1V2JT 1GI7B 3S69A 3TNSA 3HKIB 5EXLA 1F0SA 3SNEA 1EZUC 1A5GH 4NWLA 4H6SB 5EJZA 4ABIA 2GMTB 1WQSA 4OS5A 3OE7D 3RXIA 3SOSA 4X8VH 1CHOF 4JZFH 2VVVA 3T2NA 2Z6BD 1HJAB 1HJAC 3EA8A 1EAWA 1E1QD 1BMFD 1VITH 1A5HA 2ZFRH 1KLIH 4IMZA 1GVZA 4Y71A 3Q00A 4K1EA 4H6TA 1P2QA 1O32A 1P03A 2PP6A 1O2GH 4NCYA 1O2JA 3UIRA 2V35A 2SGAA 1C9PA 4FUCA 2C8XB 3OX7U 1EPTA 3ZYEA 4MPUA 1AQ7A 1PFXC 5A0AE 1C2LA 1TX6A 4JK6A 4YESB 1O5BB 1H8IH 1HLTH 3M5LA 1FLEE 1KXCA 1O2OA 3T27A 3UWJH 2BD4A 4IGDA 3ZVDA 1ELFA 3EA9A 1K9OE 4ABGA 2THFB 3SQHE 1G3BA 1ORFA 3GY6A 5C3NA 3GDVA 4XRNA 1FQ3A 4GCHF 3KCGH 2J98B 4RT0A 1KDQA 2SNWA 1XMNB 3LGIA 1WXRA 1QQUA 1IQFA 5C5OA 1DUEA 3HK3B 4E7NA 3SYJA 1O5AB 2A1DB 1O3IA 4B1TA 1B0FA 1BBRK 3GY2A 5C5NA 3AAVA 1MTSA 1HXEH 2G81E 1ABJH 3QTVH 1SOTA 5DP6A 2WYGA 2UWOA 4Y11E 4WMEA 1SQRA 2P93A 1CE5A 4K1SA 2D8WA 4UFFH 1V2QT 3MU1A 3VB6A 1PQ7A 1TA2A 5EG4A 2Q6GA 1GJ9B 1HAHH 1MKXH 1H9LB 2SGFE 4NIYA 4A6LA 2ZTXA 5FL7D 2GZ9A 5E2PA 5E0HA 3P95A 3KQCA 1YKTA 3ATWA 2VIPA 1Y5UT 3LC3A 5GCHF 3RC6A 4F4OC 4OS2A 2Z3DA 1F0UA 1SG8B 1UTPA 3DFJA 3PLKA 5ESBA 1YPLH 1G9IE 1O34A 1RD3B 1UTQA 1ZHRA 1SGYE 2AGIX 1NRQH 1GBJA 4TPYA 1O2KA 2HPQH 3UR6A 1BT7A 3GCOA 3SGBE 1TYNA 3LDXH 3UQVA 1J14A 1Z8IB 5L6NH 1SSXA 1ZTJA 1DOJA 5FCRA 3MU8A 4LOYH 2ZU3A 3I29A 2BDIA 2WPIS 1S0QA 3PMAB 4NGAH 4F48B 1S6HA 4JMYA 1V2PT 4H42U 2VIVA 1GI9B 4AC9A 3QTOH 3SHCH 3OY6U 3S9BA 1TX8A 4B2BA 3RMMH 1G2LA 1PPCE 3P8GA 3PWBA 6GCHF 1JIRA 2FS8A 1FDPA 2ZGJA 3E90B 2BDAA 2IOTA 3TU7H 5F8XA 3BTKE 1HUTH 3TGIE 1RXPA 1THRH 1ZPCA 4NIXA 1FY4A 3LT3A 1J8AA 2ZU2A 1IHTH 2CHAC 3Q3YA 4IN1A 2BVXH 1C2EA 1EASA 1O3EA 1CU1A 1BHXB 1DWDH 3URDA 2G4TA 1L1NA 1WU1A 5GCHG 1UMAH 2XBXA 3SV7A 1C2MA 1Q31A 4DCDA 1MTWA 1DLEA 1GCDA 2J4IA 4Y7BA 3TH3H 3MH4A 2O8UA 1HAOH 1LCYA 2WPHS 1YBWA 1BUIA 1P2KA 1JBUH 1QQ4A 1W0ZU 2GCHG 4YLUA 5DSFA 3SUGA 3A7YA 3DT0H 5L2YH 1HAVA 3IG6B 1C4U2 2GCTC 3QK1A 3KNXA 4ZUHA 2VINA 3RXRA 4BTTB 1TBZH 4TYDA 1KYNA 4AYYB 3BTEE 2UUYA 2ZQ2A 2G55A 3BEUA 1AWFH 5C2ZA 1T4VH 4I8HA 1PJPA 