2G30A

Beta appendage of ap2 complexed with arh peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords AP-2 complex subunit beta-1
publication title Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2g30A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2g30A02
1B9KA 1TBPA 1TGHA 2IV8A 1QN5A 2MJ7A 1KYUA 5IYDP 1E42A 1D3UA 1KYDA 1KY6A 1QNAA 5IYBP 5IYCP 1QNCA 3H1ZA 1VOLB 1C9BB 1VOKA 4B0AA 1QN6A 4PY5A 2D0AA 1AISA 2G30A 1NGMA 3VN5A 1VTOA 2VJ0A 2Z8UA 4WZSD 3EIKA 1MP9A 1YTBA 3HS8A 3ASMA 2D0CA 1RM1A 1KYFA 4ROEB 1QN3A 1TBAB 1KY7A 3HS9A 1CDWA 1QN4A 1QNBA 1NH2A 1NVPA 1R4XA 1PCZA 1QTPA 2D0BA 1QN9A 1QN8A 3OCIA 4RODB 1YTFA 4ROCB 1QTSA 1QN7A 1PZDA 2IV9A 3OC3C 1JFIC 1VTLE 1QNEA 1W80A
chains in the Genus database with same CATH superfamily
3RJQB 3L4ZA 1Q94B 3GDCA 1YUHB 4FHBD 5I8EB 1M7IA 4OFYD 3O6FB 5GGVY 3A0OA 1FNAA 4QXGH 3VH8G 2XG5A 2B5IC 3B56A 1H3WM 4U33A 1PFOA 2WBKA 5FF6B 2X1OA 1XIWD 5M7QA 5HYQA 2FQEA 4BKLA 2XQ0A 4I87A 2UXFA 3V4UH 4PJEE 4HF5H 2QGEA 3BKMH 1IVLA 1HIMH 5I1AA 1UD4A 3B7YA 3G6JA 5KN5A 3UAEA 4F8TA 2C9VA 4HZLB 2XWCA 4KZCA 4R2GC 2UX7A 4P5TD 3BUIA 2WLIA 3QNYB 2CBOA 1T0OA 3TYFA 3QWQB 3P4NA 3NJGA 2EUXA 2EKSA 4N8UA 4AJ0A 3U9UB 5ECGA 1NOAA 3P1VA 1YEFH 3GMMA 2VXVL 5J89A 3TH4T 3PXHA 12E8L 3L3DB 2BSTB 2VW6A 4PJBF 3IB4A 2FLBT 2R2EA 4BFIA 5JIQA 1LXMA 1E9OA 4OIAA 4ZO6A 1UC6A 4RLDA 1NFAA 3DV6A 4D0CB 1WZ1L 3D07A 3IDIB 3GDBA 2HLFC 3NAAL 4WHCA 4XCNA 2BXYA 2DICA 3EHBC 3G6DH 4XX1G 4EALA 1DO6A 1CK0H 4BZYA 1CL7H 1O7VA 5DC2A 3ZVVA 4P5MB 2QR0B 3OSEA 5HVHC 2M2DA 1ET5A 5MEQB 5JW4R 4CUCA 3RZCB 4LPCA 4NKQB 2IFGA 4V1DE 5A2FA 1DQDH 2FDBP 4C56D 3QK0A 2FX9L 4WO4C 1DVQA 1PLCA 5CGBA 4AM0Q 2J8UA 2CD0A 2XTLA 1XGQB 4XMPH 5E70A 1P4IL 3C6LA 3U0TB 1N0XL 2YPKA 2DRUA 4P46A 1NBYB 1B4JH 1SN5A 3CDCA 4R7NA 3RDTB 4JM0A 4QJ3B 1NM4A 1MAJA 4C8XA 5T3XH 5K9KB 5J1AA 1RJLA 4LCIL 4PJDF 2EXSA 3ML9A 4EIUA 4YOKA 5DC4B 2K0RA 3MRJA 4UT7L 3LX9A 1TCRA 3SJVE 3FCTA 3ESPA 4L29B 2IAMB 3AU1B 2RCSL 3TZVB 3WFEL 5BVPL 4XOEA 3L5WB 3LTVA 4DK5A 1BAFH 1ORSA 2DBJA 1BX2A 3KYKL 2ZKHL 2Q6WB 2COVD 1YQVH 1IGIH 3T6QC 1CFTB 2D4FA 3CSGA 4JK0D 4HDIA 1WP6A 4PRDA 4KK8C 3BGFC 3O2DH 5TDOB 5FV2A 4JZNA 1HAWA 3UH8A 1U9KA 2LHAA 4HUKB 3NJHA 1OEZW 4HHGA 3CZLA 3HI6H 5KVGL 3W39B 5C0GA 2CM6A 5LNEA 2F58L 1F4HA 2KKQA 4E9SA 2NOHA 1OL0A 4GBXD 2EIZA 5JHDE 2DYRB 3JTBA 2Y06H 3QJHB 4WI9A 3K46A 2XICA 3C09B 1CU4H 3GXFA 3L1FA 1I8LC 3Q1SH 2EH8L 3FUIA 2HFEA 4U1SA 2V5TA 2ZUYA 4G6FB 4U1GC 2G5BA 2NY4D 5AAPA 5JDSB 2AHIA 4OFIA 4K8RH 2FO1A 4JS7A 1PLBA 4C4BA 4LLMA 2D7TL 2XVBA 2HTKC 4CJ0A 4P5RA 2AK1L 4EDXB 5GS0C 1MXGA 4IGBD 4GW5A 3B8YA 3ZOAA 1FO0H 3D4YA 4I0PA 4V1DA 5ALBL 5EG6C 3FO2B 4HIXH 3AXLA 1MHEB 3A24A 4ODUA 1QFUL 4XZUA 1ZANH 4Z7QE 3CVDA 2DBLL 4ES8A 3I02B 3Q2VA 3MOBL 4QRTB 3SKJH 2VW4A 1KCLA 2H7WA 4ECNA 1S5HB 4KI5D 1NKGA 4OM0L 4JPKL 2OL3L 2JIXA 4D9RE 1MIEH 4J4PD 5AVRB 3SQBB 4DETA 5EIIG 3QE5A 2OMZA 3QG7H 3W1ZA 3ZE2F 4XCCH 3PL6B 1U8OB 5BXFA 3QIUB 2Q7YA 5T1LB 1TENA 1MG2C 3BKCL 5KSAD 2ENJA 5LHDA 2XA8L 2E27H 4JHWL 5IHLB 4GRWE 1FFTB 1NCBL 3JV5A 2JELL 1YEJL 4AJYV 3VFMB 4DKDC 4L5FL 1A9BB 1FIGH 5D2NA 3RX5A 4X5PA 2RBLA 4S1RH 1KCRL 4LZKA 1Q1JL 43C9A 3PWPA 1R0AL 4Y9EA 5HGGS 5C07D 1H3PH 1WWAX 3IJ7A 4F7PA 3ARVA 4BWTA 1UD8A 1KIQA 2W9DL 4N90E 3LRLA 1MZZA 3K6SA 3VACA 1DBML 4N3UA 2CJUL 3VXOA 1HK6A 1USQA 4QYAA 1CJYA 1QN4A 4UQAA 5DK2A 3B9KA 2W0PA 3DC0A 5L6YL 2Y7LA 4Y2DD 2HRPH 2KPNA 2NQCA 2ZCLH 1QVOA 4WK0B 4AIZA 2XZAH 2AK4B 2NTSP 4ZUVB 3QCVL 5JHDA 3U2SA 1MCLA 3K71B 1AZBA 4KROC 1AVAA 1NGXB 1FHNA 4WI0B 1JWUB 2VISB 1KN4H 3OSKA 4UU9B 4A67A 1P5DX 3KWVA 1LEGB 1ROCA 2A38A 3IFPB 4XPTL 5KBLA 3CWTA 2R69A 4MLIA 5T1JA 2E9WA 4NDMB 4ZMNA 3T6ZA 3II3A 3HBGA 3HHSA 4PS4L 1DZ0A 4Q4IA 3FN9A 3CVIL 4L8CB 2VZTA 3D87B 3GJEA 2C7UB 2UUDH 3H53A 2QZQA 4AV4A 1J88A 4ADGA 2X4UA 4NKMB 1J8HE 3CW7A 4AI7A 3RZWA 4IK6A 3HRZB 4M93B 1AGFA 5JR1L 5ADOL 1ZGLA 4GAGH 1T5WB 3SDXF 3D06A 3JBG7 3CH1B 3VWJB 2A9NL 3K2KA 2QV4A 5TTRA 4A1RA 3I9GH 4KJPC 3PWUA 4UB0H 2HPOA 3KVDD 2YA2A 3R18A 4P06A 4YFDB 3MUHL 4MCMA 1RK0A 1YRKA 4PJCB 1P9MC 1A3RH 4P4KB 3T8VA 4Z8FH 2RALA 3VI4B 2K3HA 5FGCB 4FL4C 4HHAA 4BK4A 1I53A 1HC1A 5GGUA 1IM3D 1FSKB 1UT2A 4G8EB 4FJZA 1X4XA 1GMEA 4WU5B 2DYSB 2J73A 4EQ3A 2W0FB 1IAIH 1VB9A 1K4CB 2B15A 1W15A 3MCKA 3QXTA 4JQIH 4L1SA 1JGUL 1NIAA 1RL1A 3TBTA 4Z3FA 1ZLWH 1QHPA 3IXTA 4FJYA 4RGOH 4A7VA 1KYUA 4Y1AA 4G82A 2F68X 2O6CA 3LRHA 4BFKA 1QRNE 2WQWA 1IC1A 3RY6C 2ZKXA 5JO5A 2FWUA 4PD4K 1ZA3A 4WWPA 2BP3A 3LHAA 3E1ZA 3EH1A 1G1YA 1DQQB 2CJ3A 2EC9U 3GB7A 1YYCA 1A02N 4K7PH 1CQYA 4FI8A 5HJBA 2DEXX 2BIIA 4HHWA 4TRPL 3D33A 1S46A 1TQCC 3WO3B 2V9UA 3NABL 5CZVL 3HUJF 2X0VA 4U1IB 5I1CH 4WHTA 1HSAB 2VR3A 2WGXA 5DR5L 4ORGB 4BUGA 5FYKU 2FHBA 1U8NB 1JZHA 4GI9A 3ROOB 4QOKD 3VFUA 5E94B 4C47A 1USZA 3N5AA 4DGUA 5IEKA 2J20A 3DK2A 1X9QA 1IAII 4ZPVB 4LARL 4NZRL 2WXNA 4ESKA 4X5RA 1EWHA 2QELA 4NN7B 2OR7A 5KBMA 2YLKA 3L4XA 5A2IH 4JDZA 1FORH 5LB1A 4AQ1C 4MJ6A 1OE2A 2O1AA 4X6FA 1U8PB 4S0SD 3ECVA 1QN7A 4HJTA 1JNLH 3CDFA 1IKFL 1I7RA 3OX8B 5HXMA 2X0UA 4LAQH 3NN8A 5K9JL 5F44A 3EYSH 4HJGB 5J3HC 2IBZX 4MX7A 