2G51A

Anomalous substructure of trypsin (p1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A01
3ESTA 1HJ8A 1F5RA 2ALVA 1O2JA 3BEUA 2ODQA 3P70B 1VITF 1G36A 1P11E 2D26C 1IQNA 1TWXB 1YLCA 5ETXA 2CHAB 4E05H 3RXPA 1GCTC 1GBCA 1KTTB 3S0NA 2HPQH 3RXDA 3UFAA 1BOQA 3BTWE 5ABWA 1E38B 3P6ZB 3BTKE 1HUTH 2O8TA 3RP2A 5A8ZA 2ZDVH 4MDSA 1YPMH 2QF0A 3EAJA 1P03A 1GI1A 1C1SA 1C2MA 1C1PA 2XC0A 4IMZA 5F8XA 4Z6AH 1P06A 3H7OA 1YCPM 1NRPH 1UTNA 1AE8H 2QXIA 2ZHDA 1ANEA 2LPRA 2C8XB 2J38A 3ZZ6A 4XBDA 1SMFE 2QC2A 3SV9A 2AFQB 1XVOA 2SFAA 4ISNA 2PSYA 2VU8E 1ZHMA 4BTUB 4TY7A 4LZ4B 3SUEA 3ODFA 2ZIQH 1GJ4H 1WUNH 1DFPA 1W7GH 3A80A 2WYJA 2J34A 4A1TA 5JB9S 2F3CE 2CHAC 2SGAA 1GJ9B 3UR9A 1ELTA 1FV9A 2J92A 5AVDA 1AVXA 1IQMA 1AY6H 5JBBS 4FVBA 5EXNA 1T8MA 2BVSH 2WPHS 3TIUA 1C5ZB 1BRBE 1C1UH 2A4OA 3E0PB 1E36B 1DDJA 3LGTA 2UUYA 2P3FH 4GHQA 2VGCB 3H5CB 3VB7A 4AYVB 2EEKA 1GI4A 3MH4A 2WPLS 1HJ9A 2HALA 1WV7H 2XBXA 4ABEA 3BSQA 3M7QA 3OU0A 2C90B 1Z6EA 4I31A 3I29A 5EXMA 4CRCA 1AMHA 4CREA 2GV6A 1O2QA 3RXHA 4RKJB 1DSTA 3SNCA 1UO6A 3O8BA 1BJUA 4TYDA 3RXAA 3MNXA 1O30A 3MO9A 1E35B 1LHGH 3A8CA 5FBIA 3LC3A 1TBQH 1P57B 1HV7A 3V12A 1W11U 4CRGA 2ZU4A 4UFFH 2PSXA 3NKKA 2BLVA 3SNAA 5FX5A 1K1IA 1RIWB 1PYTD 1BDAA 1HRTH 1C2EA 1TX7A 3TGIE 2TGPZ 4ABDA 1NROH 4ABHA 3D23A 1OKXA 3TNTA 5FPTA 4XBBA 4KTUA 2O9QA 3MU5A 3DD2H 1O2VA 2OC0A 3IWMA 4LZ1H 1C2GA 3MNBA 2AIPA 5EXLA 1XUIA 2QGRA 3OY6U 3UWIA 3A8AA 1GHAG 1BT7A 3F9GA 3LGWA 2UUFB 3SN8A 5JB8S 2V3HH 1QJ1B 2Z9GA 4GVUA 1QL7A 1O5EH 3TK9A 4F49A 4FUHA 7ESTE 2AMDA 3F9HA 2PKSB 1HIAA 2AYWA 2QIQA 1SLWB 2V6NA 4DCDA 1HAXB 3SNBA 1AWHB 4YM9A 1L2EA 4ZHAA 1QGFA 1V2UT 3BIUH 4MNXA 1SQTA 1K1JA 1O31A 1BTUA 3GY4A 2BY6X 2FESH 2HWLB 1RRKA 3GY8A 1CT2E 1SGEE 5AHGH 3SU4A 1J15A 1WYKA 1XUJA 3UTUH 3KCGH 2BQWB 1G2LA 1SFIA 2FODA 3F68H 3U98H 3M35A 5A2MH 3A89A 5J4SA 2P93A 2P3UB 3AW0A 3TK6A 1O3NA 1TBRH 2ZFSA 9LPRA 3RXCA 3OYPA 4ZAEA 2A5IA 1K1OA 3GCTG 5HXFA 4KKDA 5DO4H 1BUIA 1QCPA 1NRQH 1DM4B 6ESTA 1MQ5A 1UK3A 1ANBA 3A87A 2WPKS 1VGCB 1OWIA 1TNHA 4AG1A 5A8XA 2BD9A 3DT0H 3ZZCA 3GYMA 5LGOA 3MU0A 1C5MD 1QL9A 3BG8A 5AFZH 1BJVA 3P92A 3Q77A 1PYTC 1XUGA 1F92A 4X1QU 4X2XA 4UONA 2RA3A 1EAUA 3C1KA 1FAKH 2GP9B 1S81A 1ESBA 2ODPA 2BQ7B 1TX8A 1NESE 1CVWH 3V0XA 3O8CA 2ZGXH 1NM6A 3M7UA 1O2RA 2H5CA 3TJNA 4WWYA 2BVRH 1QIXB 2HLCA 2AMPA 2A4QA 2BDIA 4Z0KA 4CRBA 2ZGJA 3HK6B 1O3IA 4UFEH 1Z6JH 4B2BA 4CRDA 3AW1A 1C2JA 3A7XA 1ID5H 2XXLA 1UJ1A 1LHEH 3QO6A 3SU3A 4ABAA 2BYAX 1P02A 2VWLA 2STAE 5BRRE 1XM1A 2BXTH 2WPJS 2BDGA 4FU7A 1NY22 4QT8C 3SO3A 4FUEA 3M5MA 1VCPA 1GPZA 1QQ4A 1DOJA 4AFSA 4AGKA 4TWWA 1TGSZ 5IYTA 2H6MA 1H1BA 4DW2U 2TPIZ 3ZVDA 5CMXH 1AUJA 1RTLA 4K5ZA 1HJAC 1DWEH 1XXDA 2ASUB 1EAXA 4THNH 3MFJA 3ZYEA 2PLXA 4A1XA 1O2UA 3DA9B 2FI5E 2C8WB 5K0HA 2FDAA 1Y3VA 5DP4A 1ARCA 1BIOA 1GI9B 2A2XH 5EQQA 2M5TA 2Y5FA 3A8BA 7KMEH 3ODDA 4D7GA 1KXFA 2G81E 1AB9B 1T4UH 3SNEA 2ZNKH 4BTIB 2AEIH 1OWHA 1KXBA 2YOLA 1ZTJA 1NFXA 1ABIH 5A09A 2A0QB 1T8NA 2ZZUH 3EYDA 4JZ1A 1FY8E 4MG3A 3KQBA 1GHZA 1JBUH 4TWYA 1Y3XA 2GV7A 2OCVB 2FXRA 3T25A 1BZXE 1F2SE 1K1NA 1GI7B 3UQVA 3GY2A 2QV1A 2ZWLH 1PPCE 3GISB 1VJAU 3ATMA 5L2ZH 1T4VH 3A88A 4BOHA 4ZMAH 4XDEA 2GZ8A 3MH7A 1TGBA 2XRCA 2A45B 3A86A 1ELBA 1O2ZA 1GJDB 2Z3CA 4OS7A 3PTBA 2OBQA 2TIOA 3QLPH 3LT3A 1IQHA 1GBBA 2QN5T 2ZKSA 5GXPA 2BM2A 3E16B 2THFB 8ESTE 2Z3EA 4AG2A 3QGNB 4GCHG 1T31A 2BLOA 3SJ9A 2P3TB 1C9PA 3RXOA 3T26A 1O2IA 2Y5HA 2ZPSA 1SGCA 2BZ6H 2KAIA 1NZQH 3PV4A 1YF4A 6CHAB 2ZCHP 2NU4E 4UFDH 1P04A 2FOMB 1C2HA 2SGQE 3L6PA 1V3XA 3U69H 1RTKA 1S6HA 3SU2A 1AGJA 1EOJA 3UREA 3T28A 4ZKRU 4MNWA 4KELA 5LH8A 3EA7A 3B9FH 3ZZ8A 3HKIB 1MZDA 3SZNA 5C5NA 1WOFA 5HM9A 1BHXB 2UUKB 1AIXH 1SOZA 3ELAH 3CP7A 1YBWA 1EASA 2F9BH 1JXPA 1TFXA 3JZ2B 5CE1A 1ZHPA 3AAVA 1GDQA 1RS0A 2O8LA 2FLRH 4U01A 2GX4A 3DFLA 1L4ZA 2CV3A 5GCHG 2ZP0H 3HGPA 2TRMA 4AYYB 2FLBH 1S0QA 3QX5H 2AGGX 1DVAH 1HIAB 3PROA 1DWDH 5FX6A 4I8KA 2R9PA 2XCNA 1CBWC 1P2JA 3SV7A 3ZZ4A 3ZZDA 4X8TH 2YNAA 2B7DH 1SQOA 3SI3H 4D8NA 4B2CA 1SGDE 1UCYE 3R0FA 4YLUA 1C5OH 1D6RA 5ESBA 2CGAA 2GCHG 5GIBA 1GI6A 2A31A 2BZAA 3CS7A 4B71A 2PFEA 2Z9KA 1P2OA 1GMDF 4JK6A 4K2YA 3O8DA 4WXIA 3PWCA 4Y6DA 1YP9A 1GGDB 4GUXA 1V2ST 3MTYA 3LU9B 1O3KA 5FPYA 1WTGH 4JZFH 3KEEA 1SSXA 1ZMJA 4I8LA 5E0JA 4AFQA 1FUJA 1O38A 1GI2A 1JWTA 1OP2A 1CT0E 1O2XA 1T8OA 3FP8E 1OX1A 8KME2 1IQKA 3ITIA 3M3VA 2YNBA 3ATIA 4ABGA 1HDTH 1Q2WA 1RFNA 2VIQA 3KQEA 5DP9A 2A5KA 1BTXA 4X2WA 2CJIA 1T32A 1QHRB 1C5XB 1TIOA 1O2LA 4WMFA 3NUMA 1GVKB 1L1NA 1O2HA 5JYIA 1TNJA 1IHSH 1ZPZA 2ANYA 3QK1A 3F9FA 1D3TB 4MVNA 2ZECA 2BDYA 4AFUA 3UUZA 2Y7ZA 3KGPA 3RLYH 4K69A 5EPYA 1A0HB 1GI3A 1QQUA 3MU8A 3PO1C 4OS5A 1GBAA 3UOPA 2Y81A 1RJXB 1O39A 4LXBH 1XUHA 1AWFH 1NN6A 2ULLA 1IAUA 5SGAE 1UVPA 3PLBA 1BHXF 4RN6A 4RSPA 2ALPA 2BDAA 4NIWA 2JETB 3LPRA 3CENA 3NZIA 1QNJA 1TAWA 3M37A 4YT7H 1EAIA 1SGPE 1F7ZA 4H6SB 2ZDAH 1JIMA 3SGBE 2FYRA 1UTJA 1GCTB 1MU8B 1OWJA 1EZSC 1GJBB 1P05A 1O3HA 1TBZH 5LPEA 2Q6GA 3RMMH 3QTOH 3IITA 5CHAC 5T6GA 3U8OH 5A0AE 1E34B 2ZF0H 4CH2B 3QWCH 1X7AC 4B2AA 1ANDA 3M5OA 1DXWA 5EQSA 1IOEA 