1O2LA 1V2VT 4MTBA 1SB1H 3TJOA 2ZDMA 1O3JA 4ZHMU 3RLYH 2ODQA 1SL3A 4ZXYH 2ZGXH 1FNIA 2QYIA 3A86A 4K69A 4Y0YE 4MNVA 3SU5A 1TPSA 2GGVB 5I46H 3I78A 1YPHE 1LTOA 2IPQX 1O3BA 3SNBA 1GJ8B 1P2IA 4X8UH 3GYMA 1L1JA 1THSH 1ZSKA 1FI8A 2ZPQA 1MTNB 1OYQA 5ABWA 1A3EH 1G3DA 4B76A 1H8ED 2C3SA 4MG3A 2GDDA 5DO4H 1GBIA 2HOBA 4IN2A 1SQOA 4X6OA 2M5TA 2JDID 1ELBA 2ZI2H 2PSYA 1GI5A 1MAXA 5HM9A 2AMPA 1XX9A 1P2JA 4X1QU 1ELTA 1O3OA 4RI0A 4ZKNU 4XBDA 1EKBB 5HKKD 3H09A 1AVXA 1O5GH 1BTYA 1UTLM 2QF0A 4Q4LA 1NRPH 1UTMA 1E38B 1GBCA 2ZWLH 4X2YA 2BY7X 1TLDA 2OUAA 4NA7A 4XBBA 5DP9A 1GBLA 1QBOA 3C27B 4VGCB 4VGCC 1LKBA 1BRBE 1G32B 4OGXA 3A7XA 1O2YA 2ZFFH 3N7EA 1GCTB 1GCTC 2BLVA 1TGNA 1DSTA 3ITIA 3PTBA 4MPXA 1QBNA 2BZAA 4FUGA 1K1MA 4KTCA 1C1SA 1NT1A 4K1TA 4XSKU 3SGAE 1Y3WA 3BTFE 4Y10E 4E06H 2WPDD 4FVBA 3L6PA 1N6YA 3P70B 4GVUA 1BOQA 3SNAA 2B7DH 2JKHA 4Y0ZE 1Y3UA 3PV5A 2CMYA 2WUCA 1BCUH 3QWCH 4YT7H 2XW9A 3UR9A 1Y8TA 1ZMNA 4ABEA 3UY9A 1HXFH 1EPTC 1Q2WA 4WMFA 4I33A 3SNCA 1SHYA 2H5CA 3P8FA 1TX7A 1AGJA 1J15A 3QGJA 4JCNA 2BX4A 1FIZA 1J9CH 2VBCA 2ZGBH 3A7WA 1SMFE 3ZVFA 2KAIA 2ZCLP 5E8EH 3FP7E 4DURA 4YO9A 5B6LA 3RXSA 2G51A 3LJJA 1W14U 2HNTC 2VVCA 2FOCA 3MFJA 2TGTA 1BZXE 1HNEE 2Z7FE 5EW2H 3BG4C 3BG4B 1C5PA 2FX6A 1ZGVA 2GJGA 1MKWK 2OC8A 5C67A 4YLQH 7KMEH 1HRTH 2A45B 1O31A 5FPSA 1P10A 3TNTA 2WPJS 1IQMA 1NY22 2FWWA 4P02A 2WV5A 3F3BA 1LHGH 4YOIA 4I8JA 9ESTA 3T62A 1SGNE 2VWNA 2WPLS 3OEED 1FN6A 3MO6A 5AF9H 5DP7A 1ZPZA 1AVGH 4DJZB 1C1UH 4NA9H 3U1IB 5J4SA 1P2NA 2XNDD 1P9UA 4BAMB 2PKSB 4FUEA 2F9UA 1QA0A 2OXSA 5C0UA 3U8TH 4NZLA 1DE7H 2NWNA 4X1RU 3OU0A 3UUZA 2K8IA 1AHTH 1L1GA 1EAUA 3N7DA 5H4IB 1MBQA 2OD3B 4AGKA 4FU7A 2BM2A 1BRUP 1O2WA 3KQEA 3RXGA 4RKJB 2PGQB 1GJCB 2G00A 3QDZB 1UTNA 2FTLE 2FS9A 1QTFA 1UO6A 2J95A 4JYTA 1UVUH 3U98H 3P6ZB 2QIQA 1MCVA 2BY8X 2H6MA 2ZDLA 2TBSA 3FZDA 1KXDA 3EAJA 4LK4A 2PTCE 1ZHMA 1ZYOA 2VH6A 1A2CH 3LONA 2ZDVH 2WHXA 3QGNB 3ATLA 1SGRE 1VJAU 1K22H 1O3AA 2CV3A 2PLXA 1TQ0B 3Q77A 4ACAA 1NC6A 2BDBA 