3C8KB 3VXUD 4F7CB 3F0ZA 1P7QD 3AWEA 2CGYA 3CFKA 4X6DE 3P3TA 5JW5B 3AABA 3H9ZA 1PG7X 1SY6H 1DL7H 2W60B 5CFAA 4XZ4A 1ETA1 5KSBE 4ELME 4ZW6A 4KOCA 5TFSL 3NIFB 1ADQA 4N87A 4NEHB 4NUGH 3TNMB 4EI6A 1MCEA 2E7LC 2X09A 1IQWL 3HTLX 3MRHB 1QLEL 3WXWH 3TN0D 2FECI 3TWCH 3ZHKA 1SBSH 2P7TA 3C60C 5G5DA 4M1CC 5BZDB 4RETB 3QJVB 5FGBA 3SPCA 2A9MH 2VDPL 5E2VL 3WNPA 1N64H 3O8XC 4JM4H 4HKXB 4X7CC 1NGZB 3QORC 3SDCD 3IDMB 2GYSA 4J8RB 3EADA 5C0RL 3T2OA 2FIKB 3QUML 1FH5L 5I15H 5HI5D 4APQA 4LSDA 4MXWH 4HUCA 1PJ9A 3CHXA 1QO3B 1OF0A 2IQ9H 5D7IF 1WIPA 3X14A 3ESVF 4OJDH 3T04D 1LLAA 3MJ7A 3O4LE 2A6IB 3T4AA 3CLFH 3SPIA 2V2TB 3JVGC 3IDJB 4ZQKB 1IBGH 2ZYSA 2BNQB 2VMEA 4P05A 4PRHA 1AC6A 2ZSWB 2R2CA 4LBAA 4Y9BA 1DBBL 4IBSA 3X12A 2IH3A 1ZHBA 2B59A 3FTGB 4WFFD 5AYUL 2ATKA 5FOJA 2Z91A 2H6PA 3BP6B 1R75A 3H3BC 4FYRA 4XMWA 1A7RH 4IRJB 5L0QB 2WV3A 1EO5A 1SXBA 4JFUA 4XHJD 1NFIA 2N7AA 4N22A 1ASPA 4XPBL 2CMRH 1BEYL 3MRDB 4IBYA 4JAMB 3CVTA 4F7EA 1SMDA 3QQ9D 2ZUUA 1BA9A 4JKLA 3QHFL 4JHZA 1QSEA 5DDHA 1BFSA 2ZX5A 4XVUD 4OJCA 5HGAB 2F54D 2QL1A 1C1EH 2B1AH 5ACZB 5E1AA 3BE1H 3HB3C 5T33L 4GQ9H 4CNIA 2CO6B 2XSKA 1N6QH 3KM2A 3H4HA 1NEZG 3GBMH 5FYLH 1NIBA 3EOTL 5FW8A 2HPTA 2NY2C 3IFLH 3EAKA 4CGTA 2OM5A 2C4XA 3N41B 4WCYL 1ZGLP 4X6DA 1G9NL 4U6YB 5EZOL 5EHFA 2B4CL 4JO4H 2R1XB 1QPPA 3H7BB 4K9EC 4C4UA 5CEZD 3RVUC 3GTVA 3QO0A 4CU7A 2X4OA 3QJQB 4ELMA 1IVTA 4L8SB 1GXEA 3WHE1 4YBLB 2R2BA 4PJ7F 2A4EA 4NRYB 3ZK0A 3U46A 4XP9H 3ASWA 5C08E 4AZ8A 3X1GA 2R1YA 5FOBA 3KAAA 1OT4A 3BN3B 4RFOL 4ENEC 4BHUA 1UASA 1VOKA 3HZMA 1MRFL 2Z35A 1CIUA 5E2WH 7FABH 4PJHA 1D5ZA 1BLIA 5DD5H 3VFNA 3RL1B 4LSSL 3Q1EA 2QHRL 4KZEH 1YMMB 3MRMA 3BCFA 5D6CA 1F8TL 3TBWA 1PD0A 5JA8B 3DMMC 5H4YA 3RVXC 1P4UA 1CF8H 2B1OA 1NAKH 3MU3A 1BV8A 2FO8A 5BVJA 1NIFA 5EF2A 2AJYH 1SOSA 5GSRA 3QBTB 4B9KC 3WTYA 1ID2A 1XF4A 5GS2D 1T6AA 2FB4L 5DZAA 2ZXEB 3WNNA 2B8OT 3MZTA 4NFBA 6TAAA 3NCCB 4BRVA 3SGKC 3AADB 1MDTA 4ZOBA 4NHUA 3VA2C 1FVEA 1G9NC 1KJVB 2NT1A 3SBPA 3HFMH 5JYMA 2B4CC 4XBMA 2WLLB 1I7UB 1AG0A 4WFGD 3WEOA 3DTXB 5DZOA 5FO9A 2DMHA 3Q8BA 4MQ7A 3JWDH 2IBBA 2AI0L 2WWMC 3KBPA 2JMRA 5T3ZL 1P1VA 1TVBA 2AGJH 2CNYA 1LP9B 4K3GA 2XV6B 1OB0A 1HHIB 1X7QA 1JZFA 2WZ5A 4K94C 3BAJA 4LDCA 4QHUA 3RX8A 1EEUA 4WFHD 4Y5YC 3WUWA 3DXAE 3S9DB 4XN7A 4I0KA 2OXGA 3WXVL 5KW9L 1WBXB 3BW9B 5FYJE 4GI8A 3NSXA 3MLSL 4WEUD 4NO0B 5B3JE 1E4HA 2Y7QB 3H2QA 5EOQH 2X5PA 4QRSA 3MXWH 2HRHA 3AREB 3OWEA 1AO7D 1YEEH 4ZS7H 2VWEE 4EZJA 1AOHA 2IPKA 2K6WA 2R1WA 3MLTB 4H44C 3ULUD 4KUZH 5CJOH 3OAUH 4PM1A 2IWFA 5E03A 1XGUA 3MLZH 3Q13A 2D73A 3PWNA 4M7JH 1X5LA 3RIFF 4WHDA 1BG1A 2Q8BH 5I19L 2P48B 4PTTB 5C0FB 1KCUH 3C5JB 3DRQA 3RQ3A 4PPTA 4XTRD 5KBKA 4NWTH 5EA0L 3SBWC 4KBPA 1F11A 2HLAB 2DKMA 5HHQA 1R5IB 3HG1A 4PREB 5IFAL 2DMCA 3TP4A 3DBXB 3T5WA 2PXYC 1E27B 2IDTA 5AVQB 2BOCA 2FX7H 3PP4L 2V9JA 3KYOB 2ITFA 5IBUB 4Q11A 3HW7A 3CWSA 2AMGA 2BDNL 3MV8B 2HRLA 3GLEA 1B0IA 1WBYA 4YNYB 5DVMA 4JHVA 4KAQL 4PJAA 2EVGA 1OTTD 1Q72H 5I71C 3QGVA 4QAMB 5EU7C 2YRPA 4NC0B 1O7DE 1RIUL 2K7QA 1H3GA 3U82B 3BH9A 4ZXBC 1P4LB 3U1PA 5DJ8B 4DSYA 3VFPB 4BCYA 4XNQB 1YQLA 3VNYA 1J10A 5F7DA 5FHAL 2Z6FA 3H54A 3KPNA 3MBEA 4A2FA 3M7OA 3LZQA 4O02B 3AFLA 4WI6A 5EMYA 1NAMA 3ARGA 4GRLD 1HKLH 4TUOA 1SDDA 2F1BA 4HD9A 1E4XL 1BOGB 3FQYA 2R15A 5DTFA 5IVZB 2JE8A 1JDCA 1N19A 2XXCB 2W59A 4OIIL 5F8QC 5HHMD 4FFVD 1UOVA 3LNEA 3DXAA 1I9RH 3UAJA 3ROLA 1SJXA 1T1YB 5FO7A 4MNQB 1TVDA 3CX5J 2MOGA 5TDNB 1HQ4A 1HXYA 4MMXC 3TJHC 1IAMA 2RTTA 4D8PB 1N5YH 3BVDB 4RQQA 1ZS2A 3BKQX 4RODB 4OVUA 4MVBD 1EJOL 2NR6C 3NCYS 1I8MB 1A6ZB 2BFGA 2KS0A 3VVWA 1E40A 3DI3B 4AEFA 9PCYA 4XOAA 2GQHA 4OUOA 4BZ1L 4CSSA 1VGEH 1K6QL 2BIMA 4L9DA 5F3FA 1HINL 2ZWYA 3LCYA 5EWIH 1RUPL 2H9GB 4U6HA 5DZJA 1B3JA 1WYJA 4YHLH 4OR1A 4UM9A 4IU3A 3ARZA 4DN3H 3EOAB 4MXQC 4IM8A 4X5WA 1F18A 4FKEA 1BVZA 3C08L 5ID1B 2EO7A 3VGDA 4CA4A 4N4YB 4PJGB 1MCJA 3PYCA 5IB2B 1OTSC 2C3GA 3C5SA 3OGCB 2X4TA 2A77H 4HUUB 3DSNB 2PTUA 2R56H 1G7JB 3CH8A 3M86A 1KZYA 1RJYB 3MCLH 5D1QD 3ZZSA 4FG6D 4K7FA 4P59H 2P24B 5GGRB 4NKDB 2J7LA 4Z7UE 3T2NH 4X7TA 1KFAH 3WFBH 3KEHA 4EN3C 2H2PD 4QIRA 3HR5A 1EAPA 2MCG1 5GISL 1EO8H 3ARRA 3FB5A 3NSCA 3QXDA 3UG5A 4B3EA 3OXSA 4IKLA 2DMKA 2WKGA 2ZWSA 5AOIA 2Q8AH 1I8LA 1PY9A 4ZPTA 3GK8H 2ZSVA 4Y9FA 5LBVA 4JHBA 2M8XA 2V8LA 1MJUL 2ARWA 3F5WA 5SX5K 4KJYB 8FABA 4G7QB 3UX9B 2VITA 3VB9A 2I32A 1DVFB 2X2YA 3T0BA 3SJVB 1D3CA 1ZWIA 3CVHH 4DIXA 3IDXH 3F7KA 4O4YH 4LF3B 3GSVB 2J12B 2Q2LA 3G04B 5JOFA 3MACL 1TQBC 1B6DA 4MQXD 4ZUWB 4G7VL 5ELIA 1MFMA 1WIOA 2GBVA 3QDMB 4ZAKA 3LJ3A 5IVXF 4RISH 1T22B 2B7DT 1HH6B 1JGEB 3PHOA 1A4KA 1EDYA 4H4NA 5AQ0A 5AALA 3UJJL 3UPAA 4R0LB 1XGRB 2KDGA 2JVUA 4TQ8A 3WLWD 1F3DH 3BWUF 3NT0A 1MF2L 4KI5F 4HEME 1K2DB 1UCTA 1QSFA 1IAKB 2CRZA 5D7JC 5JPMA 1RIHL 4NHCL 2W80C 2GBTA 1DDTA 4PJ8D 3WE6B 2Y0SA 3ATAA 2KPWA 4Q6KA 3BSZL 5F9OH 4AVJA 4FQHB 1V5JA 1REIA 2WCSA 4MWFB 1L0PA 3W3BA 2OR9H 1ZS8A 2W9EL 5AW2B 2I60H 3EG9A 3KWUA 4QD2E 3NJNA 4JFFD 2EIBA 3FFCA 4FC3E 4PI2A 5IESL 1QFWI 3HE7A 3TNNA 1JNHA 2WXPA 2A6KB 2WNWA 1GZPA 3HI5H 3TBCA 1HE8A 4Y5VA 3ETBJ 5EORH 4Z7UF 2PPCA 3N06B 