1ZPCA 3DUXH 1CO7E 1KIGH 2NU0E 1LHFH 4DG4A 4J1YA 1P3CA 5JBTA 1AO5A 1DS2E 1C4U2 4IGDA 2TGDA 2PKAB 1VR1H 3QZQA 1EZUC 1B5GH 2VNTA 4FXGH 4JZDH 3TJUA 1THPB 3HGNA 1EUFA 1TNKA 4ZXXH 3SV2H 3TU7H 4E06H 3U1JB 1AUTC 3SOSA 3RXRA 1Y5AT 3G01A 4YLQH 1QR3E 2BMGB 4Q2KA 4O9VA 1O5AB 1ESTA 1SGIB 4FUIA 1O3OA 2O8MA 1FY4A 1OS8A 2OBOA 1J8AA 2ZTYA 1C4Y2 1O36A 1DPOA 1O2WA 2H5DA 3LOXA 1A3EH 3M5NA 1A4WH 3NPSA 4CHAC 1K28D 2RDLA 1GL0E 2FO9A 2G8TA 1V2RT 1NU9A 1PFXC 5DP8A 1ZPBA 2VVVA 5EPNA 1B0FA 1AVGH 2EI8A 1DANH 1E37B 3M7TA 1YPHC 3PMBB 1C2KA 1LCYA 3S9CA 1JRSA 4B73A 3EA9A 3SU1A 1NRSH 3OTJE 2SGFE 3T2NA 2G00A 2BD2A 1CSOE 5L30H 4XSKU 1HBTH 4HZHA 1IQFA 3RU4D 4I8JA 1KXAA 3PMJA 5JBCS 3O8RA 3GYLB 3SNDA 2QXJA 3TK5A 3U8TH 3S7HB 3TH4H 1N6XA 1ZHRA 2KAIB 1G32B 2BOHB 1ORFA 2ZU1A 2ZGCA 1EXFA 1L1GA 1L4DA 1S83A 1V2NT 1O2MA 3E8LA 1MBMA 1LTOA 4FU9A 1GMHG 1UVOA 5C1UA 1Z1JA 2B0FA 1KY9A 1FN6A 2WPIS 3SV6A 2GDDA 5FXLA 8GCHF 3RXLA 2DE8A 1O0DH 2ZGHA 2Z6BD 1EOLA 4K3JA 1J16A 4PROA 4K8BA 4DGJA 3TNSA 4DY7B 2DUCA 1P2NA 1FI8A 2STBE 3QZRA 1FZZA 1QJ6B 2F91A 4CR5A 2K1QA 3UIRA 2TBSA 1AN1E 3ZZBA 3UPEA 4OS2A 2W26A 3QGJA 1TPSA 1INCA 2XBVA 1GBHA 2ZFTA 2CN0H 1W3CA 4K60A 2F9VA 2ZU3A 2F9PA 3ATLA 3PWBA 1SQAA 2HNTC 1Y3YA 1GL1A 1MU6B 3A7TA 1MAXA 2ZCKP 1GMCF 1GHAF 3S9AA 3RXGA 5A0BA 1UTOA 4Y76A 3M3SA 3RXEA 3A7WA 1AZ8A 3D65E 5JDUB 1KLJH 4TPYA 3SJ8A 4XFQA 1C5SA 2FX4A 5DP3A 3RU4T 5A8YA 4KP0A 1CHOF 1NT1A 1GJCB 2WYGA 1ZRKA 4MTBA 1ABJH 3D62A 4MNYA 4NSVA 3KL6A 4Y7AA 1TPAE 4D76A 1BBRK 1C1VH 1F5LA 2GT8A 1ACBE 1SHYA 1TABE 1K2I1 3SHAH 1ELEE 1WCZA 1A3BH 2PR3A 3FZZA 5TCAA 5T3HA 3A7VA 1J17T 2ZDLA 3ZZ3A 2OQ5A 2G4UA 2A7CA 3BF6H 4SGAE 3RMLH 2HPPH 4DOQA 4UD9H 4JZEH 3LC5A 1N1LA 4FU8A 1YPLH 1ELAA 2EI6A 1D3PB 4VGCC 3ZVFA 2Q6DA 1GHBF 1F0SA 1O3JA 3B23B 2ANMH 5E0HA 1O3CA 3EA8A 1L0ZA 2R0LA 1O2TA 2SNWA 1T7CA 2D8WA 1QURH 3MI4A 4K1SA 1QB9A 1P9SA 2ANWA 4GLYA 3PTNA 1AE5A 1CE5A 1A1RA 2A4GA 4U30A 2BY5X 2GTBA 1G3CA 1LPGB 1BMMH 4IMQA 4FUDA 5DGJA 2R3YA 3T62A 3WY8A 2BY9X 1AFEH 3FAOA 2ZTXA 4SGBE 1W0ZU 1GWAA 2ZQ1A 4D7FA 1BRUP 1KSNA 1OOKB 1YC0A 1O34A 2NWNA 1V2PT 3RXBA 2GD4B 4NA7A 2P8OB 2AIQA 1KDQB 3A82A 2ZFPH 3Q3KA 5FCKA 2JH6D 1K1LA 1BRAA 2ANKH 1GVLA 4A6LA 1QBOA 1MD8A 1P2IA 1Z8GA 3OSYA 3UWJH 3QUMP 2AGIX 4DJZB 4KTCA 1HJAB 3P8GA 3P8OA 2FS9A 1MKWH 3RUOA 3SQEE 1QBVH 1ZSJA 2BDCA 2QCYA 1Z8IB 4ZXYH 5K7RA 1O2PA 1C5NH 7GCHG 2JH5D 2FIRH 2BY7X 1UVUH 3TJVA 1JRTA 2W5EA 6GCHF 4YT6H 1BA8B 4X2VA 1BTYA 5L2YH 2VINA 3MH6A 2FPZA 3UY9A 4BANB 2UWLA 4I32A 3T27A 3MMGA 4FUGA 1FONA 1QB1A 3CS0A 3GY6A 1ZTLA 1UMAH 1O2NA 1UTQA 4JYTA 3N7OA 4WJG2 1DXPA 1C1QA 2FOBA 5HGGA 2P8OC 1EATA 2BD5A 1MTNC 3MNCA 4ABJA 4INLA 1FMGA 3SORA 3MNSA 3A8DA 4U32A 2PHBA 1AFQC 2SGEE 1LQDB 3RXJA 3VB4A 1TMBH 1WQVH 2CF8H 2HNTE 1V6DA 2OINA 1O3AA 3NXPA 2XYAA 2GVFA 3FP6E 3KQDA 2F9NA 5GJ4B 1H9LB 1QTFA 1TGCA 1PJPA 1ZLRA 2Y6TA 3LGYA 2FZZA 1TMTH 4BAMB 4FVDA 1BBRH 1H8IH 1SVPA 2PKAA 3RC6A 1C5YB 1OWKA 1GHWH 4GCHF 3K6ZA 3P17H 4B1TA 1O3DA 3MU1A 2FM2A 1XMNB 1XXFA 2V0BA 1OWEA 4HI3A 1FXYA 2ESTE 3PLPA 3HATH 3RXVA 1XVMA 1IQJA 1P12E 2XBWA 5FCRA 3SW2B 3A84A 4H4FA 4O3UA 3VXFH 3SU5A 2WV4A 1MTUA 1CT4E 5ESTE 4CH8B 4H6TA 1W14U 4Q80A 1DY9A 1A0JA 1SB1H 2BY8X 2FTLE 1G30B 2ZGBH 4WH6A 4ESTE 1QJ7B 4MPVA 1NTPA 1C5UA 8LPRA 4AORA 3TPIZ 5F8ZA 3TLOA 4AB8A 1NS3A 1D9IA 2VIVA 2XC5A 1THSH 1CA0C 1CA8B 1P10A 1E0FD 4BAQB 1CBWB 1MKXK 4X6OA 4X1NU 2SNVA 3MOCA 1C5LH 1TE0A 1LVMA 4NIVA 1GBJA 3W94A 2ZPQA 1FIZA 5DJ7A 3S9BA 1QB6A 1TA6A 3FFGA 1Q3XA 3LJJA 2GCHF 1TPPA 1WAYB 4Y79A 1YCPH 1C1MA 4MPWA 3VB5A 1G3EA 1ZYOA 1S0RA 2Y80A 2ZQ2A 1XKAC 1DLKB 1TGTA 3MHWU 1SLUB 4ABFA 1B7XB 4U2WA 1BRCE 1RD3B 2DE9A 4FUJA 3ZVBA 2W3IA 4NWKA 1O3BA 1TYNA 4FUBA 1DWBH 2PWXA 1MMJN 2FOCA 3VXEH 2ZI2H 3A81A 4JMYA 1UTMA 4NCYA 3ATKA 2XC4A 4IC5A 3U1IB 1GHYH 1UTPA 2GT7A 1LKBA 1LVOA 1GJAB 3SHCH 1YPEH 3GOVB 3FZDA 5H4IB 2OP9A 4NIXA 1MZAA 1EJAA 1F0RA 1SGFG 3T5FH 3QN7A 3FP7E 1CGIE 1Z71A 3AASA 1DWCH 1O5GH 2BDBA 2W7UA 2OTVA 4CRFA 3NWUA 1UK4A 1QL8A 1C5RA 2VH0A 2FOGA 2G5NA 3A83A 1HGTH 1GJ6A 4ISIH 4ZUHA 4X0WU 3PO1B 4IBLH 1HAVA 2GGVB 3GICB 4O97A 2BLWA 3ZV9A 2GDEH 2AGEX 4J2YB 4Y0YE 1YPJH 2ZDNA 2FX6A 4TY6A 4UEHH 4Y10E 2Z9IA 5FAHA 1EP6A 2AERH 2WUCA 1DUAA 1NO9H 2R3UA 1LVBA 4YO9A 4HGCA 1QRWA 1O5BB 3LJOA 4ZROA 1XUFA 2R0KA 3VEQB 1BITA 1EZQA 3BTHE 1EZXC 5L6NH 2Q1JA 1O3MA 4CBNA 2EI7A 1S82A 1BTZA 4LK4A 1VJ9U 1EPTB 3PM3A 1BTWA 4DURA 5CHAB 1C5QA 3TH2H 2FI3E 1TX6A 3M36A 2XNIA 4ISHH 1V2TT 1MUEB 1ZGIA 1HNEE 3QTVH 3E3TA 1TMUH 2FOAA 1FY1A 1GBEA 1BMLA 4BNRA 3KF2A 2J2UA 1SGRE 3ZZ7A 3PMAB 2GZ7A 4GSOA 4X8VH 1LDTT 1O35A 2FI4E 2HOBA 1W13U 4RKOB 1VITH 2UWOA 5F03A 5FHTA 5C67A 2R2MB 2AMQA 3VGCC 1C2IA 1GG6C 1DLEA 1C5TA 1ZSLA 4X6PA 2V35A 3LKWA 3S7KB 1GMDG 1TONA 2V3OH 1ZTKA 4Y11E 3JZ1B 3BG4C 1VCWA 1LPZB 2VIPA 4XBCA 4BAHB 2QXHA 4CHAB 4I8GA 1M9UA 1MKXH 1W2KH 4JK5A 2ZHFH 2CXVA 2A2QH 1EPTC 1PPEE 2C3SA 2Z9LA 1AQ7A 2C4FH 3RXQA 1KDQA 3OY5U 1C5WB 2HVXA 3AAUA 4NZLA 3STJA 4FUFA 1CHGA 4YESB 3MO3A 3R3GB 1O5CB 1OPHB 4X6NA 2PTCE 1GBLA 1DSUA 3RXSA 1V2LT 1QA0A 1QA7A 1HXFH 3P95A 2A32A 2D2DA 1D3QB 