3TGKE 1OP8A 2ZFSA 3P8OA 2CF9H 1P3CA 3AVZA 2FIRH 1IQNA 1QZ8A 2LP6A 2QXIA 4JYUH 5EQRA 1C1WH 1TMTH 1O2UA 3F6UH 1W11U 4IS5A 4YTAA 3MNBA 1ZJKA 1SBWA 4ABFA 4AGJA 1INCA 5F8TA 1THPB 2PUQH 5DP4A 2EQNA 1DICA 2I6QA 1N8OB 1N8OC 2L74A 3AASA 1HAGE 2ZDKA 3M35A 3KGPA 3GISB 3UOUA 2H9HA 2LELA 4IC6A 1HPGA 2F4LA 4OS4A 5EXMA 5FHTA 1QCPA 1LPKB 2C90B 5A0BA 1GVLA 3D49H 1E35B 1TFXA 3GCTG 3R3GB 3SUEA 1HIAA 4AOQA 4AB8A 1B0EA 1MBMA 1Z8GA 5GWZA 4DIHH 3ATMA 1ACBE 3NRLA 2Z94A 1UVSH 4TT3D 2F9BH 2XBWA 1BTUA 3PTNA 4FU9A 2VIWA 3S7KB 1NTPA 4ABDA 2ULLA 1MZAA 2G8TA 3LH3A 3A8AA 2FP7B 1HAVB 4ASHA 3ZZ5A 1V2WT 2ILNA 1RIWC 1RIWB 1W10U 1EP5A 5JBCS 1P57B 1TPPA 1OWKA 2FPZA 5FX6A 2ANMH 1L0ZA 3LH1A 4WMDA 2UWLA 5A09A 1EZQA 1OS8A 2ZDAH 3A8BA 3RU4T 2JJ1D 3MI4A 1O5DH 1SHHB 1HBTH 3U8OH 2OC1A 2R2MB 3NK8A 3V12A 2FOMB 5IK2D 2ZFTA 1MQ5A 1UJ1A 1QBVH 3HGNA 1ZMLA 2ZP0H 5BPEA 5GXPA 3RXFA 3HGPA 1XUHA 2A7HA 1MMJN 3TH2H 1GHBF 2EC9H 1T8OA 3F2GA 1V2UT 4E05H 1DY9A 1C9TA 1CVWH 4TY6A 3FKSD 1A5IA 3UNSA 3ZVBA 3SI3H 2BY5X 3E6PH 3A87A 3ENSB 2HLCA 1C2IA 4INHA 2XBVA 1C1QA 1P11E 2G5VA 4B75A 4O97A 4HG6A 3O8BA 4Z1MD 1DITH 3EYDA 3PRDA 4O03A 4U2WA 1X7AC 4THNH 3S0NA 1NS3A 2Y7ZA 1GHVH 2JJ2D 3ZV8A 2KCPA 2WPKS 2V0BA 3GS9A 3FAOA 3TK6A 1BHXF 3PMHB 3OFND 1GDUA 1UCYE 4JZIA 4ZAEA 3MO3A 2J9NA 4ISOA 1S82A 1F2SE 1XXDA 1EJAA 2F83A 2WSSD 1NFUA 3RXJA 4JK5A 3M3VA 1JIMA 3HPTB 3S9AA 3FP6E 2GV6A 3U69H 1NRNH 1FUJA 1SQAA 3GY3A 4B2CA 2A0QB 4NZQA 3SORA 2ZEBA 2W7UA 1GI2A 2F9OA 1DX5M 4TWWA 1ELAA 3UQOA 1WOFA 1QA7A 3RXHA 1V6DA 5A8XA 2ZPRA 2D26C 1EAIA 1KSNA 3ZVGA 2QF3A 1QFKH 2FM2A 3K9XB 1TWXB 2XC0A 4Y8ZA 2I6SA 4CR5A 4Z0KA 1HAPH 1GVKB 5T3HA 1L2EA 1MD8A 3RXDA 1CBWC 4WXVA 3F9EA 1AZZA 2QE7D 2Z9KA 1MTUA 4OS7A 4DY7B 2HLDD 3GY5A 2P8OB 1SGQE 2P8OC 3MQKC 4CREA 2H9EH 1SC8U 4ABHA 4Y79A 4Y8XA 5T1VA 3MNCA 1CT4E 4WY3A 1SGPE 3BTQE 2BY9X 1EZSC 5LGOA 1EX3A 1UHBB 1K1NA 3T5FH 4BAOB 4I8GA 2GMTC 3VXEH 3SI4H 3D23A 1ID5H 2NU4E 3E1XB 8LPRA 2FI3E 1FONA 1HJ8A 4DOQA 1MD7A 1AE8H 3AW1A 2ZQ1A 1UW7A 