4KVPA 2O61B 3QG6B 3EFDH 4HCRA 4ODHL 1IC4H 1C5CL 2BIHA 3I50L 1YY9D 4PB0H 3ZL4H 4XNZB 4TUJB 3G9AB 5H37H 4I3RL 1PJWA 5DEGA 2HJKB 1U92B 4O5LL 1AZVA 1DCEA 3Q9QA 1YNKH 2NOZA 2OTUB 2IG2H 2BRRL 5KSUB 1CGTA 1U95B 2DD8L 1KTLB 2X70A 1X9UA 3OSTA 4XPGH 1LO3H 3HIZA 5IBLC 1MXDA 2G60H 1GH7A 2OL3A 1OXYA 2EXWD 3R0MA 5L2KB 1YQMA 2X42A 5HD8D 4U1HA 5DYOB 1MI5E 3U0WH 2FO4B 2K9UA 1I7ZB 4BXSV 2DQUH 3BZEA 4MCNA 5AOKA 2CHXA 2ZAHA 2NY5H 3EYQC 4FP8L 5CINH 5DI8A 1QN3A 1TJGL 5BO1H 4UT9A 4YGAB 1FVCB 3QQDA 3P54A 5T5NF 4ZD3H 5KG9B 2KZ1B 2B14A 3HG0A 2PYED 2VDML 1BF2A 5C0CB 1ILSA 1F3RB 1OE1A 2N56A 3B6SB 5FM8A 4GUQA 2YBRA 3MODH 3MI6A 5HPMA 1U8IB 1FFPB 4XWOD 5EO0A 2GSIB 3D09A 4Z3EA 2P8PA 4MB1A 1P9MA 1D5BB 1MIML 2P52A 1Z9NA 3APCA 4YXHL 1OP5H 3WFCL 3IGLA 5IYCP 1BQKA 1N2RA 2X44D 3A21A 2NT0A 2NY1B 2Z93B 3FQUB 3KYNA 2FEEL 3O6FD 3T0AA 5D2LB 4R8WH 1Q9WA 1YEDB 4RRPG 3BD5A 1R3LB 1YJDL 4YHKH 3KCPA 3TBVB 2ARJQ 1NCIA 2WBXA 1PCJX 3FQ4A 4IHOA 3D69A 2HVKA 1F58H 4W81A 1OF2B 1KGCD 3PQYA 3PHAA 1F6LL 1WZMA 3GKWL 4HAFA 4MZ2A 4MD4A 4XVSH 4BWWA 3RY6A 1DLHA 1AKJB 2QPFA 2DWDB 4EXPX 5I0DA 3U2JA 3BQUB 3UXFA 1ZSHA 3L3IB 4U1KB 2EAEA 3RAJH 3RUGB 4FQLL 5IB1A 2MQ0A 1FL5B 3IYLW 4FS0A 3SODB 3LSOB 5DS8B 2H1PH 1OTUC 5LCVH 1U8JB 5FK9B 1JHLL 1KXQE 3RVVC 2HYMA 1AGCB 1XR8A 2DB8A 3EJYC 2EADA 2WSDA 1CZ8H 4B97A 2ATPB 4XMVA 5IGXH 4KPHL 4H25A 2IADB 4ORZC 5ESAB 3BISA 1SXCA 2PW2A 3BXNA 3MUUA 5EO9B 2NYYD 4YUEH 3FZUC 3BESR 3T6WA 3KJ4C 4LHUG 3WSQL 2Y7SA 1EVUA 2R0WL 3F04A 1YJDC 3NAAH 3OJDB 4I3SH 1RK1B 2VXQA 4P5KA 4YBQD 1IGJB 4ZOCA 3RZCD 1IBDA 4JR9H 3HE6C 2W65B 4UWQB 2IANB 1ZA6A 1JHTB 1HWHB 2OMYA 2LU4A 1IAIM 3LVTA 4Q8BA 1EEYA 4HWUA 1DBKL 1KBKA 4YZFF 3BLBA 5TF0A 1V7NL 1LE5B 3W0WE 1WICA 1RU9H 1YNTF 2YD7A 4OCMC 4R7XA 1FJ1A 1MFBL 5D1ZC 3EJPA 3S37X 1ETZA 5C0AB 2VAAB 1BWWA 1E42A 5EUOF 3BN9D 5DO2D 4ZO8A 3VXQB 4E42B 1CE6B 3M1BB 4F8LA 4GIPD 3GIZH 5JNYB 2CQVA 1E6JH 2Y23A 1R3JB 2G30A 2XZQL 3P2BA 1ZLVH 2E7LA 3RDTD 3I6GB 1IBHA 1RIVL 4AYFA 3V4PL 4P9ML 1EEQA 3I6SA 3RY4A 2IPUK 3S4SA 3MLVH 3VCLB 1S7QA 4R7DA 3NFPA 3PABA 3NCFB 4L3EA 2CBQA 3N1FC 4U4IA 1H5BB 5CMAB 2IAMD 3GM0A 5DRWA 4KKBC 3NFSL 2APFA 3TZVD 1HU0A 2D4DA 3L3OA 1OGTB 3BUYA 3DX9A 5C86A 3TEWA 1TBPA 2OZ4L 3NA5A 5JXAH 4Q0XL 1GPOL 4AXWA 4JN1H 4HK0A 3HC0B 2DM7A 4XN9A 3WS6A 2VQ1B 1BGXH 1RZFH 1LK2A 1INEL 1XTMA 3UCRA 1JF1A 3BT2L 1D5XA 1XAUA 4HEPG 2PTTA 1URLA 2DQEL 2AJUL 3JVGA 2CAKA 2YEQA 3M8OL 4WWNA 3LQAL 4JO3L 4FFZL 4ZMOA 3FTVA 4WAFA 4QT5B 3BIKA 1IBZA 1V05A 3ZN6A 3GEWB 5EU6B 1Y6KR 1VADB 4AUJA 5ACMA 3RJDA 5JOPE 2V17L 3QEGL 1B0GA 1FZKB 3LXCA 1HNFA 2H2SC 4HUVA 5BS0B 3RVWD 1YN7B 4DKEH 4QRRE 4TUKL 4GS7C 4IRZL 3QDGB 1TDQA 4XP4L 2YJLA 3APMA 1F4YL 4MDIB 3S5LB 2J5LB 3RURA 3VQ2C 3QAZB 5B3NA 1HXMA 3KLDA 2CA3A 2VH5H 3EGXB 1I9EA 2MCAA 3W0WA 2DLGA 3ZJAA 3SNSA 3FU0A 5EB9A 4RGMC 4MS8D 4AG4L 4KY2A 2EVHA 5DQ9A 1UD3A 5HHOA 1A21A 1XWVA 5CILH 3VD9A 2VIRA 3EIFA 4WTQA 3S98A 3FRUB 3L13A 3LQAC 1LK3H 2DBLH 3PL6D 5HDQL 3MBWA 4E5XB 5T1LD 4JE0A 5I0XA 4F8PA 1OCWH 2A2QT 2BVPB 2BP8A 3NPSB 6PAZA 4L4VB 5FUCE 4ZMXA 1TZGL 2LFGA 3GBNH 2ESVE 2JCCF 3JWOL 1MVUB 4FZEL 4OGXL 5IHWA 1U6AL 3UZQA 1NWPA 2Y24A 5AUMA 5DURB 4JHWH 2EE9A 3KM1A 2N1TE 3SZ6A 4DO5A 2R8SH 4GJTB 1NCBH 4OZGB 4BE5A 1ACZA 3WIHA 4EUPH 3KLHC 1KJ2L 1BM7A 3KPRA 3QJXA 4I18C 5IUSA 2PCYA 2CKBB 2I24N 1KCRH 4YSOA 3TXAA 15C8H 1WH0A 3IEAA 4WGWB 2ICCA 3ABZA 2QPEB 3ILQD 2WTRB 1AXTL 4AYBA 1RJZB 2HJLB 1LMKA 1HI6B 4S2SB 5EIIA 3HG4A 2V6HA 3SGKA 4PGEA 1AP2B 5E8NA 5IIEA 2ITCA 1F3DJ 4LHQB 2AK4D 4GG6E 5BMNA 3LXAA 4LGPB 5GPRA 2CO2A 5FO8B 1A4BA 2BS9A 4UTCA 5EZIL 5IMKB 5K59E 5MI0B 1CICB 3O2WH 4IDLA 4AYEC 5DVLA 2EC9T 3MNMA 5IHUH 3BPCA 3P3YA 2C26A 2C9XA 3OC8A 3W37A 1AE6H 1BZ9B 2CUMA 1U33A 1C7SA 4W9JC 1NDGB 2H6UA 3DV4A 4QTHA 4ZDHA 3VXPB 1U91A 1W72A 2JFCA 1JZJA 4JFXB 3QIBD 4X6CF 4PYHA 3P3UA 4JO2L 1FLTX 1EJ8A 3U4AA 3ZE0E 3JWOC 1MCSA 4QRRA 1JDAA 2TSAA 4RDBA 4WKZB 3HA0A 1TZHB 1BXUA 5IG7A 3WCYA 2ITDB 3FU5A 5TE4L 4A2HA 5LNDA 3OKYA 3VWJD 2R2HA 3UTQA 2A6DB 1J5DA 4ZUSB 4MJ5A 5GGRY 1OP4A 3ZLQC 3GXDA 5SV3A 4AWJC 1I4FB 1UZ8B 2NUTA 2OXHA 2GJZB 3ULUF 4WEBH 5DLMH 2QJDA 4KVNH 4NJAL 4PQXA 1Q9LB 3RIFK 5D7HA 4P4KD 3IMVA 3U36B 2HL9A 4DQOH 3O6ML 4R2GB 4UTAA 5EUKA 4NGHH 1MFAL 2PW1A 4YHZH 4HKJA 5HHVL 2DKSA 1MFDL 3BP7A 4PJ5E 5IJCC 4HGKC 3OC3C 2EDQA 2YAQA 4FNUA 3P0VL 1LDPL 2J6WA 4WJ5A 1S8DB 1BIIB 1GW6A 2APSA 2HB0A 4JFED 4M6AA 1NFDE 3OB0K 5IFJA 3F3HA 4H40A 4U3CA 4DP7X 1QFPA 5DUJA 3SBWA 2C3HA 3Q06A 1O6TA 4AMKL 3WELA 3RTQC 3L3JB 3OZ9L 1KFGA 1R24B 1NDMB 4YPJA 4NPJA 2PXYA 2P4AB 2PCFB 4PW4A 3EHBB 5KYWB 1CXEA 1GVIA 4LP4A 1S7TB 5E00A 5E4OA 4R7LA 4PJIE 5IMOB 4U1NA 2XTJB 5I28A 2BMKA 3FS9A 4NQUA 5KVFH 3CFQA 2WMPB 4GG6F 1DQTA 4PGCB 3G5ZB 1OGAB 1OP9A 3ISRA 3VJ6B 3SPVA 4Z77A 3ZYZA 4JANA 5DUBA 5B39A 3RWGA 4Y4KC 2DQIL 3QRFM 5F7EL 4UAOB 1BZDA 1UZ6E 5IEHA 2YEZB 4UUJA 1S7SB 1NQBA 1K72A 4WO4B 3U4EA 3NABH 4DOHB 2EVJA 3BX7C 3MXVL 4QRPB 5C70A 3LKNB 5BMFH 3IMBA 1DQJA 4IIQA 5IJBC 1VCAA 4EI5C 2WVVA 5C0DA 3Q43A 2ZCKL 4QXTB 4W1TA 3L1OH 4DHLA 1CURA 1PIFA 3KPLB 3ZZ1A 2QPUA 3DX8A 4MA3A 4I1NB 3GMRB 4HKZB 4HIIB 4OSUH 