1S84A 1DY8A 4B75A 4JZIA 1HAZB 1TQ0B 4YOIA 3VFEA 2WV5A 1H8DH 2JH0D 4X1SU 1BCUH 1ETTH 5EODA 2PTNA 1HAGE 1PQ5A 4K1TA 3SU6A 3LDXH 3PB1E 1XKBC 3GCOA 4AZ2B 1HFDA 1ZR0A 3LGIA 3RDZA 5J4QA 1K1MA 2A4RA 3RMOH 2GMTC 5IDKA 5T6FA 3B8JA 5FPSA 3V13A 1ELFA 5EQRA 1TOCB 5FBEA 5HMAA 2XWAA 1KLTA 6LPRA 3D49H 3C27B 4O03A 5DG6A 2OQUA 2B5TB 4UFGH 4WMEA 4CRAA 3EQ0H 1PPGE 2B8OH 4DVAU 3F1SB 1GI0A 4NG9H 3TH3H 4ASHA 2BVXH 3DHKH 1FDPA 2P95A 1Z8RA 4JYVH 4F4OC 4ZKSU 2GCTC 4NZQA 1P09A 1ETSH 3W95A 1WBGB 2OC7A 2VWOA 1G3BA 4NSYA 3BTME 1KXCA 3GCHC 1TB6H 1CQQA 1UTLM 4NFEA 1UCYK 1IQGA 5T6DA 1YKTA 5I25A 1DT2A 2XCFA 3VPKA 2CF9H 2C8YB 1ELVA 1MKWK 2PUQH 1AHTH 1O3FA 2WINI 4Y8XA 3GDSA 1ZOMA 1NRNH 1D6WA 2G52A 1TRYA 2H1UA 3SJKA 1MCVA 5LPRA 1A5IA 3MH5A 2QY0B 3PLKA 1VITG 1Y3WA 1O2SA 1MCTA 2FP7B 4X8UH 1PPHE 2SGDE 1WQSA 1EJNA 1NRRH 4IS5A 1LO6A 4WF8A 4ZKNU 2G55A 3UQOA 3EGKH 2IPHA 3QDZB 3UOUA 1SOTA 1B0EA 1YPGH 2G51A 3P8FA 3PMHB 2Y82A 3STIA 1XX9A 1C1TA 3SGAE 3GDUA 3SU0A 4KTSA 2VVCA 5TCCA 4YTAA 4VGCB 3ATWA 3BTGE 5EG4A 1HB0B 3A85A 5F6MA 1OP0A 1ZMNA 1HAVB 3ZYDA 2ZC9H 4AN7A 4YOJA 1O3PB 4DIIH 1O33A 1W7XH 3ZVEA 1RXPA 1S85A 2VWNA 4ISOA 2BXUH 2FMJA 3UR6A 1SFQB 2VH6A 2G4TA 4UE7H 2FS8A 1UHBA 1OYTH 1GBFA 8GCHG 2FWWA 2ZHWH 2VVUA 4JCNA 1AVWA 2OUAA 2ZCLP 3RXKA 4IN1A 1NPMA 5TJXA 1O5FH 4B76A 1GHVH 3E0NB 2O8UA 3GCTF 1H4WA 2Y5GA 1FPHH 2IN2A 4A5TS 2HNTF 1P2QA 1BMNH 1P0SH 1TLDA 1V2OT 1MQ6A 2NU2E 3LGVA 1UK2A 3OX7U 3RMNH 2FYQA 1GDUA 5EW2H 1SGTA 1QY6A 3U8RH 1AKSA 5BPEA 5C2ZA 2ZU2A 1CGHA 4INHA 4MPUA 2FOFA 1NFUA 1O2OA 4FUCA 2GZ9A 1H9HE 2VGCC 2ILNA 1GJ7B 2BHGA 2BQ6B 5DKMA 1GMCG 1G3DA 1T8LA 4E7NA 1O3LA 1O37A 7GCHF 2OC8A 2G5VA 2AH4X 3HKJB 3BEFB 4OS4A 2F9OA 4ZHMU 2IJOB 2GKVE 1TNLA 1N8OB 1P8VC 2ZTZA 2VIOA 4XE4A 1QFKH 1CHOG 1RGQA 1RTFB 5F8TA 1EKBB 2I6SA 2VB0A 3GCNA 1LQEA 3EDXB 2ZFFH 3RM2H 3ZVAA 1MTSA 2FEQH 4R0IA 3BEIB 3M5LA 3F9EA 1EB2A 3S69A 1W0YH 1MTNB 1YPHE 1U6QA 2ZFRH 2FTMA 3PYHA 3RXMA 1RIWC 1F0TA 1AFQB 4X1RU 1BMAA 2RCEA 1UCYH 3Q3XA 1SR5C 1EPTA 1YCPK 2TGAA 3SI4H 3P8NA 1HAPH 2XWBI 4ZHLU 4E7RG 1ELDE 5C20A 1A7SA 1HAOH 1GJ8B 1GHXH 3RXIA 3SBKA 5GWZA 3SUFA 1GHBG 3V3MA 1OP8A 2W3KA 5DP7A 1SGQE 2ZO3H 2LNCA 2H9TH 2PKSC 4INKA 2Z7FE 1TNIA 5E2PA 1O2YA 1JIRA 3ZZ9A 3GY5A 1HCGA 1N8OC 3K2UA 4B74A 3KNXA 3AVZA 3GY3A 4K8YA 5DPAA 1PQ7A 1FPCH 1VZQH 2RG3A 4X6MA 1G2MA 1OXGA 2R2WU 1MTVA 2CMYA 2WUBA 4WH8A 5PTPA 4AOQA 1LPKB 1Z7KA 1V2JT 3Q3YA 3U9AH 1HYLA 1A46H 1DX5M 1FN8A 2BB4A 3TITA 1LHDH 1UVTH 3BTTE 1O2GH 2F83A 4TPIZ 3SGQE 2QAAA 2ZFQH 2QXGA 5DP5A 2J94A 1K22H 1O2KA 3BTEE 4UDWH 1TALA 4O3TA 4Y0ZE 2A7HA 2BLQA 2P94A 3NK8A 1D4PB 1VGCC 3ZVCA 2D1JA 1FY5A 5AF9H 2JKHA 1SG8B 2BX4A 4GPGA 1CA0B 3E91A 3E1XB 1YYY1 1KXDA 2QA9E 1SPJA 2C93B 1Y5BT 3V7TA 1MTWA 5GDSH 5JBAS 3M3TA 1W10U 1SBWA 1NFYA 2QF3A 4YOGA 1EAWA 9ESTA 2A5AA 2BD7A 4MQAA 5EU8A 3RU4E 2HRVA 1CGJE 3A7ZA 3VB6A 6GCHG 4A1VA 1IHTH 1P01A 3F6UH 1MBQA 1QRXA 1HAIH 1AU8A 5A0CA 1SLXB 1C5PA 4Y8YA 3URCA 3TJOA 1V2QT 2TGTA 4X2YA 1SGYE 2P16A 1DUEA 2Z9JA 1SLVB 4Q7XA 4ABBA 1FY3A 1UTKA 4ABIA 3SJOA 2UUJB 2XTTB 1HLTH 1BQYA 2PV9B 1W8BH 2A7JA 4R8TB 3L33A 1V2WT 2VWMA 2XW9A 4NWLA 1AD8H 4CR9A 1C1RA 1C2DA 1WU1A 1Z1IA 3RLWH 2BX3A 4NA9H 3RC4A 5EW1H 5C3NA 5GCHF 4BXWA 2PUXB 2H2ZA 1Y59T 1PPBH 3MO6A 4OS1A 2Q6FA 1A5GH 2UWPA 4LOYH 1VCQA 4XOJA 1HPGA 5EGMA 4IN2A 1FLEE 2J95A 1A61H 3MU4A 2C8ZB 1MH0A 1K1PA 1UVSH 1A5HA 1UHBB 4AGJA 4CBOA 4D9QA 1Y8TA 5LPFA 2RA0A 3LH1A 4X1PU 1YLDA 4NFFA 3KQCA 2BD8A 4K1EA 1GCDA 2VJ1A 1NFWA 3L3TA 1LHCH 3SV8A 2J4IA 1AB9C 5I46H 3MWIU 1FNIA 2J9NA 3URDA 1PQ8A 3E90B 1ARBA 4H42U 5EOKA 1DE7H 1L1JA 4D9RA 2IOTA 2H9HA 1FAXA 3RXTA 5GPIB 4YZUA 1SC8U 1KXEA 3LGUA 4AB9A 2Y7XA 5E2OA 5JPMH 5C1YA 3NCLA 2PGQB 1THRH 1Y3UA 1ESAA 1TOMH 1AKSB 2AS9A 1S6FA 3TVJB 4WXVA 3T29A 1ELCA 3I78A 3ZZAA 4BAOB 1C1OA 2P59A 1BTPA 2BOKA 2BD3A 3HPTB 3ZVGA 2XBYA 1ETRH 2OLGA 4OS6A 2OC1A 3BTDE 1TGNA 1HAHH 3I77A 3K65B 2F9UA 1S5SA 2BTCE 2ZG0H 4A7IB 4ZKOU 1JOUB 3RXFA 1KYNA 4M7GA 1ZMLA 1ZGVA 3K6YA 3K9XB 3DFJA 1HAYB 1XUKA 1YGCH 3VGCB 1GG6B 4NGAH 1N6YA 1LVYA 3TGKE 2FOHA 1BTHH 2ZEBA 3BV9B 5C1XA 1EX3A 6CHAC 3BTQE 1NU7B 1LKAA 4Y71A 2NU1E 1TRMA 4BAKB 4IW4E 5E0GA 1EP5A 3BG4B 4AFZA 4I33A 3SQHE 3TGJE 3UNQA 5C5OA 1MD7A 1SI5H 3H7TA 1SHHB 1WSSH 3IG6B 3SJIA 2B9LA 1O32A 1OYQA 1A2CH 3ENSB 3Q00A 1O3EA 3FANA 1P9UA 4X8SH 1C2LA 1A0LA 1YPKH 4GAWA 2OD3B 4Q7ZA 4WMDA 1EQ9A 1GBMA 1OSSA 1IQLA 1GI8B 1ZSKA 4HFPB 4JYUH 4A92A 4OGYA 1P2KA 3HK3B 1BB0B 2OXSA 3LH3A 3SUDA 1J14A 2ODYB 1GJ5H 4OGXA 1DITH 5AFYH 1V2KT 1Z8JB 1P3EA 4MNVA 4AX9H 1TA2A 2PW8H 3SUGA 1P2MA 3VB3A 1GBDA 1GDNA 1YM0A 1AZZA 2I6QA 1EJMA 4DIHH 4I7YH 1ZJKA 3LONA 4WY3A 1AI8H 1TQ7B 4BTTB 1J9CH 1C1WH 3BTFE 5DK1A 1O5DH 1W12U 4GHTA 1KLIH 2GMTB 1EB1H 1GVZA 3RXUA 2A1DB 2SGPE 3GDVA 4ISLA 3RC5A 1ANCA 1WTHD 4NIYA 1G37A 2ZA5A 1MAYA 5G4BA 1TRNA 1D3DB 2WPMS 3A7YA 2Z3DA 3FVFB 4WVPE 5DP6A 3KHVA 1GGDC 1Y5UT 1NC6A 1V2VT 3M61U 1HXEH 1C4V2 2PGBB 4Y8ZA 1F0UA 2O8WA 1BBRE 1H9IE 4HTCH 2BD4A 4ZH8A 3RM0H 1ELGA 2H9EH 3LIWA 1G9IE 1GBTA 1V2MT 2EA3A 1QBNA 3UNRA 1TPOA 5HM2A 1JMOH 4MPXA 3Q76A 1ZJDA 1DICA 2Z94A 3BN9A 1ZZZA 1GBIA 1IQIA 2ZU5A 1GBKA 2FOEA 3BIVH 1K9OE 1F5KU 3UNSA 1OWDA 4IC6A 1C5VA 4Y7BA 1GI5A 2GCTB 1O3GA 7LPRA 1SGNE 2ZDKA 4Q7YA 1CU1A 1IQEA 2EC9H 3ZZ5A 4DT7B 2HGTH 1C2FA 2VIDA 2NU3E 2VIWA 3GCHB 3KN2A 5B6OA 2ZDMA 1FIWA 2QYIA 2W7SA 3ZV8A 1C9TA 1KTSB 1PQAA 1SGFA 1ZRBA 4BXSA 3KIDU 4KGAA 1K21H 1GMHF 1FQ3A 4NA8A 3EE0B 3GY7A 2ZHQH 1PPFE 5E8EH 4I8HA 1SL3A 1LMWB 1C1NA 1Q31A 3E6PH 4MLFB 1QRZA 1PPZA 1FJSA 1TNGA 2BDHA 2ZPRA 3MYWA 2JETC 2ZHEH 5HYOA