1TNKA 2FOEA 2R9PA 2ZO3H 3UB0A 1OX1A 5C0TA 1BBRH 1SFQB 3EA7A 3Q3XA 1WTHD 2Y5FA 2GTBA 1D3QB 5DP3A 3P92A 4MNXA 1YLNA 4AFZA 4CRCA 3RM0H 2GX4A 1AB9B 1AB9C 3A7VA 1MTVA 1PQAA 4BXSA 5LPFA 2A5KA 3KYFA 1GBMA 1UCYK 3KQ5A 3A8DA 9LPRA 2ZDNA 4XBCA 5E0GA 4IC5A 1GMHG 1YM0A 1O3NA 1BQYA 1SLXB 2G52A 2H2ZA 1EAXA 4GHQA 1LHEH 1WV7H 2AIPA 3KQDA 1UVPA 5FBEA 5CHBA 3A84A 4JZ1A 1C2GA 5KECA 3RDZA 2GD4B 5FX5A 4D8NA 1F0RA 2KZ4A 3A7ZA 2ODPA 4Y7AA 1FXYA 2BQ7B 4YOJA 1OWDA 1SOZA 1P04A 4I8KA 6LPRA 2A2QH 3SV2H 1AKSA 2Y5GA 2XXLA 3ZZAA 2J38A 7ESTE 2A4RA 2AIQA 2BD8A 1GGDC 1GGDB 3E3TA 2ZPSA 2Z9GA 1C5MD 4R8TB 1ELGA 3BTDE 2ZCKP 3RMNH 4BAHB 5GPIB 3PRBA 1K1OA 2BXTH 3LGWA 2OTVA 3SV6A 2XC5A 4WH6A 1L4ZA 3AK5A 1W2KH 1SPJA 2Q1JA 4DT4A 5C1XA 1YPMH 3U1JB 1Y3YA 3SUFA 5FPTA 1O3CA 2YOLA 1SVPA 3VEQB 1SI5H 1OYTH 3LGTA 2ZTZA 4AB9A 1TMUH 2GCHF 2AERH 1V2NT 1K21H 1HIAB 2PWXA 1CGJE 5ETXA 1C1PA 2KM0A 3M7UA 4D7FA 3IITA 1TOCB 1YPHC 2BLQA 1C5UA 4ISHH 3U8RH 2QA9E 4I8LA 1LQEA 2F9PA 2EEKA 4ACBA 1KXFA 4ZKSU 4XFQA 2R0KA 2ALVA 5JPMH 3E91A 5JBTA 3VB7A 3ZZBA 5EW1H 1HAXB 3RXKA 3EE0B 3NXPA 2LPRA 1TNHA 1P06A 3PLPA 2TIOA 1QURH 2KCAA 4BOHA 2TGPZ 2RA3A 4UDWH 3SU4A 1Z7KA 2WV4A 4TSFD 1FZZA 5DK1A 1G3EA 1W8BH 4I31A 7GCHG 2J94A 4F55A 1ZMJA 1D9IA 4MVNA 3A81A 1TALA 2ZKSA 1KLJH 2FI4E 3CS7A 1MU6B 4AORA 1SGFG 3KHVA 4OGYA 3RXUA 3WWFA 2QC2A 3CP7A 3KF2A 1NFWA 1S0RA 3SHAH 4K8BA 2Y80A 4DG4A 4ZCNA 1O2SA 1GMDF 4MQAA 4X2WA 2R2WU 3BTME 5HGGA 3SN8A 1O2PA 1AIXH 1V2ST 3N99A 4ISIH 4I86A 1NN6A 3BN9A 3PV2A 5K0HA 1GJ6A 1Y5AT 1K28D 1NFXA 1P05A 1JRTA 3A82A 4K3JA 4KTUA 1O3KA 3RMLH 1ZJDA 1ESTA 3R0FA 1DPOA 1P3EA 3VB4A 4ZHAA 2GP9B 1QRWA 1C1VH 1UK4A 1PPHE 1V3XA 1JRSA 3PLBA 1OWJA 4BXWA 5DN6D 1TGTA 2ZGCA 1DFPA 2OC0A 4D7GA 4AZ2B 1MTNC 3ZZCA 3SZEA 2YNBA 1RRKA 2GVFA 2TGDA 5ESTE 2ZECA 1RTFB 1C2JA 3K6ZA 4OS6A 5LPEA 4J1YA 2ZFQH 4XE4A 4RT1A 3AAUA 5EQSA 1TPAE 4J2YB 3MH5A 1ZZZA 3SU2A 2J97A 2W5EA 1BJVA 1YWUA 3PV4A 4AG2A 4HI3A 1SLVB 2TPIZ 2ZHEH 1GMDG 3ZYDA 3M5OA 1GJDB 1EP6A 1KIGH 3M3TA 2KFWA 4TWYA