4XR8C 3RE0A 3T09A 4IRSC 5BW7C 2GHZA 1DQIA 4EMZA 5EC2A 1KACB 4MYPA 4KZ0A 2Z31B 4KKCD 4UV7H 3UPRB 4HLJA 2NDFA 2XWDA 4L8DA 1QRKA 3HVDA 1BQHG 1I1FA 1SMOA 4JMNA 3S5ZA 4CSPA 2EDMA 3I3EA 2DLIA 3QWNA 4D9LL 3HAEH 4YDIH 2J44A 3RB5A 2HG5A 3MCG1 1QW9A 3QFJE 2NR6A 3MUJA 4ZFQA 3WUZA 1NGQL 5HGDB 3L4YA 3EYFB 3SBRA 4DVBB 5GHWH 5T5NG 1K2YX 3BGFB 2H8PB 4PLJD 1JD9A 3TEXA 5SX4H 3FN0H 4HCIA 3WO4C 2QKIA 3WGVB 1B9ZA 4XI5C 4OFPA 3T2LA 3FB7B 3SE8H 1ETJA 4UNIA 1A7PH 1E2VA 1GZQB 2VLKE 4NQDE 5C71A 3QS3A 1XH3A 5AVZB 2OOYA 3PJNA 1KLGB 1VTOA 1VJSA 5LBSL 4OGYH 3QZOA 3UYRH 1TR7A 4LIQL 5DJXB 4MMZA 4GAFB 4FA7B 4U1GB 1BMGA 4NUJA 5L8LB 3IJSA 1FVDB 2SEBA 1UUNA 5IB5A 5E1IA 3T1WA 3ESMA 3B2UD 4N6RB 1JXFA 1I3UA 1HEJC 4HS3B 4A68A 2RJMA 3MLRL 4N8VB 1CVRA 2XV2A 4A6YL 1WD8A 1OB1B 2FT7A 5D70L 3CHOA 3CHSA 5D72L 5K39B 4NFCA 3UTTB 4NUPA 2DQGL 1JN6B 4JZJB 4L1HA 2G5UA 4AGQA 5J6GA 5EH1A 4JRXE 2EH7L 2WXLA 3IGAB 2CUIA 4EDWH 4IRJD 4X7DC 1PEZA 4XE5B 3WL9B 3MLPA 2K8QA 2X9ZA 1P1ZB 5C6WH 1XIWC 2VW7A 4OJAA 4M61A 3QI9B 1WS7A 4YSTA 3HN8A 4PJXF 4HK3N 2L7EA 3DJTA 4OKVB 1XF2B 3P9LA 3CX5K 2VR8A 2VZUA 3BCDA 3D39E 3F12A 3VXSB 2YMXH 3QZWG 1B3IA 2IGFL 3I2CH 1CI3M 2JK5B 3GGWB 5F88B 3FOLB 4OJFH 2F7IA 4P5TC 3VD1A 5ICXB 3CPUA 4E0RA 5B7FA 1A8ZA 3L2NA 5HGBB 5A2LH 5LWYL 2I27N 2J43A 2IFFL 4MA1C 4QTIH 1UM6L 4HUWB 3NH7H 5D7JA 5FECA 2ICWI 3NJJA 1H6FA 3L3KA 1BREA 3DPTA 4LFHD 4PJBA 4H88L 4W9CC 1UWFA 4JDEB 3H1ZA 5JN5A 2ISDA 4PRPE 2RD0A 1TJIH 2FJGB 4IEFA 4JY6B 3OG4B 4I5BA 4JUSA 4NO5B 3P77B 1BFVH 4RMRA 2VLKA 5HJ3A 4YLCA 2F74A 1KTRL 1WFTA 1IC5L 3WIFB 3MDJA 4KROB 3IXAB 2CGRL 2JH2A 3NTCL 4LVHC 4AQZA 3KLAB 1YMMD 2Y1YA 4JFZL 4M8QA 5B3SB 1PY0A 2OK0L 2BWQA 3FO9B 3QP3A 4LVEA 4AJVA 2AJVH 4S11A 4BA8A 4KKAD 3CLEH 3CFIC 3T3PE 4HS8L 5EFIB 2UY6A 4F92B 1QFWM 3R4RA 3KPMA 4TQIA 4OD2B 2D7QA 3ZDZF 1PZCA 2CBTA 2P49B 4I89A 4WFEE 1AS6A 1CFNA 4EUPB 5KUMA 4L4JA 3SE4C 4HX1B 3EYUL 5HHNA 3JZ7A 4YAQB 1QBMH 2XVLA 3FT4B 2CIKA 2Z8UA 3PHQA 1T20A 5CSGA 3Q5OA 5C0BA 1HEZB 1MWAH 1N8ZB 2DIBA 4WW2C 2BCKB 1HHHA 3I6LD 3STLA 4KTEH 1SXZA 1S9YB 5FWRA 3B3IB 1NICA 5LAPA 4XB3A 4JPWH 2K8MA 4PJDA 3B2MA 4R4FL 4R26H 3H6AA 1U3YA 2WKOF 4XP1L 5E6IB 5FA4A 2EIKB 4FL4B 3QUXB 3IJ8A 2IWGA 1S7VA 4JKWA 5IW1B 5K93A 1TGHA 5DHVH 4RWYH 1ZV2A 3WBDA 3NQIA 4LCWE 4J27A 1F2XK 3OKEB 2E7HA 4KXAA 3LB6D 2O5XH 1SEBB 1MUJA 3ZT6A 1BQRA 1JYWA 1WQVT 1G7LB 1CLYH 2ATAA 2GITB 3EDFA 1U3NA 2CLRA 2J57A 4BKSC 4H1LG 4LKCB 3TA3A 2J6EA 2CUAA 2X41A 2A73B 1FV1B 3ARED 3GMOA 1FC2D 4NQSA 4OZFB 1RPKA 4DGWC 2EIDA 4DZ8A 2H41A 4GBXC 2A9BA 3BMVA 4ZFGL 5L9DL 1CFVL 2P5EB 1YN6B 2VLJE 3GHPA 3LN5A 1CUOA 4QI3A 5C2BH 3PRZA 1KEMH 2VQ4A 4MKMA 3K72A 2NY4C 2V7NA 4LDEB 3VXTA 1UXLA 1FGNH 3Q44A 4Y16B 4OZHB 5F0LB 1DANT 3FL7A 3QARA 4U1LB 1DLFH 3O9WA 4G8IA 1Q9KB 2ADGA 2GJ6E 3BEVA 1LEIB 3RWHB 4NYLA 3R19A 4AM0A 4IGBC 4Z7NE 3IU3A 3WFHA 3PGCA 2GABA 3LPPA 2AJXL 5F72S 1GCFA 1H6EA 1I1RA 5IP4A 1JAEA 3I9PA 1T83A 2NYKA 4AQ1B 5JW4N 5JHLL 3BRGC 3PWLB 3VXRE 1ZT7B 2H45A 4FTVE 3O3BA 4WJKB 4A7GF 1KUMA 3OD3A 3OKOB 3IMSA 3D0LB 1BAGA 4HIEA 3KJ6L 4KI5C 5B4MC 2J8OA 2JKJA 4WUUE 4R3SB 1T0MB 3M17B 3HCVA 1AS7A 1JGDB 1C8QA 1Z0MA 2YPLE 2KLSA 2R29A 3WKNA 4PRIB 4B5ZA 3L17A 2ZP9A 1MH5B 4XAKE 1QNAA 1JV5B 3J07A 4U2YA 1NBVL 5CIPH 2AQRA 2ADJA 1BXVA 2GTQA 4NO2B 4TNVF 3OKNA 5E8EA 3C60B 4LCWA 5GS3A 5C7ZA 4NIKB 4ACTA 4QHMA 4MNQD 1M2VB 2Z4TA 4KHTL 2KT6A 3IKCA 3RILA 4LSRL 3O8XB 3L7FA 2XN9D 4G83A 4DCQA 3CQFA 3QORB 1XMWA 3AROA 3FJTA 1MCPH 4JKPH 5ETUB 3GSNL 3RA7L 5JW3L 3F62A 4Y2DC 3U25A 3IGKA 1DEEA 5T5FA 4Y19B 1KDIA 3NZ8B 3HAEB 3QUGA 4L9LA 5C3TA 3STBA 1FIEA 5I5JA 3JSSA 4F80A 1NCJA 1E90A 4TXVB 4NKIL 4DJMA 1E4JA 2A0LD 1DQLL 5I26A 1EJFA 1L0XA 3OLIA 4Z7AA 4O2EB 1EV2E 4XN4A 4XHQA 1G1OA 5ALCL 4IBQA 3L9YA 3BWZA 2WTOA 1J86A 4AKOA 5EOTA 2FTAA 4F3FA 1DBJH 3ATFA 3NIDB 3WNMA 2ZOUA 1E4XI 5DK3A 3U4KA 2V7HA 1QLRA 5DEZA 4OZIB 1PYWA 4JO8A 1UT9A 2VZOA 3BVUA 3CIAA 3FAWA 1MQKL 1TVHB 3HG2A 4J6IA 4R90H 1AGBB 3UP1A 3SDXA 1QEXA 2AXWA 1VFAA 4HC1A 1WWWX 2VDPB 3HB3B 4OCRL 3VXRA 5DRNA 1DP0A 4U3SA 1UJ3A 3CGTA 4PVLA 1R3KA 4G80A 2H47C 3UBHA 3NJLA 3QUMB 4NENA 2X4QB 2FAUA 3FH8A 1X4ZA 1Z3GH 3NJVA 5EO1A 4JRYA 2B1HL 2EP6A 3WNOA 3D3VA 3HMXA 4PH8A 2YPLA 3H9SB 5HYJB 1DVFD 5CR8A 3V4PA 2KH2B 2X6CA 2ICWB 1HDMA 2AAAA 4QRQB 5E2TH 4WTZA 5I0WA 3NSYA 4MJIA 3IJEA 2Z0BA 5DMGC 3EH4B 4ZFOB 4JFPA 4E68A 3K6NA 2VR5A 2ICEC 3WN5B 1KELH 5I1IH 2WB1A 3LKOA 3MMEA 3N40F 2QMJA 3QDMD 4P57B 1KB9J 3D4GA 1MKFA 1EQWA 1A22B 1F90L 2B2XH 3Q8CA 4Q2ZA 3CAFA 4OFDA 3V0VA 4EAJA 5CEYA 1ORQA 1XCXA 2G9KA 1JE6A 4U05A 5TF1H 3S35X 5CEXB 3DMMB 3TFKD 1L5GA 2V5RA 3DX6A 4P2RE 1UT1A 5FYLD 4ODBD 5EN2A 2JB5H 1XGPA 1CXFA 3G5VB 4JG0H 3RGVC 5FW7A 1EXGA 1YLBB 3WU1A 3HPLA 2I9LB 3CK0L 2EEFA 1CLZH 4HQQL 1UWGL 2IQAA 1RCYA 4UT6A 5ANHA 3GSUB 1ZLUK 3MRRB 2HKAA 3DTDA 2JKWA 1U8KB 1ED3B 3B8SA 4JRLA 1KGWA 4ZK8A 1HXKA 1CT8B 2VDRL 3IMTA 4NP4L 4Q74A 4YS4A 5D4IA 1HCVA 2XKNB 3LZFH 2VN4A 5C9JA 1L0YA 3HZKA 4ONHA 4DAGH 5MENE 5ISZB 4RMTA 4XOBA 4I18A 4H8QA 3PG2A 3MGAA 1DJWA 5JYLA 3UTZB 1S5IH 5TQ0H 3GSXA 3KR3L 2O5ZL 3I6KA 4NC1E 2D0AA 4IRZA 3IBEA 1TJXA 3H9HA 