chains in the Genus database with same CATH superfamily
3ESTA 1HJ8A 1F5RA 2ALVA 1O2JA 3BEUA 2ODQA 3P70B 1VITF 1G36A 1P11E 2D26C 1IQNA 1TWXB 1YLCA 5ETXA 2CHAB 4E05H 3RXPA 1GCTC 1GBCA 1KTTB 3S0NA 2HPQH 3RXDA 3UFAA 1BOQA 3BTWE 5ABWA 1E38B 3P6ZB 3BTKE 1HUTH 2O8TA 3RP2A 5A8ZA 2ZDVH 4MDSA 2IJD1 1YPMH 2QF0A 3EAJA 4P02A 1P03A 1GI1A 1C1SA 1C2MA 1C1PA 2F4LA 2XC0A 4IMZA 5F8XA 4Z6AH 1P06A 3H7OA 1YCPM 1NRPH 1UTNA 3AK5A 1AE8H 2QXIA 2ZHDA 1ANEA 2LPRA 2C8XB 2J38A 1E1RD 3ZZ6A 4XBDA 1SMFE 2QC2A 3SV9A 2AFQB 1XVOA 2SFAA 4ISNA 2PSYA 2VU8E 1ZHMA 4BTUB 4TY7A 4LZ4B 3SUEA 3ODFA 2ZIQH 1GJ4H 1WUNH 1DFPA 1W7GH 3A80A 2WYJA 2J34A 4A1TA 5JB9S 2F3CE 2CHAC 2SGAA 1GJ9B 3UR9A 5IK2D 1ELTA 1FV9A 2J92A 5AVDA 1AVXA 1IQMA 1AY6H 5JBBS 4FVBA 5EXNA 1T8MA 2BVSH 2WPHS 3TIUA 1C5ZB 1BRBE 1C1UH 2A4OA 3E0PB 1E36B 1DDJA 3LGTA 2UUYA 2P3FH 2WV9A 4GHQA 3PV5A 2VGCB 3H5CB 3VB7A 4AYVB 2EEKA 1GI4A 3MH4A 2WPLS 1HJ9A 2HALA 5C17A 1WV7H 2XBXA 4ABEA 3BSQA 3M7QA 3OU0A 2C90B 1Z6EA 4I31A 3I29A 5EXMA 4CRCA 1AMHA 4CREA 2GV6A 1O2QA 3RXHA 4RKJB 1DSTA 2WPDD 3SNCA 1UO6A 3O8BA 1BJUA 4TYDA 3RXAA 3MNXA 1O30A 3MO9A 1E35B 1LHGH 3A8CA 5FBIA 3LC3A 1TBQH 1P57B 1HV7A 3V12A 1W11U 4CRGA 2ZU4A 4UFFH 2PSXA 3NKKA 5EJ1A 2BLVA 3SNAA 5FX5A 4FOUC 1K1IA 1RIWB 1PYTD 1BDAA 1HRTH 1C2EA 1TX7A 3TGIE 2TGPZ 4ABDA 2QF4A 1NROH 4ABHA 3D23A 1OKXA 3TNTA 5FPTA 3KYFA 4XBBA 4KTUA 2O9QA 3MU5A 3DD2H 1O2VA 2OC0A 3IWMA 4LZ1H 1C2GA 3MNBA 5FL7D 2AIPA 5EXLA 1XUIA 2QGRA 3OY6U 3UWIA 2L74A 3A8AA 1GHAG 1BT7A 3F9GA 3LGWA 2UUFB 3SN8A 5JB8S 2V3HH 1QJ1B 2Z9GA 4GVUA 1QL7A 1O5EH 3TK9A 4F49A 4FUHA 7ESTE 2AMDA 3F9HA 2PKSB 1HIAA 2AYWA 2QIQA 1SLWB 2V6NA 2OK5A 4DCDA 1HAXB 3SNBA 1AWHB 4YM9A 1L2EA 4ZHAA 1QGFA 1V2UT 3BIUH 4MNXA 1SQTA 1K1JA 1O31A 1BTUA 3GY4A 2BY6X 2FESH 2HWLB 1RRKA 3GY8A 1CT2E 1SGEE 5AHGH 3SU4A 1J15A 1WYKA 1XUJA 3UTUH 3KCGH 2BQWB 1G2LA 1SFIA 2FODA 3F68H 3U98H 3M35A 3CNRA 3A89A 5A2MH 5J4SA 2P93A 2P3UB 3AW0A 3TK6A 1O3NA 1TBRH 2ZFSA 9LPRA 3RXCA 3OYPA 4ZAEA 2A5IA 1K1OA 3GCTG 5HXFA 4KKDA 5DO4H 1BUIA 5HIYA 1QCPA 1NRQH 1DM4B 4HG6A 6ESTA 1MQ5A 1UK3A 1ANBA 3A87A 2WPKS 1VGCB 1OWIA 1TNHA 4AG1A 5A8XA 2BD9A 3DT0H 5HIZA 3ZZCA 3GYMA 5LGOA 3MU0A 1C5MD 1QL9A 3BG8A 5AFZH 1BJVA 3P92A 3Q77A 1PYTC 1XUGA 1F92A 4X1QU 4X2XA 4UONA 2RA3A 1EAUA 3C1KA 1FAKH 2GP9B 1S81A 1ESBA 2ODPA 2BQ7B 1TX8A 1NESE 1CVWH 3V0XA 3O8CA 2ZGXH 1NM6A 3M7UA 1O2RA 2H5CA 3TJNA 4WWYA 2BVRH 1QIXB 3DSGA 2HLCA 2AMPA 2A4QA 2BDIA 4Z0KA 4CRBA 2ZGJA 3HK6B 1O3IA 4UFEH 1Z6JH 4B2BA 4CRDA 3AW1A 1C2JA 3A7XA 1ID5H 2XXLA 1UJ1A 1LHEH 3QO6A 3SU3A 4ABAA 2BYAX 1P02A 2VWLA 2STAE 5BRRE 1XM1A 2BXTH 2WPJS 2BDGA 4FU7A 1NY22 4QT8C 3SO3A 4FUEA 3M5MA 1VCPA 1GPZA 1QQ4A 3GS9A 1DOJA 4AFSA 4AGKA 4TWWA 1TGSZ 5IYTA 2H6MA 1H1BA 4RI0A 4DW2U 2TPIZ 3ZVDA 5CMXH 1AUJA 1RTLA 4K5ZA 1HJAC 1DWEH 1XXDA 2ASUB 1EAXA 4THNH 3MFJA 3ZYEA 2PLXA 4A1XA 4DT4A 1O2UA 3DA9B 2FI5E 2C8WB 5K0HA 2FDAA 1Y3VA 5DP4A 1ARCA 1BIOA 1GI9B 4YXWD 2A2XH 5EQQA 2M5TA 2Y5FA 2CK3D 3A8BA 7KMEH 3ODDA 5C0UA 4D7GA 1KXFA 2G81E 1AB9B 1T4UH 3SNEA 2ZNKH 4BTIB 2AEIH 1OWHA 1KXBA 2YOLA 1ZTJA 1NFXA 1ABIH 5A09A 2A0QB 1T8NA 2ZZUH 3EYDA 4JZ1A 4B6FA 1FY8E 4MG3A 3KQBA 1GHZA 1JBUH 4TWYA 1Y3XA 2GV7A 2OCVB 2FXRA 3T25A 1BZXE 1F2SE 1K1NA 1GI7B 3UQVA 3GY2A 3N7DA 2L6OA 2QV1A 1PPCE 2ZWLH 3GISB 1VJAU 3ATMA 5L2ZH 1T4VH 3A88A 4BOHA 4M9FA 4ZMAH 4XDEA 3WW7A 2GZ8A 3MH7A 1TGBA 2XRCA 2A45B 1E79D 3A86A 1ELBA 1O2ZA 1GJDB 2Z3CA 4OS7A 3PTBA 2OBQA 2TIOA 3QLPH 3LT3A 1IQHA 1GBBA 2QN5T 2ZKSA 5GXPA 2BM2A 3E16B 2THFB 8ESTE 2Z3EA 4AG2A 3QGNB 4GCHG 1T31A 2BLOA 3SJ9A 4ACBA 2P3TB 1C9PA 1WXRA 3RXOA 3T26A 1O2IA 2Y5HA 2ZPSA 1SGCA 2BZ6H 2KAIA 1NZQH 3PV4A 1YF4A 6CHAB 2ZCHP 2NU4E 4UFDH 1P04A 2FOMB 1C2HA 2SGQE 3L6PA 1V3XA 3U69H 1RTKA 1S6HA 3SU2A 1AGJA 1EOJA 3UREA 3T28A 4ZKRU 4MNWA 4KELA 5LH8A 3EA7A 3B9FH 3ZZ8A 3HKIB 1MZDA 3SZNA 5C5NA 1WOFA 5HM9A 1BHXB 2UUKB 1AIXH 1SOZA 3F0PA 3ELAH 3CP7A 1YBWA 1EASA 2F9BH 1JXPA 1TFXA 3JZ2B 5CE1A 1ZHPA 3AAVA 1GDQA 1RS0A 2O8LA 2FLRH 4U01A 3EE7A 2GX4A 3DFLA 1L4ZA 2CV3A 5GCHG 2ZP0H 3HGPA 2TRMA 4AYYB 2FLBH 1S0QA 3QX5H 3OEHD 2AGGX 1DVAH 1HIAB 3PROA 1DWDH 5FX6A 4I8KA 3WWFA 2R9PA 2XCNA 1CBWC 1P2JA 3SV7A 3ZZ4A 5HKKD 3ZZDA 4X8TH 2K8IA 1MABB 2YNAA 2B7DH 1SQOA 3SI3H 4D8NA 4B2CA 1SGDE 1UCYE 3R0FA 4YLUA 1C5OH 1D6RA 5ESBA 2CGAA 4B6EA 2GCHG 5GIBA 1GI6A 2A31A 2BZAA 3CS7A 4B71A 2PFEA 2Z9KA 1P2OA 1GMDF 4JK6A 4K2YA 3O8DA 4WXIA 3PWCA 4Y6DA 1YP9A 1GGDB 4GUXA 1V2ST 3MTYA 3LU9B 1O3KA 5FPYA 1WTGH 4JZFH 3KEEA 1SSXA 1ZMJA 4I8LA 5E0JA 4AFQA 1FUJA 1O38A 1GI2A 1JWTA 1OP2A 2KFWA 1CT0E 1O2XA 1T8OA 3FP8E 1OX1A 8KME2 1IQKA 3ITIA 