chains in the Genus database with same CATH topology
1FJSA 4NIVA 2JH5D 4OS1A 2W3KA 1RTLA 2C8ZB 1G30B 1OPHB 3RXLA 1K1PA 1TQ7B 1WTGH 2XRCA 3M5NA 2P59A 2J92A 3LGUA 5FPYA 1LO6A 1QNJA 2ZIQH 2GZ7A 1C4V2 5GDSH 3KN2A 4D9RA 1NZQH 3MNSA 2NU1E 1UVOA 1S84A 3IWMA 3LOXA 2Z9LA 1E0FD 1MH0A 1V2RT 3V7TA 1O0DH 4GUXA 1FAXA 1MKWH 1V2OT 4H4FA 3SJ9A 3ZZ6A 3GOVB 1DWEH 1O5FH 3VFEA 3BEIB 4PROA 3LKWA 6CHAB 3HK6B 4NSYA 3BTHE 3H7OA 1VITG 2V3OH 4XOJA 3NCLA 3KQBA 1ELCA 4CRFA 4JZEH 1O2HA 1DWCH 1BTHH 5JBAS 3P17H 2A5AA 4YOGA 2A4GA 3RXQA 1Q3XA 1BTWA 1LPGB 3OTJE 3TGJE 4YZUA 1H9HE 2CJIA 4KGAA 3L3TA 4CHAB 1GHWH 4IW4E 5TCCA 3SU3A 5C20A 4CHAC 1OP2A 5B6OA 3QX5H 1ZOMA 2FXRA 1KY9A 1UHBA 1D3TB 2WPMS 3SJ8A 2W3IA 4NA8A 3A89A 1WBGB 4UFDH 4CR9A 3GCHB 3E8LA 1CT2E 2PKSC 1F5RA 1BIOA 1TNGA 3M7TA 2QCYA 4ZH8A 4CBNA 5LPRA 4NWKA 5DP5A 1TGBA 1WUNH 4MNWA 2HRVA 2OLGA 3OYPA 3BIUH 1AKSB 1BITA 3P8NA 1YC0A 5EOKA 2ZCHP 4X0WU 3ZZ7A 2QN5T 1CO7E 4WVPE 1MAYA 3RU4D 4I7YH 1CGHA 1O2IA 1CA0C 1CA0B 1NO9H 1CQQA 3GCTF 2XWAA 3VGCB 3VGCC 1JOUB 2OP9A 2R0LA 1DXWA 2FX4A 1PYTD 1ETSH 2A32A 3BTTE 4O3TA 1GBEA 2CN0H 1D6RA 4A92A 1QL9A 2HWLB 1W7GH 3NKKA 4NSVA 4CRGA 3MMGA 1GG6B 1GG6C 1S81A 4X1NU 5LH8A 3SU6A 5IYTA 1SGCA 1W0YH 3B8JA 3RLWH 2BDGA 4NFFA 2ANKH 4FXGH 4DT7B 1VGCB 1VGCC 2FZZA 1YPKH 3D65E 1LMWB 1GI6A 1SLWB 5E2OA 4JYVH 2B5TB 1EOJA 4GPGA 1WQVH 1A4WH 1TBQH 5EGMA 4ZHLU 1TNJA 2VWOA 1W7XH 2SGEE 3UNRA 3SJOA 2Y6TA 3ATKA 1YPEH 1GBFA 1GL0E 1N6XA 5C1UA 5JB9S 1N1LA 1T8LA 1CGIE 1O36A 1P0SH 8GCHF 4QT8C 5CE1A 1O5EH 2CF8H 3T29A 2BD5A 4IMQA 4AG1A 1SR5C 2O8MA 1O33A 1WYKA 2OBQA 3A88A 3ZZ4A 3M7QA 2BMGB 2ZU4A 1C5LH 1BJUA 4DVAU 4KTSA 1V2KT 3QZQA 4NIWA 2QXJA 1ZTLA 4WF8A 1ELDE 3MYWA 4INKA 3GY8A 2PV9B 2H1UA 3MHWU 1K2I1 2BOKA 2BXUH 1IHSH 1GMCF 1O3PB 1S6FA 2P3UB 4UONA 3A8CA 1D4PB 1HAIH 1XXFA 4UE7H 1W12U 3HATH 1T8MA 1IQGA 5A2MH 1NRSH 4ABBA 4Q80A 3TVJB 5HXFA 1BTZA 2W7SA 5TJXA 2BZ6H 1GHAF 1XKAC 4X1SU 4ISLA 1UVTH 2HPPH 1F5KU 2XWBI 4ESTE 3TPIZ 5C1YA 1Y3XA 4F49A 