3QEHA 3SE6A 3KHQA 4G8FA 3FPYA 1A6WH 3M6DA 1EZUA 4N0UA 4Y5YB 4W9LC 3A47A 3S5YA 1PZ5B 5F3BA 2UXVA 1PCZA 4A55A 5KZCB 1MQ8A 3CV5A 3IM1A 3VXMB 4FFYA 1QI3A 4EVNA 1GJIA 2Y8QA 1ETB1 4UOZA 3LS5L 4HFUH 4AKQA 4MXVF 1UM4L 3CQQA 3L9RB 2JB6A 4KDTA 5L2KD 2BLFA 1DSFL 2VC2L 3E6HB 4TVUA 2VZVA 3KPPA 4P99A 2JTDA 1MWAB 3P4OB 4NWUH 3STZB 2P46B 1IZJA 2XRAH 1ZHNA 4JDVB 3SDCC 4M6NH 2V5YA 1FAIH 3LEVL 5B38G 4XNYH 1J05A 2L7QA 5EZLB 3SYCA 4HWEL 5HI5C 2UZYB 1T04A 5MHSD 2WIMA 3DGGA 3MR9A 1EBAA 2YMOA 1F45A 1JTOA 1WTLA 5D7IA 5C0CD 3BHBB 3QO1B 1XGYH 4PJCF 5HGHA 3D0VA 3VI4F 3D7PA 4XMKH 3FQWB 1KZQA 1UKTA 4HJUA 3DJRA 1PF3A 5FB8A 4HPYL 4AEIH 1PCXA 5L2JB 3TDHA 4I1RA 1PFCA 4DN4H 1SQ2N 1TTRA 5J7CC 4OLYL 2UZXB 5A16B 5LXGL 1I9JH 1GGCH 3CFEB 4I77L 5F1OB 2CHNA 5KSVA 4PY8I 3PDKA 1FDLL 2P5WE 5HTSA 4B96A 3H85A 5DJAB 3FB6B 4ALAL 2BIOA 2MQ3A 5EOCJ 1INQA 3FUMA 4ZXBB 3RTQA 2F53A 2V3EA 4GMSH 3SO3B 5T3XE 1TCMA 2VLRE 3WKPA 4B50A 1AKJD 2Y8LA 5LVEA 4XVUC 3QQ4B 3D34A 3BQUD 3O6KL 2OAAA 4GUPB 4PLNC 2FVNA 4OKDA 4G8GE 1CR9H 5HYSG 1DVUA 2XETA 1J5OH 4L1BA 5D8JH 2D9QB 2NXYC 3BH8A 5AOLA 5F7WC 3NSDA 4N2BA 3WTWA 1UFGA 3QZMA 2ADFL 3T4NA 2ZAIA 2UZPA 2NNCA 4ZOEA 3SKNA 3EJZD 2HMID 1FGVH 4P2QB 1Z7JA 2ZPKL 2ED6A 4XPAL 5FC9A 5I6MA 4OCWH 4DKFL 1TQSA 4X2UA 4NAMA 3LEYL 3SO5A 1SEQL 2G75B 4TN9A 2JLPA 4UZGA 4MMXB 5DUMH 2DQ6A 3OTTA 3P73A 4F58H 5D5ME 4UCFA 1OLLA 3ZE1E 5IQ9A 3IFNL 3VFGL 4FXGA 3AITA 4PJ7A 2FEEI 4QR7A 2R69H 4JNXA 3W9EA 3KBFA 5F1NA 4G9FA 2G2RA 1CGSH 1UB5B 2YXMA 4HCGA 3FOMA 4AQEA 4WUKL 3TIDB 4TQEL 2PPEA 4XMLH 4R97B 4HUXB 2IAND 1XCTA 4OFQA 5DMIL 4ALAC 1CDUA 2WSPA 1OD7A 1RUAL 5CGTA 5GGSA 3CUPB 1MREH 2FWOB 1G7IB 1T7WA 3IMRA 4G3YH 4GAJH 5A6IA 3FTXA 1MJ7L 5CIPB 3C9NB 3KPQB 1T7XA 5D1ZI 2NZ1A 1NMCC 5C0AD 1ODAA 1M4KA 2VSKB 3ULUL 5L7XL 3NIFF 3UJIL 3GMNA 4HXAL 2ZONA 4Z78B 1VGKA 2D9CA 4GPVA 2F7QA 4LSPL 4I48A 3SB3A 4QJ4B 2NVMA 1GHFH 2P26A 1LVEA 2EYTA 3CMOH 4N0CD 5A7BA 4LB8A 1EZLA 4YSPA 4AT6A 3IVKA 4EN3B 5SWZA 4JFQA 3LRMA 5F97E 4WDIB 2VUKA 3N1PC 3KNBA 4WTWA 4Z7OB 1L7TL 2Z8VC 3WD5L 4BINA 1WAAF 3PGFH 1TEFA 2EUWA 4GRWH 1LJMA 5C09B 1UJTA 1TEYA 2DQJH 3IJYB 1H0DA 2WIIA 2VLRA 2XACC 5T1DH 2OP4L 3EFFA 3GIVB 4P0DA 4NQEA 3ALPA 3NDYE 4Q14A 3V0WH 1T66D 3NFSH 4KOBA 3TH2T 4O2FA 2Q86B 5G4OA 4TVSa 1NCOA 3CFBB 5CSZA 3DX2A 4PWIA 3DHJA 4PV9A 1U3HC 3FU7A 3VE0B 2NLJB 4KX7A 5E08H 3QWRA 4Y5XC 1BLNA 3A67H 2QADD 3LHPL 2ZOLB 1FQ9C 3ZGHA 2P5PA 5GXBB 5IQNA 2WXGA 3ULUC 1ROWA 4JG1H 4OFYA 2GBAA 5EU6D 1FN7A 1JL8A 2P3YA 2BOBA 4NBXB 4JO3H 4PLKD 3PNWA 4F93B 5CGMA 1XIWA 4MAYB 1U4EA 4AEEA 4GFXA 2V92A 1RZ8B 1I3GH 3DUUB 4DUVA 2PWFA 3FO0L 2A7BA 4KFMA 3NJKA 5BZZA 3K74B 4FF9A 2BSBA 2E46A 4NSKB 5FUCC 3KPSB 3G5YB 4CFFA 4XTRC 1KIPA 5BS0D 1S9WB 4GXFA 3TA4D 2CLVB 2PPFA 3QCUH 3VFTB 1J1PH 1QKZH 2VDKL 4GG8A 3FN3A 4QPEA 1X5MA 1M3IA 2HFFA 5LAXB 1J0IA 1NEZB 3A4DA 5L8KB 1E3XA 4YPGA 3B2VL 3N1QC 3UBXG 1JI1A 1OTTC 1V55B 3BVXA 4NM4L 4CN6A 4X98A 5F7LB 3SOBL 2DDQH 2E0PA 2A83B 3ARTA 4F8QA 1ADQH 2Y9RT 2C3VB 1IRAY 3DRTA 4HZ1A 2P8MB 3ARDB 4P3DA 1CQKA 2B20A 3HVNA 1BP3B 4ELDA 4HMCA 4KMQA 2M83A 1E5CA 3DVGB 4L4VD 4OIFA 3NVQA 4GRLC 4CBPA 2WXQA 1L3NA 3VI3E 2OA9A 4EQ2A 1A2YA 5DURD 1FYTE 1NIEA 4X4ME 4FA8A 1ZHLA 3S96B 1NMBH 4ZMQA 1MVYA 1HHJB 3MJ9A 5A1AA 4P2YA 4FFVC 4FZEH 6CGTA 5I17B 2AZUA 1VHPA 3QNXB 3FT0A 5IW6B 1HOCB 5EPCA 3Q8EA 2Q7AA 1Z5HA 4B0MB 2YK1L 1CVSC 4PJEB 2N59A 3SE4A 4UYPA 1EEZA 2WGNB 3QDAA 1ZLVK 1IILE 3LIZL 1IMHC 1P6FA 1N18A 5GZOD 5DMKA 3UGUA 3UG3A 1CICD 1OZTG 3QQ3A 2ADIA 2FJUB 4NZUL 2VDNL 4X8GA 3W2DH 3WFDH 3ENOC 1SXSA 4XH2A 3U4BH 1T4KB 1NCCH 1LP9F 4POYA 2OMVB 3WJMB 3FH5A 2EDKA 2QQQA 5D71L 4FYSA 5F1IA 4KQ0A 3OLGA 1NCWH 2X7LB 3WKYA 3BPNC 1A65A 3UTPE 4FQ1H 4M48H 4JLRB 1JUFB 4YGVA 3F7VA 4M3HA 4PP1C 5CBEA 4RGNE 3D2UB 2Z65C 3V5DB 3R1GH 4FG6C 1J0KA 1OPGL 3MYJA 3EZJB 1ZOXA 2H2PC 3IF1B 4TSCL 3L4UA 1Y0LB 2TRHA 1AQ8A 3DPUA 5I1JH 4YHIB 4WY7L 4R2GD 4OF3A 1RZIA 3AAZB 1ZV5A 3QULA 5IMLA 2WXFA 5GRJL 3BDBA 1VCBC 1K8DB 3MRBA 4A7QA 3PDOB 2A9CA 2A99A 2B0SL 3BDYH 4LCUB 2I07B 1A1OB 3QZLA 3EFOB 4WKXA 1U8HB 2VDMB 1AQHA 4I9XA 4N5UA 1JZGA 3PAVA 3Q3GB 1TMQA 2NMSA 3IFOA 2FX8L 2E7MA 2XVGA 3NIGF 3JXAA 1AJ7L 3VI3A 2HLFD 1CBJA 3OAYH 5CZKA 1ZD6A 1DBAH 1XF1A 3COOA 3EHBD 3H55A 3QFGA 1H3VA 4IGBA 1X44A 4GSXA 1MPAH 4HMDA 4QRUB 3RHWK 3KJ4B 3ZE2B 3NMEA 2DAVA 1CD0A 2ZUWA 1E2ZA 4H2AA 1IV8A 4LLWA 2XTJD 4MQXC 4OLWH 4PS7A 3ZDYE 2FGTA 2F5BL 2UWEE 1AZUA 5IVXA 1N3NA 4OLZH 5FCUH 1OGAD 3F2LA 3HE6B 1WTGT 2A9DA 4XVJH 4YDZA 4WLCA 2GEQA 2NW3A 4F91B 2OCCB 1AIFB 2EYRB 1KLUA 5BJTB 2X4SA 2VXSL 3UC0H 4J4PA 4NN6C 4WO4D 3BMWA 1O6VA 1TQUA 3QISA 2DIJA 5D1ZB 2CZNA 3LS4L 1SLWA 5IREA 2PKDA 3EGSB 5KSAA 5DHYB 1QUNA 3ARQA 2OTPA 1MLBA 5H35A 4OCSL 1SM3H 4AW4A 5KYUB 4Z3JA 1KB5L 1A14L 3KH3A 3DO3A 1U8LA 3CNKA 5GJSH 1J1XL 1UA6L 2XLLA 3TS8A 2IAAC 5C9KA 1QN5A 4BJUA 5MEPB 4P4RB 3TIEA 4AL8L 2YN5A 3OMZA 1QEWA 2IPTL 4OGZA 5E8OA 5C07A 4UM8A 3G5XA 2Z31D 3N43F 4ZS6D 3U0PA 1YAIA 5CHNA 3VMNA 4JJOA 5ICZA 4Q6IC 2FYYA 4DEPC 3JQOB 4Z76B 5DJZB 4OIBA 2IPUG 3GJFB 5AZ2H 1E4WL 1GIGH 4PVNA 5I66A 4ONGH 4GMTH 4Y2DA 2AXFA 1ZGLB 3MRIA 3S48A 