3M3VA 2YNBA 3ATIA 4ABGA 1HDTH 1Q2WA 1RFNA 2VIQA 2EQNA 5EJZA 3KQEA 5DP9A 2A5KA 1BTXA 4X2WA 2CJIA 1T32A 1QHRB 1C5XB 1TIOA 1OHHD 1O2LA 4WMFA 3NUMA 1GVKB 1L1NA 1O2HA 2EY4C 5JYIA 1TNJA 1IHSH 1ZPZA 2ANYA 3QK1A 3F9FA 1D3TB 4MVNA 2ZECA 2BDYA 4AFUA 3UUZA 2Y7ZA 3KGPA 3RLYH 3VG8A 4K69A 5EPYA 1A0HB 1GI3A 1QQUA 3MU8A 3PO1C 4OS5A 1GBAA 3UOPA 5B6LA 2Y81A 1RJXB 1O39A 4LXBH 1XUHA 1AWFH 1NN6A 2ULLA 1IAUA 5SGAE 1UVPA 3PLBA 1BHXF 2QE7D 4RN6A 4RSPA 2ALPA 2BDAA 4NIWA 2JETB 3LPRA 3CENA 3NZIA 2V3MA 1QNJA 1TAWA 3M37A 4YT7H 1EAIA 1SGPE 1F7ZA 4H6SB 2ZDAH 1JIMA 3SGBE 2FYRA 1UTJA 1GCTB 1MU8B 1OWJA 1EZSC 1GJBB 1P05A 1O3HA 1TBZH 5LPEA 2Q6GA 3RMMH 3QTOH 3IITA 5CHAC 5T6GA 3U8OH 5A0AE 1E34B 2ZF0H 4CH2B 3QWCH 1X7AC 4F55A 2W6JD 4B2AA 1ANDA 3M5OA 1DXWA 5EQSA 1IOEA 1ZPCA 3DUXH 1CO7E 1KIGH 2NU0E 1LHFH 4DG4A 4J1YA 1P3CA 5JBTA 5C0TA 1AO5A 1DS2E 1C4U2 4IGDA 2TGDA 2PKAB 1VR1H 3QZQA 1EZUC 1B5GH 2VNTA 4FXGH 4JZDH 3TJUA 1THPB 3HGNA 1EUFA 1TNKA 4ZXXH 3SV2H 3TU7H 4E06H 3U1JB 1AUTC 3SOSA 3RXRA 1Y5AT 3G01A 4YLQH 2KZ4A 1QR3E 2BMGB 4Q2KA 4O9VA 1S6LA 1O5AB 1ESTA 1SGIB 4FUIA 1O3OA 2O8MA 1FY4A 1OS8A 2OBOA 1J8AA 2ZTYA 1C4Y2 1O36A 1DPOA 1O2WA 2H5DA 3LOXA 1A3EH 3M5NA 1A4WH 3NPSA 4CHAC 1K28D 2RDLA 1GL0E 2FO9A 2G8TA 1V2RT 1NU9A 1PFXC 5DP8A 1ZPBA 2VVVA 5EPNA 1B0FA 1AVGH 2EI8A 1BMFD 1DANH 1E37B 3M7TA 1YPHC 3PMBB 1C2KA 1LCYA 3OEED 3S9CA 1JRSA 4B73A 3EA9A 3N7EA 3SU1A 1NRSH 3OTJE 2SGFE 3T2NA 2G00A 2BD2A 1CSOE 5L30H 4XSKU 1HBTH 4HZHA 1IQFA 3RU4D 4I8JA 1KXAA 3PMJA 5JBCS 3O8RA 3GYLB 3SNDA 2QXJA 3TK5A 3U8TH 3S7HB 3TH4H 1N6XA 1ZHRA 2KAIB 1G32B 2BOHB 1ORFA 2ZU1A 2ZGCA 1EXFA 1L1GA 1L4DA 1S83A 1V2NT 1O2MA 3E8LA 1MBMA 3SYJA 1LTOA 4FU9A 1GMHG 1UVOA 5C1UA 1Z1JA 2B0FA 3PV2A 1KY9A 1FN6A 2WPIS 3SV6A 2GDDA 5FXLA 8GCHF 3RXLA 2DE8A 1O0DH 2ZGHA 2Z6BD 1EOLA 4K3JA 1J16A 4PROA 4K8BA 2GJGA 4DGJA 3TNSA 4DY7B 2DUCA 1P2NA 1FI8A 2STBE 3QZRA 3DSPA 2LP6A 1FZZA 1QJ6B 2F91A 4CR5A 2K1QA 3UIRA 2TBSA 1AN1E 3ZZBA 3UPEA 4OS2A 2KCPA 2W26A 3QGJA 1TPSA 1INCA 2XBVA 1GBHA 2ZFTA 2CN0H 1W3CA 3KYGA 4K60A 2F9VA 2YMSD 2ZU3A 2F9PA 3ATLA 3PWBA 1SQAA 2HNTC 1Y3YA 1GL1A 1MU6B 3A7TA 1MAXA 2ZCKP 1GMCF 3FN8A 1GHAF 3S9AA 3RXGA 5A0BA 1UTOA 4Y76A 3M3SA 3RXEA 1H8ED 1AZ8A 3A7WA 3D65E 5JDUB 1KLJH 4TPYA 3SJ8A 4XFQA 1C5SA 2FX4A 5DP3A 3RU4T 5A8YA 4KP0A 1CHOF 1NT1A 1GJCB 2WYGA 1ZRKA 4MTBA 1ABJH 3D62A 4MNYA 4NSVA 3KL6A 4Y7AA 1TPAE 4D76A 1BBRK 1C1VH 1F5LA 2GT8A 1ACBE 1SHYA 1TABE 1K2I1 3SHAH 1ELEE 1WCZA 1A3BH 5T1VA 2PR3A 3FZZA 5TCAA 5T3HA 3A7VA 1J17T 2HVYB 2ZDLA 3ZZ3A 2OQ5A 2G4UA 2A7CA 3BF6H 4SGAE 3RMLH 4Z1MD 2HPPH 4DOQA 4UD9H 4JZEH 3LC5A 1N1LA 4FU8A 1YPLH 1ELAA 2EI6A 1D3PB 4VGCC 3ZVFA 2Q6DA 1GHBF 1F0SA 1O3JA 2JIZD 3B23B 2ANMH 5E0HA 1O3CA 1SKYE 3EA8A 1L0ZA 2R0LA 1O2TA 2SNWA 1T7CA 2D8WA 1QURH 3MI4A 4K1SA 2YMSC 1QB9A 1P9SA 2ANWA 4GLYA 3PTNA 1AE5A 1CE5A 1A1RA 2A4GA 4U30A 2BY5X 2GTBA 1G3CA 1LPGB 1BMMH 4IMQA 4FUDA 5DGJA 2R3YA 3T62A 3WY8A 2BY9X 1AFEH 3FAOA 2ZTXA 4I86A 4SGBE 1W0ZU 1GWAA 2ZQ1A 4D7FA 4Q4LA 1BRUP 1KSNA 1OOKB 1YC0A 1O34A 2NWNA 1V2PT 3RXBA 2GD4B 4NA7A 3NRLA 2P8OB 2AIQA 1KDQB 3A82A 2ZFPH 3Q3KA 5FCKA 2JH6D 1K1LA 1BRAA 3H09A 2ANKH 1GVLA 4A6LA 1QBOA 1MD8A 1P2IA 1Z8GA 3OSYA 3UWJH 3QUMP 2AGIX 4OM9A 4DJZB 4KTCA 1HJAB 3P8GA 3P8OA 2FS9A 1MKWH 3RUOA 3SQEE 1QBVH 1ZSJA 2BDCA 2QCYA 1Z8IB 4ZXYH 5K7RA 1O2PA 1C5NH 7GCHG 2JH5D 2FIRH 2BY7X 1QZ8A 1UVUH 3TJVA 1JRTA 2W5EA 6GCHF 4YT6H 1BA8B 4X2VA 1BTYA 5L2YH 2VINA 3MH6A 2AHME 5CDFE 2FPZA 3UY9A 4BANB 2UWLA 4I32A 3T27A 3MMGA 4FUGA 1FONA 1QB1A 3CS0A 3GY6A 1ZTLA 1UMAH 1O2NA 1UTQA 4JYTA 3N7OA 4WJG2 1DXPA 1C1QA 2FOBA 5HGGA 2P8OC 1EATA 2BD5A 1MTNC 3MNCA 4ABJA 3OE7D 4INLA 1FMGA 3SORA 3MNSA 3A8DA 4U32A 2PHBA 1AFQC 2SGEE 1LQDB 3RXJA 1COWD 3VB4A 1TMBH 1WQVH 2CF8H 2HNTE 1V6DA 2OINA 1O3AA 3NXPA 2XYAA 2GVFA 3FP6E 3KQDA 2F9NA 5GJ4B 1H9LB 1QTFA 1TGCA 1PJPA 1ZLRA 2Y6TA 3LGYA 2FZZA 1TMTH 4BAMB 2LELA 4FVDA 1BBRH 1H8IH 1SVPA 2W6ID 2PKAA 4RT1A 3RC6A 1C5YB 1OWKA 1GHWH 4GCHF 3K6ZA 3P17H 4B1TA 1O3DA 3MU1A 2FM2A 1XMNB 1XXFA 2V0BA 1OWEA 4HI3A 1FXYA 2ESTE 3PLPA 1EFRD 3HATH 3RXVA 1XVMA 1IQJA 1P12E 2XBWA 5FCRA 3SZEA 3SW2B 3A84A 3PRDA 4H4FA 4O3UA 3VXFH 3SU5A 5DSFA 2WV4A 3WWBA 1MTUA 1CT4E 5ESTE 4CH8B 4H6TA 1W14U 4Q80A 1DY9A 1A0JA 1SB1H 2BY8X 2FTLE 1G30B 2ZGBH 4WH6A 4ESTE 1QJ7B 4MPVA 1NTPA 1C5UA 8LPRA 4AORA 1VKYA 3TPIZ 5F8ZA 3TLOA 4AB8A 1NS3A 1D9IA 2VIVA 4F48B 1WDIA 2XC5A 1THSH 1CA0C 1CA8B 1P10A 1E0FD 4BAQB 1CBWB 1MKXK 4X6OA 4X1NU 2SNVA 3MOCA 1C5LH 1TE0A 1LVMA 3OAAD 1GBJA 4NIVA 3W94A 2ZPQA 1FIZA 5DJ7A 3S9BA 1QB6A 1TA6A 3FFGA 1Q3XA 3LJJA 2GCHF 1TPPA 1WAYB 4Y79A 1YCPH 1C1MA 4MPWA 3VB5A 1G3EA 1ZYOA 1S0RA 2Y80A 2ZQ2A 1XKAC 1DLKB 3F2FA 1TGTA 3MHWU 1SLUB 4ABFA 2XNDD 1B7XB 4U2WA 1BRCE 1RD3B 2DE9A 4FUJA 3ZVBA 2W3IA 4NWKA 1O3BA 1TYNA 4FUBA 1DWBH 2PWXA 1MMJN 2FOCA 3VXEH 2ZI2H 3A81A 4JMYA 1UTMA 4NCYA 3ATKA 3KQ5A 2XC4A 4IC5A 3U1IB 1GHYH 1UTPA 2GT7A 1LKBA 1LVOA 1GJAB 3SHCH 1YPEH 3GOVB 3FZDA 5H4IB 2OP9A 4NIXA 1MZAA 1EJAA 1F0RA 1SGFG 3T5FH 3QN7A 3FP7E 1CGIE 1Z71A 3AASA 1DWCH 1O5GH 2BDBA 2W7UA 2PP6A 2OTVA 4CRFA 3NWUA 