1T32A 1A0HB 1FY5A 1O2NA 1RTKA 3MWIU 3PYHA 2ZHQH 2HGTH 1F7ZA 1C2FA 2OC7A 5HM2A 2ZC9H 2ZNKH 1DT2A 1Y59T 2B8OH 3E0NB 1AMHA 1QRZA 1C5VA 1MUEB 2W26A 8GCHG 4K5ZA 4Q2KA 1QHRB 3MOCA 1A46H 1NROH 1H8DH 5JDUB 1ANDA 2BOHB 3MO9A 1P2MA 2GDEH 1H1BA 4CH2B 2DE9A 2GZ8A 1LKAA 3UTUH 1OP0A 1C2HA 4MPWA 2TGAA 4INLA 1Z71A 1G2MA 1GMCG 3AW0A 2V3HH 3LPRA 2A4OA 1BA8B 1HGTH 1TONA 4B73A 4D76A 2BDHA 1UTJA 2OCVB 1K1JA 1K1IA 1TOMH 2ZA5A 1NM6A 1ZTKA 1GHAG 3SQEE 5CMXH 1MQ6A 2FYQA 4FVDA 4Y8YA 2BQ6B 1EATA 2A31A 1GDQA 1NU7B 2EI6A 1ZSLA 1LVYA 4XDEA 1GI0A 2J2UA 3O8RA 2AYWA 1A1RA 1QJ7B 3BIVH 4IBLH 3W94A 2XTTB 3ESTA 2RG3A 2Y5HA 2ALPA 4X6NA 1AU8A 1XM1A 5A8YA 3ZVAA 3MU4A 2Z3EA 2FDAA 2VIQA 4X2VA 2PKAA 3TLOA 4FUIA 1OWEA 5EU8A 3MH7A 1KXBA 1O2RA 2XCNA 1QB1A 3Q3KA 3UREA 5DKMA 1Z8RA 2ODYB 1SFIA 1FPHH 4X6MA 2PW8H 3U9AH 1GMHF 2FLBH 2R3YA 1BMAA 2RCEA 1Z8JB 3OSYA 5EXNA 2CGAA 1EUFA 4O9VA 4Q7XA 1GJAB 1Z1JA 5T6DA 4B2AA 4RKOB 2C93B 1DLKB 1C1RA 3DUXH 2VGCB 2QXGA 3A7TA 5CHAB 5CHAC 1J16A 1UK3A 1VR1H 1YCPK 2ZU1A 1GJBB 3BEFB 5JBBS 1G3CA 3D62A 4LZ4B 1IQIA 1G37A 2Z9JA 3ATIA 4K60A 1LVOA 1ZGIA 4WJG2 4MNYA 1UCYH 1TGCA 1C1NA 1JXPA 2P95A 5K7RA 1MZDA 1P09A 3H7TA 4TPIZ 3GYLB 1KXEA 3KL6A 2B9LA 2UUFB 1E34B 2EI7A 1NPMA 3K65B 3K6YA 4KP0A 1NU9A 2AFQB 2AS9A 2BY6X 3M5MA 5AFZH 3NUMA 2O8WA 4AFSA 3RMOH 1VZQH 1IQLA 3RXCA 3F1SB 1QL8A 4CRAA 2QY0B 4ZKRU 3TK5A 1K1LA 4A1XA 1TMBH 4MPVA 2A7CA 2FOFA 4BNRA 1EZXC 4MDSA 1XUIA 1ZRKA 3A83A 1FPCH 3SV8A 4BANB 1DWBH 2JETB 2JETC 1ETRH 2P3TB 3BSQA 2C4FH 1GL1A 3SJIA 3B9FH 4HZHA 2PSXA 1HCGA 4AN7A 2OINA 1SGFA 1ABIH 1LHCH 3RXOA 1TPOA 3UWIA 4CRDA 3ELAH 3S9CA 3E16B 1GBKA 4MLFB 5TCAA 1IQJA 2XNIA 1KTTB 1ZRBA 1O2MA 3ZZ9A 1TIOA 2EI8A 1VCQA 3SU0A 1DS2E 3K2UA 1DANH 2BD2A 1H9IE 2BHGA 3V0XA 1O37A 5FBIA 1TRYA 1YYY1 2IPHA 3GDUA 2PGBB 3JZ1B 2NU3E 5T6FA 2PHBA 1Y3VA 2P94A 4X2XA 2BVSH 7GCHF 3SNDA 3PO1C 3PO1B 1E36B 1AN1E 1O2VA 2BDYA 1HFDA 7LPRA 1BMNH 1GJ5H 1Z6JH 2FYRA 1ZSJA 1CHOG 2FOHA 1HDTH 2HNTF 1LPZB 1GBTA 2Y82A 4FU8A 2PTNA 