2NNFA 1A6AB 1R47A 4J3OH 4WI7A 1I1CA 5TDPB 4HIPA 3LDBB 1MHPH 1UWYA 1VPOH 1IAOA 1E0OB 3O11B 2Z4QA 3TO4C 4HV8B 4QHPA 2C1PA 3ZMNA 3CDZA 4Z7QB 2G4GA 1C9BB 3LH8A 2EXWC 1NGWB 1T1XA 1VRSA 1NANI 2FJHB 4ZYKA 4E9XA 4CVZA 4XRCB 4NQCE 2BSED 5C8JA 1BQHA 2DQCL 4JN2B 4Y4FA 3DGDA 1PDKA 4POZC 3JT2A 2ZOWA 3C6SA 2YJQA 4NM8L 5KS9F 3CE1A 3T8XB 3SDYL 4HWBL 1ZDSA 4FLSA 2Z1PA 4GRWB 2XZCL 4AL8C 1FNHA 1V7MH 5IBTL 2XFXB 3WI9A 1BEXA 2HTKD 3KWWA 4N8CH 5I1GH 1UKQA 2UWEA 1HQRA 3ZR5A 4YSQA 3EO0A 1G6RA 5I76A 4GW1A 3O0RL 3HI1B 5KOMC 4FADA 1AXSA 1XBDA 1D7CA 5KJRL 5F96L 4ZSOA 2EEXA 1IM3A 5FKAA 4LL1A 4KY1H 5INDB 1ZTXE 2K6YA 3OXRA 4LEBA 1FNGB 2WVSA 1L4IA 3L9EA 3QI9D 1NAMH 2NUPB 3QEQE 2LTQC 5B8CC 1U30A 1XT5A 3HUJB 2EIJB 2X4PA 3L3HA 3FT3B 4RZCA 1LEKB 3TCLB 1RHHB 5B1AB 1BG9A 4WWKA 4OQTA 3LKRB 1LDSA 4LKXB 4V33A 4X8JA 3VXSD 5I75C 5EU4B 4Q89A 4EOWL 2GTZB 3VFRB 2WINB 5FM5M 1A7QH 4YBHA 5AG9A 4H5SB 3DIFB 5FYJH 4PJ9D 2X38A 2BVOB 4OQ1A 3KLQA 3LOWA 4PJFE 1JMZA 1Z9PA 3BT0A 4FOMA 5GS1A 3JYCA 5EBMA 1RUQL 1KEGH 1J8HB 2YUXA 5EBLA 4QF1A 4BBWA 1PQZB 2ZOKB 1MHHA 4L4TE 1AZRA 3BAXA 3VO0A 4OLVL 3TYGL 4LU5L 3UMNA 4EN2A 4M4RB 2FCBA 3ZYIA 4GLRI 5JORA 4J3WA 1NSNH 3LV3B 1NGYB 4HISA 4QOKA 2OFQA 4XP5L 4J39A 5A2AA 5GGQH 2MPAH 1D6EA 4HPOL 3AWGA 4XBGA 4ZX4A 2PP8A 3DO7B 3BVVA 3QZWA 4NCC2 5DXWA 5F1SA 3L4WA 1KBWA 4TSBH 1BVKB 4KROD 4YBQC 3MLWL 3RZCC 1IBFA 4PRAB 1VKXB 3TBSB 1XF5B 5FPIA 3QJFB 4CC4A 3RWIA 3M46A 1LO2L 3KH4A 1SOQA 1NPNA 5L8JB 2WLYA 4YHOH 2XHNA 4TTDD 3VXUA 1MCOL 2A4CA 2FL5A 4HBCH 3V4VA 1P7QA 1S7WB 5IR1A 5AKVA 1XSIA 1QRNB 2EDOA 2EEDA 1FFQA 1YNTA 1PCSA 5D55A 4HIJB 5EDXA 1JK9B 4PY7A 3P4MA 3LH2L 5JOEA 1AOZA 4ISVB 4W4OC 4U1MB 3OG6B 3VYOA 1HZHL 5D93B 3RDTC 2P42B 4AKPA 1YPZF 3TN0A 1KJ2B 5E99L 1GSMA 2GUOA 4KJPD 1Q0YH 1YQRA 2Y3NA 2FK9A 3C8HA 4GNKB 4KH9A 1ZEAH 2IH3B 5D7SL 5E6ID 4DGVH 3LXUX 2OTWB 3QUXD 1OCOB 5LGJB 3P11H 2OQJA 3SDCA 5KYXA 1KB9K 3UIZA 5CKGA 1NUDA 1IGCH 1AFVL 5K9OB 4ANWA 3KWXA 3VFOA 3TV8A 4BZ2A 1KFQA 4GAYB 1QR4A 1QMUA 1RD6A 2GCYB 2ZXDA 1G9EA 3BZ4A 3RSMA 1IEBB 5E4AA 4HVBA 3ULVE 1E8XA 1BOYA 1PG7W 3QPQC 4DZBA 2OJZH 2AFNA 4B0MM 1SJVA 1WK0A 3Q9PA 1Z2KA 5BOJA 4HA1A 5IB3B 3H6JA 4AW7A 1MCWM 3BZFB 3PU7A 5D2LF 5DO8A 4JZOB 4Z7WA 4JQVC 2PNDA 1QYGH 2P5ED 3RKDD 1ZAGA 3ZO9A 3ISWA 1FUNA 1XCQA 5D7LD 2AV7A 3L8QA 1KIRB 1RZGA 3GSQA 4QRFA 3VYPA 3ZQXA 1OGSA 1T4WA 5LQBL 1QACA 4Y16D 4Y4KB 5KSBB 2EYSB 1CPUA 2BVYA 4F33B 2VXTL 1D5RA 1DVSA 1EH9A 2F54A 1MRCH 4F9PC 1KTKE 4C55A 4OZ4B 1UQSB 3RVWC 3NA9L 2WLJA 1ZJAA 2QLVA 1GOHA 2NX5E 2YH5A 1EAQA 3FTWA 2CIIA 1N6UA 4EI5B 2Z0FA 1T7VA 4HCRH 2O93L 5TH2B 2IDUA 1BMZA 3GRWL 1MAMH 3CFMA 4UMSA 4N0FB 1IKNC 4IRSB 4MS8C 4J6RL 4AJWA 4LBEA 1YCSA 2ZOOA 1UACL 4AK2A 4UOW1 2CK2A 4WI8A 3K0WA 3O4LB 2BPBA 3R4DA 5BRZE 2GAZA 1CYXA 2HLEB 4PTUA 2XWBA 4PEEA 4UQIM 3GSOA 3VAEA 3H7LA 4PRID 2QSTA 5JUEL 2X0WA 2CO1A 5BQDA 4HS6B 1IJNA 3D18A 1YYLL 1PNCA 2F2HA 1EUTA 4LHUB 3RG1C 2VO8A 2JCCA 3CSYA 3D52A 4PG2C 3WO4B 3C60D 3UZEC 2I26N 4UIKH 1HESA 2HVJB 5J9PB 3DECA 2BNRE 4GEJA 1GC1L 4M1CD 4UT9H 4APXA 3ZDXF 3X13B 3HRPA 2LLNA 3O8XD 1IC7L 1S9XA 2Y5TB 3OBAA 1GCYA 3QORD 1G7MB 2ODHA 3C2AH 3ILQC 3CPLA 2WLNA 4TMPA 1OM3L 1DQKA 4NPYA 3ZKXC 1U42A 2OCFD 4C83B 5AL8A 4GEIA 2Q2EB 5HBBA 4Y19D 3L95B 1AISA 3FMGH 4GT0A 3RBGA 4XNMA 3SKMB 2P45B 2IF7A 5B1BB 5JW3H 1VEMA 3EYVB 5T1MA 5TQ2H 4U31A 2HVBA 1TBAB 3DUHA 2QR1A 4NNYB 4QXGL 4F1SA 3MRPB 2MNWA 1HHGB 2RIKA 1IB5A 3KVPA 4XNBA 1JTTA 2BVQA 3S36X 3WYRA 3HKZA 5EBWB 1ONQB 3IAQA 4LLAA 4MCZA 3V0EA 3QIBC 2K70A 2X53A 1VEOA 4DTGH 2Z1KA 5DHXB 2W07A 1EHLH 5HYIA 3MFFA 1ZLEA 4X6CA 1E28B 3K7UA 5C08B 4NX0A 3RNQA 3OMIB 3V4UL 4HF5L 4M93C 2Z9TA 3BKML 1HIML 1M1XA 3ZHDA 4LSTH 3FU3A 3RBSA 1TIUA 3U9PH 5HHXH 1U8CB 4UILH 3SKOA 3H2PA 2C1OB 1GC1C 2E7BA 1W0WB 1M05A 1CXIA 2HCZX 3MGOB 3HB3D 3OLEA 2OMUB 1SHSA 2WWKO 2CDFB 3FTZA 1KPRB 3ZTDC 1PVSA 4KNTA 4P4KC 1NA8A 2NOYA 1YEFL 4MNGE 3L5XH 3DX7B 4PV8B 3ULSB 4P5TB 4G7YH 2Z7YA 1D2PA 2XXGA 4JVUA 1T80A 1NCNA 4NRZB 5D7EA 4MA1B 3RWDB 1WA2X 3H9SD 4RIRB 5KJ7E 3QUZC 5I8CA 1M71B 1TTCA 4I7ZC 4LLUA 3BUPA 2H26B 3LKPB 5DJ0A 5I1LB 3X11B 3G6DL 5F89B 5GRVL 3RWEA 2NPLX 1E9PA 2VXQH 2NW2A 2R23A 1RURH 1E9QA 1CK0L 3EJCA 1JIBA 4A6YB 1CL7L 4WZ9A 2X3CA 2AEPH 1F6FB 1CD1A 3AACA 1UVQB 3H0TA 1HWWA 1AD9B 1YUKB 4Q58C 2J72A 5D1QE 4ENED 4ODWA 1F6AB 3T2QA 1VFMA 3G5WA 3PIQB 4H0LC 4D0DA 1DQDL 5DSCA 1P53A 2QZ5A 1PSKH 1T0PB 1K8IB 4XCEA 1A4JA 1K3ZA 3EJQA 4GW4A 4DPRA 3DMMD 5FDWA 2BC4A 5BV7H 5E2JA 4XMPL 1JPEA 1MP9A 3SPGA 5FYKE 4QCIA 3RVTC 4C56B 4Z1PA 2APWA 4LDOB 4ZQTA 1B4JL 3KPOA 4Y4HC 3KS0H 1F4AA 2K6ZA 4JFDE 3PAZA 5T3XL 2BY2A 3NZHH 2FQGA 3CFUA 3ET9F 2WWKT 1ZSDB 2DQFA 2V8QA 1WFMA 2WO2B 1T0NA 5F0JB 3GF8A 3O3EB 4WW2B 4OZGF 1DHKA 1UTDA 5BRQA 2WQUA 1FZOA 5HSHA 2YAFA 3D25A 5ISZD 5E6YA 4J12A 1MFEH 1ND0B 1OM9A 2VL5A 4H8PA 1CC3A 1BAFL 4GIOA 4YHPB 3SY0B 3D85B 2XKSA 2AEOA 1LM8V 1F1AA 4YDJA 4N2FA 1YQVL 3OR7A 2AJZA 1IGIL 1PL3A 4PG9B 3EBAA 1T2JA 1I3RB 2J56A 1R3HA 2R4RH 4U1JB 2ENQA 1MJJB 3O2DL 4Z5RB 1SRDA 4FNPA 4X9YA 3HI6L 5KZCD 4LQFH 3VXMD 4OLUH 2WAHA 4H0HB 4PLJC 4XPFH 4N2CA 3LQZA 3BFOA 3MJ8A 2Y06L 