1UK4A 1QL8A 1C5RA 2VH0A 2FOGA 2G5NA 3A83A 1HGTH 1GJ6A 4ISIH 4ZUHA 4X0WU 3PO1B 4IBLH 1HAVA 2GGVB 3GICB 4O97A 2BLWA 3ZV9A 2GDEH 2AGEX 4J2YB 4Y0YE 1YPJH 2ZDNA 2FX6A 4TY6A 4UEHH 4Y10E 2Z9IA 5FAHA 1EP6A 2AERH 2WUCA 1DUAA 1NO9H 2R3UA 2WSSD 1LVBA 4YO9A 4HGCA 1QRWA 1O5BB 3LJOA 4ZROA 1XUFA 2R0KA 3VEQB 1BITA 1EZQA 3BTHE 1EZXC 1NBMD 2Q1JA 5L6NH 1O3MA 4CBNA 2EI7A 1S82A 1BTZA 4LK4A 5CHBA 1VJ9U 1EPTB 3PM3A 1BTWA 4DURA 5CHAB 1C5QA 3W1EA 2XOKD 3TH2H 2FI3E 1TX6A 3M36A 2XNIA 4ISHH 1V2TT 1MUEB 1ZGIA 1HNEE 3QTVH 3E3TA 1TMUH 2FOAA 1FY1A 1GBEA 1BMLA 4BNRA 3FKSD 3KF2A 2J2UA 1SGRE 3ZZ7A 3PMAB 2GZ7A 4GSOA 4X8VH 1LDTT 1O35A 2FI4E 2HOBA 1W13U 4RKOB 1VITH 2JDID 2UWOA 5F03A 5FHTA 5C67A 2R2MB 2AMQA 3VGCC 1C2IA 4XRNA 1GG6C 1DLEA 1C5TA 1ZSLA 4X6PA 2V35A 3LKWA 3S7KB 1GMDG 1TONA 2V3OH 1ZTKA 4Y11E 3JZ1B 3BG4C 1VCWA 1LPZB 2VIPA 4XBCA 4BAHB 2QXHA 4CHAB 4I8GA 1M9UA 1MKXH 1W2KH 4JK5A 2ZHFH 2CXVA 2A2QH 1EPTC 1PPEE 2C3SA 2Z9LA 2J5UA 1AQ7A 2C4FH 3RXQA 1KDQA 3OY5U 1C5WB 2HVXA 2J97A 3AAUA 4NZLA 4FUFA 1CHGA 3STJA 4YESB 3MO3A 3R3GB 1O5CB 1OPHB 4X6NA 2PTCE 1GBLA 1DSUA 3RXSA 2F43B 1V2LT 1QA0A 1QA7A 5F53A 1HXFH 3P95A 2A32A 2D2DA 1D3QB 1S84A 1DY8A 4B75A 4JZIA 1HAZB 1TQ0B 4YOIA 3VFEA 2WV5A 1H8DH 2JH0D 4X1SU 1BCUH 1ETTH 5EODA 2PTNA 1HAGE 1PQ5A 4K1TA 3SU6A 3LDXH 3PB1E 1XKBC 3GCOA 4AZ2B 1HFDA 1ZR0A 3LGIA 3RDZA 5J4QA 1K1MA 2A4RA 3RMOH 4ASUD 2GMTC 2KM0A 5IDKA 3F0OA 1H8HD 5T6FA 3B8JA 5FPSA 3V13A 1ELFA 5EQRA 1TOCB 5FBEA 5HMAA 2XWAA 1KLTA 6LPRA 3D49H 3C27B 4TT3D 4O03A 5DG6A 2OQUA 2B5TB 4UFGH 4WMEA 4CRAA 3EQ0H 1PPGE 2B8OH 4DVAU 2JJ1D 3F1SB 1GI0A 4NG9H 3TH3H 4ASHA 2BVXH 4RT0A 3DHKH 1FDPA 2P95A 1Z8RA 2VBCA 4JYVH 4F4OC 4ZKSU 4ACAA 2GCTC 4NZQA 1P09A 1ETSH 3W95A 1WBGB 2OC7A 3F2HA 2VWOA 1G3BA 4NSYA 3BTME 1KXCA 3GCHC 1TB6H 1CQQA 1UTLM 4NFEA 1KMHB 1UCYK 1IQGA 5T6DA 2HLDD 1YKTA 5I25A 1DT2A 2XCFA 3VPKA 2CF9H 2KCYA 2C8YB 1ELVA 2KR7A 1MKWK 2PUQH 1AHTH 1O3FA 2WINI 4Y8XA 3GDSA 1ZOMA 1NRNH 1D6WA 2G52A 1TRYA 2H1UA 3SJKA 1MCVA 5LPRA 1A5IA 3MH5A 2QY0B 3PLKA 1VITG 1Y3WA 1O2SA 1MCTA 2FP7B 4X8UH 1PPHE 2SGDE 1WQSA 1EJNA 1NRRH 4IS5A 1LO6A 4WF8A 4ZKNU 1YWUA 2KCOA 2G55A 3UQOA 3EGKH 2IPHA 3QDZB 3UOUA 1SOTA 1B0EA 1YPGH 2G51A 3P8FA 3PMHB 2Y82A 3STIA 1XX9A 1C1TA 3SGAE 3GDUA 3SU0A 4KTSA 2VVCA 5TCCA 4YTAA 4VGCB 3ATWA 4AC9A 3BTGE 5EG4A 1HB0B 3A85A 5F6MA 1OP0A 1ZMNA 1HAVB 3ZYDA 2ZC9H 4AN7A 4YOJA 1O3PB 4DIIH 1O33A 1W7XH 3ZVEA 1E1QD 1RXPA 1S85A 2VWNA 2IPQX 2YMSB 4ISOA 2BXUH 2FMJA 3UR6A 1SFQB 2VH6A 2G4TA 4UE7H 2FS8A 1UHBA 1OYTH 1GBFA 8GCHG 2FWWA 2WZQA 2ZHWH 2VVUA 4JCNA 1AVWA 2OUAA 2ZCLP 3RXKA 5KEDA 4IN1A 1NPMA 5TJXA 1O5FH 4B76A 1GHVH 3E0NB 2O8UA 3GCTF 1H4WA 2Y5GA 1FPHH 2IN2A 3OTPA 4A5TS 2HNTF 1P2QA 1BMNH 1P0SH 1TLDA 1V2OT 1MQ6A 2NU2E 3LGVA 1UK2A 3OX7U 3RMNH 2FYQA 1NBME 1GDUA 5EW2H 1SGTA 3MQKC 1QY6A 3U8RH 1AKSA 5BPEA 5EIYA 5C2ZA 2J98A 2ZU2A 1CGHA 4INHA 4MPUA 2FOFA 1NFUA 1O2OA 4FUCA 2GZ9A 1H9HE 2VGCC 2ILNA 1GJ7B 2BHGA 2BQ6B 5DKMA 1GMCG 1G3DA 1T8LA 4E7NA 1O3LA 1O37A 7GCHF 2OC8A 2G5VA 2AH4X 3HKJB 3BEFB 4OS4A 2F9OA 4ZHMU 2KCAA 2IJOB 2GKVE 1TNLA 5DN6D 1N8OB 1P8VC 2ZTZA 2VIOA 4XE4A 1QFKH 1CHOG 1RGQA 1RTFB 5F8TA 1EKBB 2I6SA 2VB0A 3GCNA 1LQEA 1YLNA 3EDXB 2ZFFH 3RM2H 3ZVAA 1MTSA 2FEQH 4R0IA 3BEIB 3M5LA 3F9EA 1EB2A 3N99A 1FX0B 3S69A 1W0YH 1MTNB 1YPHE 1U6QA 2ZFRH 2FTMA 5EJLA 3PYHA 3RXMA 1RIWC 1F0TA 5KECA 1AFQB 4X1RU 1BMAA 2RCEA 1UCYH 3Q3XA 1SR5C 1EPTA 1YCPK 2TGAA 3SI4H 3P8NA 1HAPH 2XWBI 3FO8D 4ZHLU 4E7RG 1ELDE 5C20A 1A7SA 1HAOH 1GJ8B 1GHXH 2RFKC 3UAIC 3RXIA 3SBKA 5GWZA 4P00A 2JJ2D 3SUFA 1GHBG 3V3MA 1OP8A 2W3KA 5DP7A 1SGQE 2ZO3H 2LNCA 2H9TH 2PKSC 4INKA 2Z7FE 1SQRA 1TNIA 5E2PA 1O2YA 1JIRA 3ZZ9A 2QF5A 3GY5A 1HCGA 1N8OC 3K2UA 4B74A 3KNXA 3AVZA 3GY3A 4K8YA 5DPAA 1PQ7A 1FPCH 1VZQH 2RG3A 4X6MA 1G2MA 4FETA 1OXGA 2R2WU 1MTVA 2CMYA 2WUBA 4WH8A 5PTPA 4AOQA 1LPKB 1Z7KA 1V2JT 3Q3YA 2RDEA 3U9AH 1HYLA 1A46H 1DX5M 1FN8A 2BB4A 3TITA 1LHDH 1UVTH 3BTTE 1O2GH 2F83A 4TPIZ 3SGQE 2QAAA 2ZFQH 2QXGA 5DP5A 2J94A 1K22H 1O2KA 3BTEE 4UDWH 1TALA 4O3TA 4Y0ZE 2A7HA 2BLQA 2P94A 3NK8A 2KX4A 1D4PB 1VGCC 3ZVCA 2D1JA 1FY5A 5AF9H 2JKHA 1SG8B 2BX4A 4GPGA 1CA0B 3E91A 3E1XB 1YYY1 1KXDA 2QA9E 1SPJA 2C93B 1Y5BT 3V7TA 1MTWA 5GDSH 5JBAS 3M3TA 1W10U 1SBWA 1NFYA 2QF3A 4Q63A 4YOGA 1EAWA 9ESTA 2A5AA 2BD7A 4MQAA 5EU8A 3RU4E 2HRVA 1CGJE 3A7ZA 3FOAA 3VB6A 4A1VA 1IHTH 1P01A 6GCHG 3F6UH 1MBQA 1QRXA 1K0HA 1HAIH 1AU8A 1W0JD 5A0CA 1SLXB 1C5PA 4Y8YA 3URCA 3TJOA 3F3BA 1V2QT 2TGTA 4X2YA 1SGYE 2P16A 1DUEA 2Z9JA 1SLVB 4Q7XA 4ABBA 1FY3A 1UTKA 4ABIA 3SJOA 2UUJB 2XTTB 1HLTH 1BQYA 2PV9B 1W8BH 2A7JA 4R8TB 3L33A 1V2WT 2VWMA 2XW9A 4NWLA 1AD8H 4CR9A 3UB0A 1C1RA 1C2DA 1WU1A 1Z1IA 3RLWH 2BX3A 4TSFD 4NA9H 3RC4A 5EW1H 5C3NA 5GCHF 2V7QD 4BXWA 2PUXB 2H2ZA 1Y59T 1PPBH 3MO6A 4OS1A 2Q6FA 1A5GH 2UWPA 4LOYH 1VCQA 4XOJA 1HPGA 5EGMA 4IN2A 1FLEE 2J95A 1A61H 3MU4A 2C8ZB 1MH0A 1K1PA 1UVSH 1A5HA 1UHBB 4AGJA 4CBOA 4D9QA 1Y8TA 5LPFA 2RA0A 3LH1A 4X1PU 1YLDA 4NFFA 2M2AA 3KQCA 2BD8A 4K1EA 1GCDA 2VJ1A 1NFWA 3L3TA 1LHCH 3SV8A 3U28C 2J4IA 1AB9C 5I46H 3MWIU 1FNIA 2J9NA 3URDA 1PQ8A 