1TNIA 1Z6EA 2F9VA 5T6GA 5A0CA 2ANWA 1QY6A 1TRNA 2BD7A 2K1QA 1KLTA 1ARCA 4AYVB 4BAQB 2V6NA 3ZVEA 4D9QA 2QAAA 2SGPE 4BTIB 1MKXK 1AWHB 2EA3A 5JYIA 2VJ1A 4GCHG 2QGRA 2XCFA 1HYLA 1PQ8A 3TITA 4LZ1H 1HB0B 2BDCA 1H4WA 2XBYA 1RGQA 1XVMA 4A5TS 4ABJA 1HAZB 2OBOA 2FMJA 1AFEH 1B5GH 2GT8A 1OKXA 2BVRH 1LVMA 3LGYA 3QN7A 3PM3A 4KELA 1O35A 1OXGA 1O3HA 4A1VA 3QO6A 1IQHA 1P02A 3A80A 4X1PU 4YM9A 3VPKA 2A7JA 2JH6D 1SGEE 1TABE 5DJ7A 5DGJA 3M61U 4DIIH 2O8TA 3VXFH 2HVXA 1C4Y2 2SFAA 3W95A 2CHAB 1ETTH 4GSOA 1C2KA 5GJ4B 3RM2H 2R3UA 2J34A 3ODDA 1ELVA 2UUKB 1GBHA 1P01A 2VIOA 1O39A 3EGKH 2STAE 1AO5A 1TB6H 3TJNA 1DXPA 1P9SA 4ZXXH 1B7XB 1BTPA 2Z3CA 4Q7ZA 5EPYA 2VNTA 3O8DA 4BTUB 1C5NH 2IJOB 2Z9IA 3MU5A 4NFEA 1UTKA 5AVDA 2RA0A 1DM4B 1DSUA 4DGJA 2NU2E 1AZ8A 1NRRH 1EJMA 1TAWA 2DE8A 2QV1A 4K2YA 2GCTB 1QB9A 1ANCA 3HKJB 4X6PA 1P12E 1HV7A 4FUJA 2FLRH 4FUHA 3BG8A 4A7IB 2Q6DA 3MU0A 2AEIH 1LVBA 2BLWA 1A0LA 1GI1A 1BMMH 1CHGA 3S7HB 3E0PB 1AD8H 1GHYH 1WSSH 1QJ6B 1AUJA 1VITF 2XYAA 1T31A 1BRAA 1CSOE 2G4UA 1M9UA 3KEEA 3H5CB 1BDAA 1YPJH 6GCHG 1PPFE 3LIWA 3ZZDA 1CA8B 2PKAB 2ZFPH 2GT7A 5AFYH 2G5NA 3NPSA 4FUBA 1MCTA 2BD3A 1DDJA 1GJ4H 4NG9H 1C5OH 2OQUA 3KIDU 5DP8A 2PUXB 1W3CA 3GCNA 3RUOA 2XC4A 2FI5E 1IQKA 1YLCA 4ZROA 2AMQA 4Y6DA 3M3SA 1VCWA 1HAYB 3VB3A 1BMLA 1C1TA 1SLUB 1NESE 1EXFA 2ESTE 3T28A 1S5SA 2SGQE 1LHDH 1O3MA 3GICB 3V13A 3V3MA 2BTCE 4X8SH 1KTSB 2A4QA 5EPNA 3A85A 1UTOA 5L30H 1V2MT 1GI3A 3TH4H 1C5TA 2BQWB 1C5ZB 3QZRA 3SBKA 5JB8S 1QR3E 2JH0D 6CHAC 1EOLA 5FCKA 1O2ZA 1O2TA 1O5CB 2F91A 1C5RA 1AVWA 4ISNA 2A5IA 1SGDE 2QXHA 3BV9B 3MH6A 5BRRE 1XUFA 3URCA 3ZVCA 3GY4A 2SGDE 1AE5A 1XKBC 4Z6AH 2AGEX 8ESTE 2AMDA 1FY8E 4M7GA 1ELEE 2WINI 2D1JA 2SNVA 1GBBA 1O3DA 2ZTYA 4AFQA 3QUMP 1EPTB 1QL7A 1YGCH 4SGBE 3GDSA 1QRXA 1T8NA 2BYAX 5J4QA 2H5DA 2HALA 1V2TT 1Y5BT 2GKVE 3GCHC 4UFEH 3M37A 1DUAA 1P2OA 2VIDA 1GHXH 4U30A 2P3FH 1QGFA 1TGSZ 1KDQB 3N7OA 2ZHDA 1TNLA 1EQ9A 4WH8A 3DA9B 2STBE 1BTXA 3SV9A 4UFGH 3F9FA 1W13U 1XUJA 5F8ZA 3FANA 5HYOA 