5DT1H 1S7RB 3PREA 3TVMD 1CU4L 5E9AA 5DD6A 3L2LA 3Q1SL 1I7TA 2LQRA 2FH8A 4AQ8A 1ZHKB 4JUTA 2GTWA 3RLSA 2BY0A 1T21A 2EDRA 1UYWH 3NCEB 3O3AA 4GBXB 4M9OA 3BH4A 1QWHA 4W68A 3Q01A 5DK0A 2ZYRA 3QSKB 4K8RL 3QJUB 4XX5A 5LG1A 3D48R 3TL5A 3RWCA 3AGVA 4BFNA 2PWWA 4CVXB 3V0HA 2OULB 1SYVB 5H8DA 4ROCB 4ZX3A 3EBGA 5EEWA 2KLTA 5F6HI 2MQGA 1I8KA 2N4IA 2MH4A 3ISYA 3L4TA 1GTFA 2XWXA 5D1QA 3AM8A 2MHAA 4HSCX 4AOFA 2VT0A 3LEVH 3MJWA 1FO0L 1JV2A 1AC0A 2F7RA 1KG0B 3MROA 2YOCA 3MLXH 4PJ6A 4Z7VE 4J2XA 5T3ZD 1LE9B 4HIXL 3L6FA 4MJHA 3CTTA 4K9EH 3VFVB 1ZANL 4DVRH 1RP9A 2ZG2A 3SKJL 5JQHC 3LIZA 1AH1A 3V7AG 3QA3A 3WEBA 2RFXB 3MCYA 1MIEL 2Q0ZX 2DJSA 4YDKH 3HZVA 1AHWA 3QG7L 5ECJE 4G1EB 5E8PB 4XCCL 3TBYA 1RUKH 1WLHA 2IDFA 4IYKA 3HBQA 4I8DA 4ZXBD 4XCYA 1K4DA 4IKKA 2E27L 3DIDA 4F7TB 1WJWA 3F84A 1P5UA 1JSYA 3D5OF 4PJXA 1CXHA 3GWJA 1FIGL 1ZS8B 2VE6A 4XWGH 4S1RL 3WIHH 4L0YA 1I9IH 1MZYA 1SJHA 4FYTA 2GPZA 1ZT1A 2GI7A 1H3PL 2ZCZA 3MRGA 4QYOA 3X3GH 4HIHB 1BYNA 2D0BA 4DH2A 5BZXA 5MERA 2Y72A 5F9DC 1XGTB 2ZQKA 2FATH 4JB9H 4P2QD 4WI2A 4RMUA 5DJCA 1V54B 5B22A 2WLZA 2XNAA 2Y36H 5ITFB 4DW2L 4GKNA 5BQ7B 1Z66A 1WDAA 3RI5K 1D3UA 5DQDH 4GY4A 1ZKAA 4X9IA 5LDUA 2HRPL 3SGDH 3JVFC 4PJ8A 5FGSA 5HSFA 3FCSB 1FNEA 2ZCLL 4YBLC 1BVLB 3TJHD 4Z7UB 2XZAL 5F7MC 4CILA 2C3XA 1TUOA 2GW5A 4DN4L 2DKUA 1KN4L 3H3KA 3HZ3A 1NOLA 4RRPM 1W72H 3JV4B 3QS2A 1L9PA 4JFFA 4UIMA 1Z6JT 4TPRL 3ILPA 4N2KA 4DP4X 3ARUA 3O45B 3IPFA 4G6JH 1JWMB 3O2VH 3NK3A 2PABA 4I2XA 4Q9QH 3TT1H 5IB4B 5AWNH 1GGUA 2KBGA 1ACYH 5LGKA 4IBVA 4KNQA 1HZKA 2HKHH 1L0QA 1P5VB 3OJMB 3MNWB 2XQYK 3T9WA 1IZKA 3NQKA 5F3HB 4GAGL 4G1MB 4LEOA 5IK3A 3T0ED 5C6TH 4XXDA 4MHHI 1LGVA 1TJHH 3JUYA 4UMGA 4HZAA 4E9VA 2QRCA 4DKAA 2R4SH 4UB0L 4UTAH 2W94A 3SGDI 3L5HA 5EV7A 2XT1B 2CJSA 2XUWA 4URKA 5EZJB 4NC2B 1A3RL 3ELAT 3WJJC 4Z8FL 4YSAA 1Z5LA 4UQ3B 4EN3D 1TZIA 2F18A 4YIQA 3N1GC 1FPTH 3O41B 1THCA 4K73A 1YDPA 4ZUTB 1DUZA 1T7ZA 4E41B 4ZMYA 4XMUA 1VIWA 3OV6A 1IAIL 2WKOA 4JQIL 1UL7A 3VUAA 3IETA 4RGOL 4N25A 2D7OA 3VVVA 5DRXA 4YHNA 3LB6C 4F37F 1NBQA 1B6UA 2XJKA 2PYEA 1T6VN 3TPUB 2HX9A 3HN5A 2YBGA 3BZ5A 4FAAB 2AZAA 2YKLH 4B41A 2ICEB 2JHNA 3MO1A 5JMVD 1D7FA 3DURA 4K7PL 1NTDA 4N9GB 2HZSA 2FBRA 5GRWA 1Q94A 1PKQE 1YUHA 2I69A 5I8EA 3S34H 4AIOA 5GRUH 3O6FA 3EO1B 3WLBB 5ADPH 3S8GB 2V8MA 5I1CL 1T3FB 1A3LH 3KL5A 1IUZA 2F8VA 2GFBB 3MN8A 3GHEH 1N39A 1YC8A 5FF6A 3QDJE 2OBGA 4MAYD 5SWSE 5E7BA 1PAMA 2ZX6A 3WDJA 4MGXA 4LCYB 3KPSD 3K5RA 3RGVB 1I1AC 5GJTH 3ZKNC 5TGBB 4HZLA 1FAKT 4GQPH 1B90A 1MI5B 1JNLL 3O6LH 5GSVB 4B9YA 3QNYA 1KBPA 3I3BA 5FEBA 4FCHA 5ID0B 1M2OA 4LAQL 1C4GA 1SJMA 4KO9A 1UURA 3UJTH 5BZWB 4JQXC 5SV4A 3EYSL 5H2BB 4IU2B 4A38A 5M95B 1TZOA 3PAUA 3DPBB 4JDTH 4O51B 3L3DA 2BSTA 3QR2A 4FMKA 2CO7B 3L7EB 2XTSA 5F9AC 2VN6A 4A7GA 3UCQA 3MV7E 3CU7A 1HVXA 3UADA 1SY6L 1DL7L 2VN7A 4J3UA 4D0CA 3IDIA 1ULVA 1BAWA 3ARDD 4HT1H 1BZ7B 4NUGL 1I31A 1VACB 3E8VA 4UYQA 4L05A 5CAYB 1HH9B 4QXVA 3WXWL 1OIOA 1THAA 3TWCL 4AC4A 1ZJBA 1C12B 1SBSL 3DOIA 4HH9B 4P46D 3KEDA 2QR0A 4P5MA 3RWJB 3ULAB 5EUOB 4GO9A 5D4QA 5MEQA 2EHBD 2YGOA 3RZCA 3HC3H 2HUEA 2A9ML 4MB3A 3RWFB 1N64L 4JM4L 4HOWA 2FSEB 3UTSE 4FHJA 5EF3A 4NI3A 5KVEE 1F00I 1QTYT 3QXWA 3FCGA 2H32B 5I15L 3VD4A 3VRJB 5EU3B 1T89A 4EBQL 4MXWL 1CTOA 2IQ9L 4TVPE 4RMBA 2ETWA 1XGQA 3C5ZC 3U0TA 5J1TC 1QFHA 2EDEA 2VDRB 3DNKA 1MCQA 3CLFL 3I85A 3V6FB 3UGXA 1LO5B 3V5HB 1NBYA 1OSYA 1VEPA 1JF5A 3G9VA 1IBGL 2WWNA 3RDTA 4B9JA 2GT9B 5K9KA 2V2WB 2APTA 1D5XB 1MHCB 5KVFE 3RU8H 3TJPA 3ARFB 2YC1B 3S0PA 2CCWA 2VLMD 5CWSB 5A40E 4WV1B 2A6JB 2XYCA 1IM9B 2A0LC 4PHXA 4L29A 4PHZA 2IAMA 1A7RL 3AU1A 3KS0J 4RVBA 1AI1H 3TZVA 1RAMA 1MCCA 2EACA 5T8IA 3MBXH 3VD0A 3L5WA 2VSMB 4QMEA 3FRPG 2B3RA 1AQKH 2CMRL 2Q6WA 1RZ7H 3WN5C 5FUZH 2VYRE 2XG4B 4LSQH 3W5MA 1CFTA 4PMEA 1C1EL 2B1AL 2VDOH 4DKTA 3D2UD 3SQOH 1UXMA 3BE1L 4GQ9L 5TDOA 2EEAA 1N70A 3ZW3A 8PAZA 3EXLA 2VC2B 4N5ED 4BCXA 1N6QL 3GBML 3RL2B 3W39A 3FSZA 3V6ZB 1PZUB 1KN2H 2W91A 1VLXA 1J9CT 3IFLL 4H1LB 4OFVA 1CE1H 4V1DD 4JQVA 4RX4D 4P9HH 3QJHA 2KQNA 2N0KA 3SOTA 4I4WB 4JO4L 2NXYB 1U0QA 3SGEI 1WZKA 1F3JB 4DPCX 4AVHA 3VFWB 1GAFH 3QUKB 5J57B 3RVVD 1QBBA 6PCYA 5JDSA 5JW4M 1FC1A 2LV4A 1DVFC 4XP9L 2JKXA 4B60A 5LDSA 4TYUA 2JQMA 4X4XB 2QVTA 4F9PA 4ETQB 4MB5A 4EDXA 1OVZA 3V55A 7FABL 4FNLH 4PBWD 5E2WL 4UI2A 2VLLB 3FZUD 5DD5L 4H8WC 4K5PA 1JZDC 3HS0C 3SJVD 5ICYB 4KZEL 3N44B 1K85A 3X1BA 3FO2A 1M7XA 4M7LH 1MHEA 1RH8A 1CF8L 4KKLD 4R0LC 1NAKL 3VGFA 3HE6D 1IKNA 3I02A 5GGTA 3NPZB 4QRTA 5CLZA 2AJYL 4FQCH 2QFRA 5FGCE 1S5HA 1HX0A 4PYGA 5E23A 5LGHH 3ARWA 3IGUA 1P2CB 2CJTA 2R5XA 3SQBA 2ICWJ 4KTDH 5D1ZD 2XWTB 1CLVA 2FGWH 1NMCB 1OO2A 1U8OA 3B9KD 3PL6A 3QIUA 3QIWC 5T1LA 1QSZA 2GIMA 1DYZA 1CIDA 3HFML 3UO1L 2FQFA 3BWAB 2O6PA 2RR3A 2WYHA 4FQXB 3VFMA 4XO4A 5H37G 1A9BA 3JWDL 1FRGH 1V3MA 4DP0X 1R34A 4JL1A 4PG2A 4YDNA 4HKBB 3UZEA 2AGJL 5C3LD 1I85A 1IEAB 4X6EB 3WMSA 1GYAA 1QG3A 1YMHB 2LABA 3RFZB 2JKSA 1ZV9A 4TL4A 1B2YA 2DL9A 4QO1B 2J6EH 2IOMA 5AVWB 1FYHB 1EMTH 2R39A 2B39A 5EOQL 4DFHA 2AK4A 4ZUVA 3MXWL 4EAIA 5CLYA 1NBZB 3K71A 2H4LX 3Q5YA 1HSBB 1AZCA 1YEEL 4ZS7L 