3E90B 1ARBA 4H42U 5EOKA 1DE7H 3ZIAD 1YY3A 1L1JA 4D9RA 2IOTA 2H9HA 1FAXA 5KGOA 3RXTA 5GPIB 4YZUA 1SC8U 1KXEA 3LGUA 4AB9A 2Y7XA 5E2OA 5JPMH 5C1YA 3NCLA 2PGQB 1THRH 1Y3UA 1ESAA 1TOMH 1AKSB 2AS9A 1S6FA 3TVJB 2J98B 4WXVA 3T29A 1ELCA 2WHXA 3I78A 3ZZAA 4BAOB 1C1OA 2P59A 5C94A 1BTPA 2BOKA 2BD3A 3HPTB 3ZVGA 2XBYA 1ETRH 2OLGA 4OS6A 2OC1A 5GNDA 3BTDE 1TGNA 1HAHH 3I77A 3K65B 2F9UA 1S5SA 2BTCE 2ZG0H 4A7IB 4ZKOU 1JOUB 3RXFA 1KYNA 4M7GA 1UW7A 1ZMLA 1ZGVA 3K6YA 3K9XB 3DFJA 1HAYB 1XUKA 1YGCH 3VGCB 1GG6B 3DSOA 4NGAH 1N6YA 1LVYA 3TGKE 2FOHA 1BTHH 2ZEBA 3BV9B 5C1XA 1EX3A 6CHAC 3BTQE 1NU7B 1LKAA 4Y71A 2NU1E 1TRMA 4BAKB 4IW4E 5E0GA 1EP5A 3BG4B 4AFZA 4I33A 3SQHE 3TGJE 3UNQA 5C5OA 1MD7A 1SI5H 3H7TA 1SHHB 1WSSH 3IG6B 3SJIA 2B9LA 1O32A 1OYQA 1A2CH 3ENSB 3Q00A 1O3EA 3FANA 1P9UA 4X8SH 1C2LA 1A0LA 1YPKH 4GAWA 2OD3B 4Q7ZA 4WMDA 1EQ9A 1GBMA 1OSSA 1IQLA 1GI8B 1ZSKA 4HFPB 4JYUH 4A92A 4OGYA 1P2KA 3HK3B 4ZCNA 1BB0B 2OXSA 3LH3A 3SUDA 1J14A 2ODYB 1GJ5H 4OGXA 1DITH 5AFYH 1V2KT 1Z8JB 1P3EA 4MNVA 4AX9H 1TA2A 2PW8H 3SUGA 1P2MA 3VB3A 1GBDA 1GDNA 1YM0A 1AZZA 2I6QA 1EJMA 4DIHH 4I7YH 2K0QA 1ZJKA 3LONA 4WY3A 1AI8H 1TQ7B 4BTTB 1J9CH 1C1WH 3BTFE 5DK1A 1O5DH 1W12U 4GHTA 1KLIH 2GMTB 1EB1H 1GVZA 3F2GA 3RXUA 2A1DB 2SGPE 3GDVA 4ISLA 3RC5A 1ANCA 1WTHD 4NIYA 1G37A 2ZA5A 1MAYA 5G4BA 1TRNA 1D3DB 2WPMS 3A7YA 2Z3DA 3FVFB 4WVPE 5DP6A 3KHVA 1GGDC 1Y5UT 1NC6A 1V2VT 3M61U 1HXEH 1C4V2 2PGBB 4Y8ZA 1F0UA 2O8WA 1BBRE 1H9IE 4HTCH 2BD4A 4ZH8A 3RM0H 3PRBA 1ELGA 2H9EH 3LIWA 1G9IE 1GBTA 1V2MT 2EA3A 1QBNA 3UNRA 1TPOA 5HM2A 1JMOH 4MPXA 3Q76A 1ZJDA 1DICA 2Z94A 3BN9A 1ZZZA 1W0KD 1GBIA 1IQIA 2ZU5A 1GBKA 2FOEA 3BIVH 1K9OE 1F5KU 3UNSA 1OWDA 4IC6A 1C5VA 4Y7BA 1GI5A 2GCTB 1O3GA 7LPRA 1SGNE 2ZDKA 4Q7YA 1CU1A 1IQEA 2EC9H 3ZZ5A 4DT7B 2HGTH 4XD7D 1C2FA 2VIDA 2NU3E 2VIWA 3GCHB 3KN2A 5B6OA 2ZDMA 1FIWA 2QYIA 2W7SA 3ZV8A 1C9TA 1KTSB 1PQAA 1SGFA 1ZRBA 4BXSA 3KIDU 4KGAA 1K21H 1GMHF 1FQ3A 4NA8A 3EE0B 3GY7A 3DCLA 2ZHQH 3OFND 1PPFE 5E8EH 4I8HA 1SL3A 1LMWB 1C1NA 1Q31A 3E6PH 4MLFB 1QRZA 1PPZA 1FJSA 1TNGA 2BDHA 2ZPRA 3MYWA 2JETC 2ZHEH 5HYOA
chains in the Genus database with same CATH topology
3ESTA 1HJ8A 1F5RA 2ALVA 1O2JA 3BEUA 2ODQA 3P70B 1VITF 1G36A 1P11E 2D26C 1IQNA 1TWXB 1YLCA 5ETXA 2CHAB 4E05H 3RXPA 1GCTC 1GBCA 1KTTB 3S0NA 2HPQH 3RXDA 3UFAA 1BOQA 3BTWE 5ABWA 1E38B 3P6ZB 3BTKE 1HUTH 2O8TA 3RP2A 5A8ZA 2ZDVH 4MDSA 1YPMH 2QF0A 3EAJA 1P03A 1GI1A 1C1SA 1C2MA 1C1PA 2XC0A 4IMZA 5F8XA 4Z6AH 1P06A 3H7OA 1YCPM 1NRPH 1UTNA 1AE8H 2QXIA 2ZHDA 1ANEA 2LPRA 2C8XB 2J38A 3ZZ6A 4XBDA 1SMFE 2QC2A 3SV9A 2AFQB 1XVOA 2SFAA 4ISNA 2PSYA 2VU8E 1ZHMA 4BTUB 4TY7A 4LZ4B 3SUEA 3ODFA 2ZIQH 1GJ4H 1WUNH 1DFPA 1W7GH 3A80A 2WYJA 2J34A 4A1TA 5JB9S 2F3CE 2CHAC 2SGAA 1GJ9B 3UR9A 1ELTA 1FV9A 2J92A 5AVDA 1AVXA 1IQMA 1AY6H 5JBBS 4FVBA 5EXNA 1T8MA 2BVSH 2WPHS 3TIUA 1C5ZB 1BRBE 1C1UH 2A4OA 3E0PB 1E36B 1DDJA 3LGTA 2UUYA 2P3FH 4GHQA 2VGCB 3H5CB 3VB7A 4AYVB 2EEKA 1GI4A 3MH4A 2WPLS 1HJ9A 2HALA 1WV7H 2XBXA 4ABEA 3BSQA 3M7QA 3OU0A 2C90B 1Z6EA 4I31A 3I29A 5EXMA 4CRCA 1AMHA 4CREA 2GV6A 1O2QA 3RXHA 4RKJB 1DSTA 3SNCA 1UO6A 3O8BA 1BJUA 4TYDA 3RXAA 3MNXA 1O30A 3MO9A 1E35B 1LHGH 3A8CA 5FBIA 3LC3A 1TBQH 1P57B 1HV7A 3V12A 1W11U 4CRGA 2ZU4A 4UFFH 2PSXA 3NKKA 2BLVA 3SNAA 5FX5A 1K1IA 1RIWB 1PYTD 1BDAA 1HRTH 1C2EA 1TX7A 3TGIE 2TGPZ 4ABDA 1NROH 4ABHA 3D23A 1OKXA 3TNTA 5FPTA 4XBBA 4KTUA 2O9QA 3MU5A 3DD2H 1O2VA 2OC0A 3IWMA 4LZ1H 1C2GA 3MNBA 2AIPA 5EXLA 1XUIA 2QGRA 3OY6U 3UWIA 3A8AA 1GHAG 1BT7A 3F9GA 3LGWA 2UUFB 3SN8A 5JB8S 2V3HH 1QJ1B 2Z9GA 4GVUA 1QL7A 1O5EH 3TK9A 4F49A 4FUHA 7ESTE 2AMDA 3F9HA 2PKSB 1HIAA 2AYWA 2QIQA 1SLWB 2V6NA 4DCDA 1HAXB 3SNBA 1AWHB 4YM9A 1L2EA 4ZHAA 1QGFA 1V2UT 3BIUH 4MNXA 1SQTA 1K1JA 1O31A 1BTUA 3GY4A 2BY6X 2FESH 2HWLB 1RRKA 3GY8A 1CT2E 1SGEE 5AHGH 3SU4A 1J15A 1WYKA 1XUJA 3UTUH 3KCGH 2BQWB 1G2LA 1SFIA 2FODA 3F68H 3U98H 3M35A 5A2MH 3A89A 5J4SA 2P93A 2P3UB 3AW0A 3TK6A 1O3NA 1TBRH 2ZFSA 9LPRA 3RXCA 3OYPA 4ZAEA 2A5IA 1K1OA 3GCTG 5HXFA 4KKDA 5DO4H 1BUIA 1QCPA 1NRQH 1DM4B 6ESTA 1MQ5A 1UK3A 1ANBA 3A87A 2WPKS 1VGCB 1OWIA 1TNHA 4AG1A 5A8XA 2BD9A 3DT0H 3ZZCA 3GYMA 5LGOA 3MU0A 1C5MD 1QL9A 3BG8A 5AFZH 1BJVA 3P92A 3Q77A 1PYTC 1XUGA 1F92A 4X1QU 4X2XA 4UONA 2RA3A 1EAUA 3C1KA 1FAKH 2GP9B 1S81A 1ESBA 2ODPA 2BQ7B 1TX8A 1NESE 1CVWH 3V0XA 3O8CA 2ZGXH 1NM6A 3M7UA 1O2RA 2H5CA 3TJNA 4WWYA 2BVRH 1QIXB 2HLCA 2AMPA 2A4QA 2BDIA 4Z0KA 4CRBA 2ZGJA 3HK6B 1O3IA 4UFEH 1Z6JH 4B2BA 4CRDA 3AW1A 1C2JA 3A7XA 1ID5H 2XXLA 1UJ1A 1LHEH 3QO6A 3SU3A 4ABAA 2BYAX 1P02A 2VWLA 2STAE 5BRRE 1XM1A 2BXTH 2WPJS 2BDGA 4FU7A 1NY22 4QT8C 3SO3A 4FUEA 3M5MA 1VCPA 1GPZA 1QQ4A 1DOJA 4AFSA 4AGKA 4TWWA 1TGSZ 5IYTA 2H6MA 1H1BA 4DW2U 2TPIZ 3ZVDA 5CMXH 1AUJA 1RTLA 4K5ZA 1HJAC 1DWEH 1XXDA 2ASUB 1EAXA 4THNH 3MFJA 3ZYEA 2PLXA 4A1XA 1O2UA 3DA9B 2FI5E 2C8WB 5K0HA 2FDAA 1Y3VA 5DP4A 1ARCA 1BIOA 1GI9B 2A2XH 5EQQA 2M5TA 2Y5FA 3A8BA 7KMEH 3ODDA 4D7GA 1KXFA 2G81E 1AB9B 1T4UH 3SNEA 2ZNKH 4BTIB 2AEIH 1OWHA 1KXBA 2YOLA 1ZTJA 1NFXA 1ABIH 5A09A 2A0QB 1T8NA 2ZZUH 3EYDA 4JZ1A 1FY8E 4MG3A 3KQBA 