6ESTA 1T7CA 1J17T 1CT0E 1U6QA 4E7RG 1PPZA 4R0IA 1QJ1B 1PYTC 3ODFA 1C5SA 1KXAA 1FN8A 3PROA 3FFGA 3I77A 2NU0E 2O8LA 5AHGH 3T25A 2FODA 4U01A 2UWPA 3STJA 3T26A 4HFPB 3TIUA 3F9GA 5FAHA 4GLYA 4DW2U 1ANEA 5L2ZH 3WY8A 1C5QA 1GBDA 1ZPBA 1C5WB 1C1OA 1O2XA 1BRCE 3RC4A 1OWIA 2VU8E 1GI8B 1VCPA 2FO9A 3EQ0H 4GHTA 4B74A 3UFAA 4A1TA 2FTMA 3G01A 3RC5A 3UNQA 1OSSA 3BF6H 1OWHA 2B0FA 3BTWE 4JZDH 1PQ5A 2VH0A 1RFNA 2VWMA 3SUDA 1P8VC 2F3CE 2GV7A 4BAKB 1O2QA 3TK9A 4ZMAH 1GPZA 1YCPM 4WWYA 5GIBA 2H9TH 2PR3A 1WCZA 3LU9B 2LNCA 3JZ2B 2VVUA 3RXMA 1NFYA 1IAUA 1D6WA 5HMAA 3SU1A 4GAWA 2FOGA 4CRBA 1IOEA 4TY7A 1TBRH 5FXLA 2HNTE 4UEHH 3ZV9A 3TJVA 4RN6A 4KKDA 2WYJA 4YT6H 1AFQB 1AFQC 1EB2A 3RU4E 3F68H 4I32A 2C8YB 1O3GA 2FOAA 1TE0A 3RXVA 1VJ9U 1A3BH 2PFEA 2VB0A 3Q76A 2ASUB 3FVFB 1V2LT 2UUJB 4HGCA 4ZKOU 5G4BA 1S85A 1FY1A 1C1MA 5A8ZA 4LXBH 2A2XH 1ANBA 1O3FA 3FP8E 4O3UA 4FUDA 3ZZ3A 2WUBA 1WAYB 1FAKH 1A61H 2BB4A 3FZZA 1AUTC 2D2DA 2OQ5A 4Y76A 3SO3A 8KME2 1L4DA 2RDLA 2AGGX 1LHFH 1O38A 3NZIA 4U32A 2ZZUH 5F6MA 1GWAA 3PMBB 1ESAA 1EB1H 1FIWA 4HTCH 1HJ9A 4RSPA 1XUKA 4ABAA 2P16A 3RP2A 1T4UH 4K8YA 1LQDB 2CXVA 4AX9H 1S83A 3SJKA 3RXBA 3L33A 3STIA 1GBAA 2O9QA 2FOBA 3DD2H 2BX3A 2ZHFH 1XUGA 2ZU5A 1MU8B 1TRMA 2BLOA 1QIXB 1C2DA 2ANYA 2BD9A 4X8TH 1TA6A 3DHKH 3RXTA 3QLPH 3UPEA 1C5XB 3SW2B 3CENA 2AH4X 2ZHWH 2IN2A 2VWLA 1D3DB 1FY3A 4SGAE 3SZNA 3O8CA 2FESH 3EDXB 3B23B 5F03A 1DY8A 1SGTA 1A7SA 4AFUA 1YF4A 1ESBA 4CH8B 3C1KA 1AI8H 3F9HA 4FUFA 1O3LA 3ZZ8A 5IDKA 1ARBA 1F0TA 1A0JA 1F92A 1YPGH 3OY5U 1GJ7B 2Y81A 1BB0B 1F5LA 1GI4A 4UD9H 3PB1E 1ZHPA 2FEQH 1C5YB 3NWUA 1SQTA 1YCPH 3VB5A 1OOKB 3MNXA 2F9NA 3LJOA 1BBRE 1FMGA 5DPAA 2ZGHA 1IQEA 3UOPA 1E37B 1D3PB 3DFLA 1RJXB 3RXAA 4CBOA 1G36A 3MTYA 1QB6A 3LGVA 1EJNA 2Q6FA 1XVOA 1PPBH 2Y7XA 5PTPA 1DVAH 2C8WB 5E0JA 1LDTT 3RXPA 3GY7A 1FV9A 1GHBG 1GHZA 4WXIA 1AY6H 2VGCC 5I25A 1PPEE 3CS0A 1YLDA 2ZG0H 5EODA 1ZR0A 1Z1IA 3PMJA 4Q7YA 1YP9A 3RXEA 1CBWB 5DG6A 1SGIB 1UK2A 3SGQE 2DUCA 3LC5A 1ZLRA 5EQQA 3BTG<