1NGXA 4CW1A 1AZNA 1JWUA 2VISA 1U3HB 4UU9A 4WI0A 4QHLB 1QWNA 1QZ1A 4KUZL 1LEGA 5CJOL 3IFPA 3OAUL 2MZ8A 1AQMA 4KRPC 4Y5XB 5A3ID 3HPJB 4NDMA 5I8KH 3MLZL 3FQTB 1AO7B 1LWYA 4M7JL 4L8CA 5AVXB 2C7UA 5J6HB 2Q8BL 3NIDF 4D9RD 3T1FB 1KCUL 4NKMA 1JZ8A 1RSFA 1N26A 2XBZA 1AHKA 1UB6B 3HRZA 4NWTL 3VNZA 3JWDC 5SX5H 3B5TA 4NJ9H 5A6LA 2LU3A 1T5WA 2P1YA 3BGMB 4XODA 4PWGA 3CH1A 3PGDB 4BCZA 3VWJA 2CO3A 3QRBA 2ESVB 4YFEA 43CAB 3WTXA 4JREC 2FX7L 3SDYH 3O0LA 3VSVA 4YK4B 1YC7A 1S7UB 1XMEB 4PJCA 1TKWB 4P4KA 1KBVA 3AT8A 4N90D 2H3NB 5ANME 1Q72L 3EH5B 2V37A 3DYMA 1N8OE 4G8EA 4HSAC 1GS7A 3QH3B 1I1YB 2BSDA 3CFJB 4OGAC 3EF7A 2IDQA 2R29H 2W0FA 1K4CA 5DA4A 3V6OC 3QUHA 4GG6B 1F02I 1U2CA 1LWRA 1KCWA 32C2B 1HKLL 3IRZA 4FQ2H 2LE9A 1MJ8H 1UA7A 2J21A 5F2FA 4YR6B 2X1QA 1AAJA 3THMH 1A3ZA 2BM3A 5JHAA 4M8VA 4JM2B 4GRLB 1J3MA 2EXYC 1I9RL 1BD2E 3OKKB 4LSVH 3TJEH 2BNQE 1J8HD 1BFOB 1ECZA 3WNJA 2O6DA 2D7MA 4YE4H 4U1IA 5EC2B 1N59B 3EJZC 3KLHD 2HMIC 1HSAA 5HHMB 2NXZB 5KYYB 1N5YL 3S3PA 1UUSA 4Q7DA 2TRYA 5T5FH 5KWYC 4ORGA 2R0KL 2UYLB 4HJJH 5F70A 4FFTA 1U8NA 3VFSB 3TBBA 1KCSH 3ROOA 3FU6A 3N0PB 2DWEB 5E94A 4E9LA 2JTYA 4ZPVA 3UAAA 5IW3A 3FB8B 4FQPA 4UTBA 5C7XH 1VGEL 2PCXA 4P8QA 1BQ5A 1V8HA 2V2XB 5EWIL 5G4NA 5I18H 3N0AA 2QQNH 2QMKA 2BOLA 4YHLL 1G87A 1U8PA 1DVXA 2RA1A 5C0ND 3BP4B 4PJ5B 3VYNA 3L45A 4DN3L 2OJEB 4EKJA 2D03H 2GY5A 4KJQD 3OX8A 4K71C 1WC7B 3F65A 1VDGA 5BOZG 4OAWB 3KCWA 3QHZH 3WKMH 3UBXI 2CU9A 2IH9A 1NFDB 2PWGA 3X1NA 4HJGA 5F1KC 5DFAA 2VRAA 3C8KA 2A77L 3IJ9A 4F7CA 5GZNC 1AR1C 1EUUA 1HL5A 2F0CA 2R56L 4FDWA 4ELKB 1QRND 4HC1H 3BPNB 5JW5A 2C9UA 1S9KC 4OLXH 3H42H 4P59L 2H5UA 3T0DA 2W60A 3T2NL 3IJHB 4KDWA 1KFAL 3WFBL 5HDBE 2DLTA 3GMQB 4DUXA 3NA4A 3TNMA 2EDTA 4PJIB 4X9FA 2JWYA 1JFHA 3MRHA 5IMMB 1EO8L 3MVSA 3EDDA 2PPDA 4N0CC 1ET7A 1BZOA 4MJJA 2Q8AL 3GK8L 3HMXH 1FL3B 2DLHA 4V2CB 4CSZA 5BZDA 5J4MA 2BERA 3FUHA 1X6NA 3TASA 4AITA 4HKXA 1NGZA 3EH3B 4H8VA 4X80L 1WAAA 3IDMA 4QY8B 1GGIH 5AAMC 5K9QG 4J8RA 2FIKA 2YD9A 3F10A 3CVHL 1JWSB 2WJ5A 1QO3A 3AQDA 1UHVA 1T66C 2CNZA 3IDXL 4YHMH 3MRQB 2P9RA 5B38B 3MA7B 4D0BB 2VDNB 3QT2A 3RIAK 2A6IA 2DQTH 2V2TA 4ZQKA 3IDJA 4RISL 2BNQA 1U41A 2DQMA 3K8MA 2ZCHH 4K2UH 4W9EC 2ZSWA 3UABA 1MPGA 2QADC 4D8OA 3FTGA 3KDPB 4PS8A 4XO5A 3O2DA 2BWDA 3I6LE 3FT9A 3WY3A 3BPOB 3EH2A 3HZYB 3BP6A 3P69A 3CJJA 3ZRSA 1YQ2A 4AEHH 4BKTC 2E74C 3RRQA 2CH8A 4PLKC 4IRJA 1KXVC 1JERA 4IMLB 1IBBA 3FSVA 4UT6H 3QFJB 4Y4KD 5E5MB 3APNA 5F9OL 4GSRA 1QR1B 3MRDA 4JAMA 4LL4A 3GSWB 2OR9L 5AVUB 5HGAA 2WCPA 3L3GB 4NN6B 5ACZA 1EXUB 1L9NA 2I60L 1PG7H 4M7LT 1WGOA 2CO6A 2QFPA 4D3CH 5AG8A 4NQDB 3QAZC 3ZTNL 5HJ3B 3HI5L 4DK3A 2MTAA 1SYSB 5EORL 4Z95H 4KV5E 1UWEH 4QKTA 2WZ6A 4NZDA 4R96B 3V9CA 3ZY7A 5HYSB 2E56A 5HJDA 1CDBA 4YZWA 3FXIC 3EFDL 4U6YA 1IC4L 3ZL4L 5IJKC 2R1XA 4PB0L 3AWFA 3H7BA 4DUWA 3FBKA 3B2XA 1ZPUA 3CSFA 3ZGIA 2F1EA 3HC2A 3AZUA 1E43A 1YNKL 3O4LD 4FFYH 2DN7A 4L8SA 4Q6IB 4WF7A 1SLUA 4WEMB 3ZX1A 4DEPB 2IG2L 4NRYA 4EUPG 2LVEA 1CFNB 4YSRA 4XPGL 4FLRA 1LO3L 3O3UN 1QHQA 2G60L 5HHPB 4K3JH 3NPSC 3PHQB 2VDQH 1RZKH 3SD5A 1PVHA 4LHUD 3U0WL 4WHYH 1TZ8A 2X12A 3LPOA 3RL1A 3TO4B 4XXCC 4JRXB 1YMMA 1SXAA 1UD5A 1E4KA 2DQUL 4J23A 2XN1A 4BA0A 1T5XB 4J8QA 5IROC 4X8XA 5IUCA 1B0RB 2NY5L 5CINL 3DO4A 2H0PA 3MV8E 1GKEA 5BO1L 5J8OA 4ZD3L 4MDRA 4A04A 2YGVA 2LR4A 1KB5B 5FYKL 1MNNA 2FNBA 3D39B 3SN6N 1ZRUA 2JJSA 2XJLA 3MODL 3LNIA 1DJIA 5I9QC 1XR9B 1CF1A 4FQIL 1N3CA 1KJVA 4AGLA 2G3NA 2RMNA 5GZOC 2WLLA 1GJUA 1I7UA 3GMPB 2J8UE 4G9DB 3BFQG 4Z7OF 1OW0C 3DTXA 3TV3H 3I75B 1N7MH 3GPEA 3PV6B 5FGRA 4R8WL 5A2CA 1UA3A 4J3OD 2FIRT 4K9JA 1S3KL 4AQAB 4YHKL 4TULL 1LP9A 2YLHA 1QZNA 3FFOA 1HHIA 2BNUB 3EBIA 2GK2A 3FNKA 4R7VA 3VU2A 1F58L 1VOLB 4K23H 2PYFB 4JCWA 2X6UA 5C08D 1PD6A 4QHNB 5GIRB 3B34A 4XVSL 1TU2B 6FABH 4PRPB 2C4FU 4FXKC 4TLUA 1WBXA 3BW9A 4FA6A 4AGMA 2LTQB 5B8CB 1RKRA 4NO0A 3RAJL 3G6JF 3FDWA 2Y7QA 5F0PB 4PGJA 3DROB 1ZE3H 2NY5C 3WIIL 3AREA 4AY0A 2H1PL 4WO0A 5I75B 4AM0B 4MAUH 2QTVA 3PS6A 3CVBA 5LCVL 4KRNA 3MLTA 3OVUB 1BJ8A 4LPUA 3ENEA 1B2WH 4RCAA 4WSKA 3A5VA 4HGMA 4DULA 3A22A 3ELQA 1A6VH 3QXAB 3T3PB 1CZ8L 3TGXA 1ZIBA 2D2CC 4CU8A 2VERN 3GM8A 3NDZE 4YFLI 4KZDH 5IGXL 1GOGA 1EFQA 3T3MF 2G3ZA 4JCMA 2DKAA 4PTTA 5C0FA 3WAKA 2JJUA 3C5JA 1F1GA 1GZHC 1GA2A 1CLCA 1JFQH 5DZVA 3FTYA 4FG4A 2Y2TA 4YUEL 1CFBA 4KXZH 2HLAA 5ESVB 5AAWA 4PJGE 5I24A 1R3IH 1TZAA 3KYMB 1EDQA 1R5IA 3MBED 4OF6A 3EO9H 3MJ6A 4PREA 3DBXA 4I3SL 3RIKA 1E27A 4XVOA 4JR9L 1M6UA 1HL4A 3KYOA 3HNVH 3SDAB 2OI9C 4JG9A 2CM5A 4K15A 2VXUL 2HX7A 2XTJC 4JFOB 3MV8A 4RMWA 1KCKA 4JQXA 1CDIA 4G70B 1RU9L 3DXAD 3ZSSA 1YTBA 3P9WB 1K3IA 3GD1C 3ES6B 4L1LA 3EJTA 4IS6B 3UBXB 4UAOC 5FYJD 1JVOA 1YECH 1P4LA 4JFTA 4QTFA 1RVFH 3HLAB 4X9GA 3GIZL 4DCQB 5DJ8A 1IGMH 3VFPA 1E6JL 4XNQA 2IXQB 5FUOH 3BVNB 3NRPA 4ERSH 4O02A 3VRLE 3CVSA 2K9FB 2IMMA 3HAEG 1CG9B 4KXZI 3MLVL 4D7RA 1BOGA 4KITB 1PPIA 4JHAH 1OAUH 2WO3B 5IVZA 2PP7A 2VLJB 2BIPA 4AIXA 3O4OC 1HYSD 3NRQA 4G7SB 4JJ5B 3NEOA 3IAGC 2AQTA 1TMCB 2W95A 4G6KH 5BUAA 3NCJH 1ES0B 3T77B 5ERWB 1T1YA 3EYOB 4TOYH 4TLKA 4MNQA 3D85D 4F15C 4JO1H 1CL7I 2Z31C 1A9EB