1GHZA 1JBUH 4TWYA 1Y3XA 2GV7A 2OCVB 2FXRA 3T25A 1BZXE 1F2SE 1K1NA 1GI7B 3UQVA 3GY2A 2QV1A 2ZWLH 1PPCE 3GISB 1VJAU 3ATMA 5L2ZH 1T4VH 3A88A 4BOHA 4ZMAH 4XDEA 2GZ8A 3MH7A 1TGBA 2XRCA 2A45B 3A86A 1ELBA 1O2ZA 1GJDB 2Z3CA 4OS7A 3PTBA 2OBQA 2TIOA 3QLPH 3LT3A 1IQHA 1GBBA 2QN5T 2ZKSA 5GXPA 2BM2A 3E16B 2THFB 8ESTE 2Z3EA 4AG2A 3QGNB 4GCHG 1T31A 2BLOA 3SJ9A 2P3TB 1C9PA 3RXOA 3T26A 1O2IA 2Y5HA 2ZPSA 1SGCA 2BZ6H 2KAIA 1NZQH 3PV4A 1YF4A 6CHAB 2ZCHP 2NU4E 4UFDH 1P04A 2FOMB 1C2HA 2SGQE 3L6PA 1V3XA 3U69H 1RTKA 1S6HA 3SU2A 1AGJA 1EOJA 3UREA 3T28A 4ZKRU 4MNWA 4KELA 5LH8A 3EA7A 3B9FH 3ZZ8A 3HKIB 1MZDA 3SZNA 5C5NA 1WOFA 5HM9A 1BHXB 2UUKB 1AIXH 1SOZA 3ELAH 3CP7A 1YBWA 1EASA 2F9BH 1JXPA 1TFXA 3JZ2B 5CE1A 1ZHPA 3AAVA 1GDQA 1RS0A 2O8LA 2FLRH 4U01A 2GX4A 3DFLA 1L4ZA 2CV3A 5GCHG 2ZP0H 3HGPA 2TRMA 4AYYB 2FLBH 1S0QA 3QX5H 2AGGX 1DVAH 1HIAB 3PROA 1DWDH 5FX6A 4I8KA 2R9PA 2XCNA 1CBWC 1P2JA 3SV7A 3ZZ4A 3ZZDA 4X8TH 2YNAA 2B7DH 1SQOA 3SI3H 4D8NA 4B2CA 1SGDE 1UCYE 3R0FA 4YLUA 1C5OH 1D6RA 5ESBA 2CGAA 2GCHG 5GIBA 1GI6A 2A31A 2BZAA 3CS7A 4B71A 2PFEA 2Z9KA 1P2OA 1GMDF 4JK6A 4K2YA 3O8DA 4WXIA 3PWCA 4Y6DA 1YP9A 1GGDB 4GUXA 1V2ST 3MTYA 3LU9B 1O3KA 5FPYA 1WTGH 4JZFH 3KEEA 1SSXA 1ZMJA 4I8LA 5E0JA 4AFQA 1FUJA 1O38A 1GI2A 1JWTA 1OP2A 1CT0E 1O2XA 1T8OA 3FP8E 1OX1A 8KME2 1IQKA 3ITIA 3M3VA 2YNBA 3ATIA 4ABGA 1HDTH 1Q2WA 1RFNA 2VIQA 3KQEA 5DP9A 2A5KA 1BTXA 4X2WA 2CJIA 1T32A 1QHRB 1C5XB 1TIOA 1O2LA 4WMFA 3NUMA 1GVKB 1L1NA 1O2HA 5JYIA 1TNJA 1IHSH 1ZPZA 2ANYA 3QK1A 3F9FA 1D3TB 4MVNA 2ZECA 2BDYA 4AFUA 3UUZA 2Y7ZA 3KGPA 3RLYH 4K69A 5EPYA 1A0HB 1GI3A 1QQUA 3MU8A 3PO1C 4OS5A 1GBAA 3UOPA 2Y81A 1RJXB 1O39A 4LXBH 1XUHA 1AWFH 1NN6A 2ULLA 1IAUA 5SGAE 1UVPA 3PLBA 1BHXF 4RN6A 4RSPA 2ALPA 2BDAA 4NIWA 2JETB 3LPRA 3CENA 3NZIA 1QNJA 1TAWA 3M37A 4YT7H 1EAIA 1SGPE 1F7ZA 4H6SB 2ZDAH 1JIMA 3SGBE 2FYRA 1UTJA 1GCTB 1MU8B 1OWJA 1EZSC 1GJBB 1P05A 1O3HA 1TBZH 5LPEA 2Q6GA 3RMMH 3QTOH 3IITA 5CHAC 5T6GA 3U8OH 5A0AE 1E34B 2ZF0H 4CH2B 3QWCH 1X7AC 4B2AA 1ANDA 3M5OA 1DXWA 5EQSA 1IOEA 1ZPCA 3DUXH 1CO7E 1KIGH 2NU0E 1LHFH 4DG4A 4J1YA 1P3CA 5JBTA 1AO5A 1DS2E 1C4U2 4IGDA 2TGDA 2PKAB 1VR1H 3QZQA 1EZUC 1B5GH 2VNTA 4FXGH 4JZDH 3TJUA 1THPB 3HGNA 1EUFA 1TNKA 4ZXXH 3SV2H 3TU7H 4E06H 3U1JB 1AUTC 3SOSA 3RXRA 1Y5AT 3G01A 4YLQH 1QR3E 2BMGB 4Q2KA 4O9VA 1O5AB 1ESTA 1SGIB 4FUIA 1O3OA 2O8MA 1FY4A 1OS8A 2OBOA 1J8AA 2ZTYA 1C4Y2 1O36A 1DPOA 1O2WA 2H5DA 3LOXA 1A3EH 3M5NA 1A4WH 3NPSA 4CHAC 1K28D 2RDLA 1GL0E 2FO9A 2G8TA 1V2RT 1NU9A 1PFXC 5DP8A 1ZPBA 2VVVA 5EPNA 1B0FA 1AVGH 2EI8A 1DANH 1E37B 3M7TA 1YPHC 3PMBB 1C2KA 1LCYA 3S9CA 1JRSA 4B73A 3EA9A 3SU1A 1NRSH 3OTJE 2SGFE 3T2NA 2G00A 2BD2A 1CSOE 5L30H 4XSKU 1HBTH 4HZHA 1IQFA 3RU4D 4I8JA 1KXAA 3PMJA 5JBCS 3O8RA 3GYLB 3SNDA 2QXJA 3TK5A 3U8TH 3S7HB 3TH4H 1N6XA 1ZHRA 2KAIB 1G32B 2BOHB 1ORFA 2ZU1A 2ZGCA 1EXFA 1L1GA 1L4DA 1S83A 1V2NT 1O2MA 3E8LA 1MBMA 1LTOA 4FU9A 1GMHG 1UVOA 5C1UA 1Z1JA 2B0FA 1KY9A 1FN6A 2WPIS 3SV6A 2GDDA 5FXLA 8GCHF 3RXLA 2DE8A 1O0DH 2ZGHA 2Z6BD 1EOLA 4K3JA 1J16A 4PROA 4K8BA 4DGJA 3TNSA 4DY7B 2DUCA 1P2NA 1FI8A 2STBE 3QZRA 1FZZA 1QJ6B 2F91A 4CR5A 2K1QA 3UIRA 2TBSA 1AN1E 3ZZBA 3UPEA 4OS2A 2W26A 3QGJA 1TPSA 1INCA 2XBVA 1GBHA 2ZFTA 2CN0H 1W3CA 4K60A 2F9VA 2ZU3A 2F9PA 3ATLA 3PWBA 1SQAA 2HNTC 1Y3YA 1GL1A 1MU6B 3A7TA 1MAXA 2ZCKP 1GMCF 1GHAF 3S9AA 3RXGA 5A0BA 1UTOA 4Y76A 3M3SA 3RXEA 3A7WA 1AZ8A 3D65E 5JDUB 1KLJH 4TPYA 3SJ8A 4XFQA 1C5SA 2FX4A 5DP3A 3RU4T 5A8YA 4KP0A 1CHOF 1NT1A 1GJCB 2WYGA 1ZRKA 4MTBA 1ABJH 3D62A 4MNYA 4NSVA 3KL6A 4Y7AA 1TPAE 4D76A 1BBRK 1C1VH 1F5LA 2GT8A 1ACBE 1SHYA 1TABE 1K2I1 3SHAH 1ELEE 1WCZA 1A3BH 2PR3A 3FZZA 5TCAA 5T3HA 3A7VA 1J17T 2ZDLA 3ZZ3A 2OQ5A 2G4UA 2A7CA 3BF6H 4SGAE 3RMLH 2HPPH 4DOQA 4UD9H 4JZEH 3LC5A 1N1LA 4FU8A 1YPLH 1ELAA 2EI6A 1D3PB 4VGCC 3ZVFA 2Q6DA 1GHBF 1F0SA 1O3JA 3B23B 2ANMH 5E0HA 1O3CA 3EA8A 1L0ZA 2R0LA 1O2TA 2SNWA 1T7CA 2D8WA 1QURH 3MI4A 4K1SA 1QB9A 1P9SA 2ANWA 4GLYA 3PTNA 1AE5A 1CE5A 1A1RA 2A4GA 4U30A 2BY5X 2GTBA 1G3CA 1LPGB 1BMMH 4IMQA 4FUDA 5DGJA 2R3YA 3T62A 3WY8A 2BY9X 1AFEH 3FAOA 2ZTXA 4SGBE 1W0ZU 1GWAA 2ZQ1A 4D7FA 1BRUP 1KSNA 1OOKB 1YC0A 1O34A 2NWNA 1V2PT 3RXBA 2GD4B 4NA7A 2P8OB 2AIQA 1KDQB 3A82A 2ZFPH 3Q3KA 5FCKA 2JH6D 1K1LA 1BRAA 2ANKH 1GVLA 4A6LA 1QBOA 1MD8A 1P2IA 1Z8GA 3OSYA 3UWJH 3QUMP 2AGIX 4DJZB 4KTCA 1HJAB 3P8GA 3P8OA 2FS9A 1MKWH 3RUOA 3SQEE 1QBVH 1ZSJA 2BDCA 2QCYA 1Z8IB 4ZXYH 5K7RA 1O2PA 1C5NH 7GCHG 2JH5D 2FIRH 2BY7X 1UVUH 3TJVA 1JRTA 2W5EA 6GCHF 4YT6H 1BA8B 4X2VA 1BTYA 5L2YH 2VINA 3MH6A 2FPZA 3UY9A 4BANB 2UWLA 4I32A 3T27A 3MMGA 4FUGA 1FONA 1QB1A 3CS0A 3GY6A 1ZTLA 1UMAH 1O2NA 1UTQA 4JYTA 3N7OA 4WJG2 1DXPA 1C1QA 2FOBA 5HGGA 2P8OC 1EATA 2BD5A 1MTNC 3MNCA 4ABJA 4INLA 1FMGA 3SORA 3MNSA 3A8DA 4U32A 2PHBA 1AFQC 2SGEE 1LQDB 3RXJA 3VB4A 1TMBH 1WQVH 2CF8H 2HNTE 1V6DA 2OINA 1O3AA 3NXPA 2XYAA 2GVFA 3FP6E 3KQDA 2F9NA 5GJ4B 1H9LB 1QTFA 1TGCA 1PJPA 1ZLRA 2Y6TA 3LGYA 2FZZA 1TMTH 4BAMB 4FVDA 1BBRH 1H8IH 1SVPA 2PKAA 3RC6A 1C5YB 1OWKA 1GHWH 4GCHF 3K6ZA 3P17H 4B1TA 1O3DA 3MU1A 2FM2A 1XMNB 1XXFA 2V0BA 1OWEA